NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F026779

Metagenome / Metatranscriptome Family F026779

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026779
Family Type Metagenome / Metatranscriptome
Number of Sequences 196
Average Sequence Length 127 residues
Representative Sequence MVNIGDASEVNEENYVPVPEHKLKEYQKKEYEELVEKFKRECLKSYSVTRSGDVIKKFNLPSFQPLTEAHRENKMIDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFLGCMGPCYI
Number of Associated Samples 94
Number of Associated Scaffolds 196

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 59.46 %
% of genes near scaffold ends (potentially truncated) 68.88 %
% of genes from short scaffolds (< 2000 bps) 93.37 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.29

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (93.878 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere
(76.531 % of family members)
Environment Ontology (ENVO) Unclassified
(96.429 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant surface
(88.265 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 51.35%    β-sheet: 0.00%    Coil/Unstructured: 48.65%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.29
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 196 Family Scaffolds
PF03732Retrotrans_gag 0.51
PF14214Helitron_like_N 0.51



 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.39 %
UnclassifiedrootN/A5.61 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300009092|Ga0105250_10188100All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum868Open in IMG/M
3300009973|Ga0105136_109527All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum587Open in IMG/M
3300009975|Ga0105129_119254All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300009981|Ga0105133_131614All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum506Open in IMG/M
3300009989|Ga0105131_126171All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum604Open in IMG/M
3300009990|Ga0105132_116828All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum687Open in IMG/M
3300009990|Ga0105132_141502All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300009992|Ga0105120_1013053All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum840Open in IMG/M
3300009992|Ga0105120_1024564All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum684Open in IMG/M
3300009992|Ga0105120_1026273All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum670Open in IMG/M
3300009992|Ga0105120_1029653All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum644Open in IMG/M
3300009992|Ga0105120_1032379All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300009994|Ga0105126_1004453All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1151Open in IMG/M
3300009994|Ga0105126_1022117All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum699Open in IMG/M
3300009994|Ga0105126_1043837All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300009994|Ga0105126_1048820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300009995|Ga0105139_1002526All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1739Open in IMG/M
3300009995|Ga0105139_1080312All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum614Open in IMG/M
3300009995|Ga0105139_1089588All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum586Open in IMG/M
3300010371|Ga0134125_13085531All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum505Open in IMG/M
3300010396|Ga0134126_11460317All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum754Open in IMG/M
3300014968|Ga0157379_11598817All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum636Open in IMG/M
3300014968|Ga0157379_12369808All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum529Open in IMG/M
3300015270|Ga0182183_1051376All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum613Open in IMG/M
3300015273|Ga0182102_1009539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum760Open in IMG/M
3300015280|Ga0182100_1000925All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1956Open in IMG/M
3300015280|Ga0182100_1027054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum774Open in IMG/M
3300015284|Ga0182101_1075597All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum556Open in IMG/M
3300015284|Ga0182101_1080328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300015290|Ga0182105_1039005All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum713Open in IMG/M
3300015290|Ga0182105_1108406All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300015293|Ga0182103_1060197All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum604Open in IMG/M
3300015293|Ga0182103_1095062All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum519Open in IMG/M
3300015297|Ga0182104_1035326All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum766Open in IMG/M
3300015301|Ga0182184_1014075All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum959Open in IMG/M
3300015306|Ga0182180_1052027All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300015309|Ga0182098_1027109All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum844Open in IMG/M
3300015309|Ga0182098_1129736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300015310|Ga0182162_1030155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum838Open in IMG/M
3300015310|Ga0182162_1101425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum552Open in IMG/M
3300015311|Ga0182182_1046910All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum705Open in IMG/M
3300015312|Ga0182168_1002114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1812Open in IMG/M
3300015313|Ga0182164_1034133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum832Open in IMG/M
3300015313|Ga0182164_1050284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum731Open in IMG/M
3300015313|Ga0182164_1094762All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum582Open in IMG/M
3300015313|Ga0182164_1128809All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum516Open in IMG/M
3300015315|Ga0182120_1002478All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1761Open in IMG/M
3300015315|Ga0182120_1017848All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1029Open in IMG/M
3300015315|Ga0182120_1053644All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum720Open in IMG/M
3300015315|Ga0182120_1087155All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum604Open in IMG/M
3300015317|Ga0182136_1034695All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum834Open in IMG/M
3300015317|Ga0182136_1119438All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300015319|Ga0182130_1028201All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum866Open in IMG/M
3300015319|Ga0182130_1046313All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum740Open in IMG/M
3300015319|Ga0182130_1067063All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum654Open in IMG/M
3300015319|Ga0182130_1082563All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum608Open in IMG/M
3300015319|Ga0182130_1101936All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum563Open in IMG/M
3300015320|Ga0182165_1003957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1636Open in IMG/M
3300015320|Ga0182165_1040852All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum811Open in IMG/M
3300015320|Ga0182165_1116503All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum553Open in IMG/M
3300015324|Ga0182134_1060134All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300015324|Ga0182134_1092351All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum606Open in IMG/M
3300015326|Ga0182166_1038172All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum810Open in IMG/M
3300015326|Ga0182166_1081400All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum627Open in IMG/M
3300015327|Ga0182114_1057547All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum757Open in IMG/M
3300015327|Ga0182114_1108054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum596Open in IMG/M
3300015327|Ga0182114_1145667All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum526Open in IMG/M
3300015328|Ga0182153_1039081All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum828Open in IMG/M
3300015328|Ga0182153_1080714All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum645Open in IMG/M
3300015328|Ga0182153_1098337All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum599Open in IMG/M
3300015328|Ga0182153_1137939All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum524Open in IMG/M
3300015329|Ga0182135_1030017All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum913Open in IMG/M
3300015329|Ga0182135_1037226All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum851Open in IMG/M
3300015330|Ga0182152_1058514All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum731Open in IMG/M
3300015330|Ga0182152_1090769All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum623Open in IMG/M
3300015330|Ga0182152_1134879All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300015331|Ga0182131_1076323All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum667Open in IMG/M
3300015331|Ga0182131_1094977All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum614Open in IMG/M
3300015331|Ga0182131_1129508All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300015331|Ga0182131_1132571All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum538Open in IMG/M
3300015333|Ga0182147_1034474All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum919Open in IMG/M
3300015333|Ga0182147_1130308All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum562Open in IMG/M
3300015334|Ga0182132_1079242All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum687Open in IMG/M
3300015335|Ga0182116_1010204All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1400Open in IMG/M
3300015335|Ga0182116_1045102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum877Open in IMG/M
3300015335|Ga0182116_1084169All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum694Open in IMG/M
3300015335|Ga0182116_1098717All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum651Open in IMG/M
3300015337|Ga0182151_1114979All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum585Open in IMG/M
3300015338|Ga0182137_1128534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum581Open in IMG/M
3300015338|Ga0182137_1132179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum574Open in IMG/M
3300015338|Ga0182137_1150887All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum542Open in IMG/M
3300015339|Ga0182149_1042772All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum869Open in IMG/M
3300015339|Ga0182149_1059891All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum769Open in IMG/M
3300015339|Ga0182149_1079671All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum692Open in IMG/M
3300015339|Ga0182149_1081942All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum685Open in IMG/M
3300015339|Ga0182149_1089815All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum661Open in IMG/M
3300015339|Ga0182149_1098061All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum639Open in IMG/M
3300015339|Ga0182149_1105114All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum621Open in IMG/M
3300015340|Ga0182133_1047868All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum878Open in IMG/M
3300015340|Ga0182133_1098058All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum670Open in IMG/M
3300015340|Ga0182133_1121081All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum615Open in IMG/M
3300015340|Ga0182133_1121091All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum615Open in IMG/M
3300015340|Ga0182133_1157593All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum549Open in IMG/M
3300015348|Ga0182115_1127023All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum811Open in IMG/M
3300015348|Ga0182115_1221390All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum605Open in IMG/M
3300015348|Ga0182115_1248905All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum565Open in IMG/M
3300015348|Ga0182115_1278260All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300015349|Ga0182185_1061985All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1011Open in IMG/M
3300015349|Ga0182185_1064636All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum995Open in IMG/M
3300015349|Ga0182185_1123984All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum757Open in IMG/M
3300015350|Ga0182163_1085787All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum941Open in IMG/M
3300015350|Ga0182163_1114425All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum827Open in IMG/M
3300015350|Ga0182163_1294179All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum508Open in IMG/M
3300015352|Ga0182169_1307096All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum510Open in IMG/M
3300015353|Ga0182179_1032420All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1328Open in IMG/M
3300015353|Ga0182179_1122013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum796Open in IMG/M
3300015353|Ga0182179_1137572All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum755Open in IMG/M
3300015353|Ga0182179_1211032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum620Open in IMG/M
3300015353|Ga0182179_1234290All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum590Open in IMG/M
3300015354|Ga0182167_1030084All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1729Open in IMG/M
3300015354|Ga0182167_1110805All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1007Open in IMG/M
3300015354|Ga0182167_1206853All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum717Open in IMG/M
3300015354|Ga0182167_1231959All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum669Open in IMG/M
3300015354|Ga0182167_1323504All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum543Open in IMG/M
3300017408|Ga0182197_1058010All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum725Open in IMG/M
3300017412|Ga0182199_1004267All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1837Open in IMG/M
3300017412|Ga0182199_1087200All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum700Open in IMG/M
3300017412|Ga0182199_1088609All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum696Open in IMG/M
3300017412|Ga0182199_1089602All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum693Open in IMG/M
3300017412|Ga0182199_1103476All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300017412|Ga0182199_1179697All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum530Open in IMG/M
3300017414|Ga0182195_1199396All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum525Open in IMG/M
3300017421|Ga0182213_1085333All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum872Open in IMG/M
3300017421|Ga0182213_1165921All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum624Open in IMG/M
3300017421|Ga0182213_1212859All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum551Open in IMG/M
3300017421|Ga0182213_1241842All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum517Open in IMG/M
3300017422|Ga0182201_1068534All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum651Open in IMG/M
3300017432|Ga0182196_1061440All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum695Open in IMG/M
3300017432|Ga0182196_1092885All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum604Open in IMG/M
3300017432|Ga0182196_1105102All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum578Open in IMG/M
3300017435|Ga0182194_1045693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum788Open in IMG/M
3300017439|Ga0182200_1139272All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum534Open in IMG/M
3300017439|Ga0182200_1156003All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum512Open in IMG/M
3300017440|Ga0182214_1140846All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum532Open in IMG/M
3300017445|Ga0182198_1158494All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum555Open in IMG/M
3300017445|Ga0182198_1180778All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum527Open in IMG/M
3300017446|Ga0182217_1085693All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum737Open in IMG/M
3300017447|Ga0182215_1121589All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum591Open in IMG/M
3300017447|Ga0182215_1175324All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum501Open in IMG/M
3300017691|Ga0182212_1098032All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum657Open in IMG/M
3300020023|Ga0182178_1011054All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum645Open in IMG/M
3300026088|Ga0207641_10740875All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum970Open in IMG/M
3300028049|Ga0268322_1021539All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum694Open in IMG/M
3300028049|Ga0268322_1037665All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum580Open in IMG/M
3300028050|Ga0268328_1005737All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1133Open in IMG/M
3300028050|Ga0268328_1050709All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum573Open in IMG/M
3300028056|Ga0268330_1000358All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum2621Open in IMG/M
3300028056|Ga0268330_1056247All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum523Open in IMG/M
3300028064|Ga0268340_1029623All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum737Open in IMG/M
3300028142|Ga0268347_1002844All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1047Open in IMG/M
3300028143|Ga0268348_1012640All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum631Open in IMG/M
3300028143|Ga0268348_1023264All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum522Open in IMG/M
3300028151|Ga0268308_1000905All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1600Open in IMG/M
3300028262|Ga0268310_1053123All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum500Open in IMG/M
3300028467|Ga0268333_1008905All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum581Open in IMG/M
3300028468|Ga0268317_1001328All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum987Open in IMG/M
3300028468|Ga0268317_1006439All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum619Open in IMG/M
3300028469|Ga0268337_1018735All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum513Open in IMG/M
3300028470|Ga0268307_1017726All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum560Open in IMG/M
3300028476|Ga0268329_1009362All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum707Open in IMG/M
3300028529|Ga0268311_1005468All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum842Open in IMG/M
3300032465|Ga0214493_1066284All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum858Open in IMG/M
3300032465|Ga0214493_1095177All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum708Open in IMG/M
3300032465|Ga0214493_1100882All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum685Open in IMG/M
3300032466|Ga0214503_1253782All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum544Open in IMG/M
3300032490|Ga0214495_1019543All Organisms → Viruses → Predicted Viral1461Open in IMG/M
3300032625|Ga0214501_1291906All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum515Open in IMG/M
3300032697|Ga0214499_1000332All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum5920Open in IMG/M
3300032761|Ga0314733_1072458All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum658Open in IMG/M
3300032790|Ga0314731_1036736All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum821Open in IMG/M
3300032845|Ga0314727_1055013All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum533Open in IMG/M
3300032875|Ga0314737_1014613All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1266Open in IMG/M
3300033526|Ga0314761_1037600All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1053Open in IMG/M
3300033531|Ga0314756_1013957All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum1380Open in IMG/M
3300033533|Ga0314770_1257133All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum547Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Switchgrass PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere76.53%
PhyllosphereHost-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere10.20%
Switchgrass AssociatedHost-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated9.69%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil1.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.02%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300005843Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2Host-AssociatedOpen in IMG/M
3300009092Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaGHost-AssociatedOpen in IMG/M
3300009973Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_222 metaGHost-AssociatedOpen in IMG/M
3300009975Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaGHost-AssociatedOpen in IMG/M
3300009981Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaGHost-AssociatedOpen in IMG/M
3300009989Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_197 metaGHost-AssociatedOpen in IMG/M
3300009990Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_206 metaGHost-AssociatedOpen in IMG/M
3300009992Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_108 metaGHost-AssociatedOpen in IMG/M
3300009994Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_171 metaGHost-AssociatedOpen in IMG/M
3300009995Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_227 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010396Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2EnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015270Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015273Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015280Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015284Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015290Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015293Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015297Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015301Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015306Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015309Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_09MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015310Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015311Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015312Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015313Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015315Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015317Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015319Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015320Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015324Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015326Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015327Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015328Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015329Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015330Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015331Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015333Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015334Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015335Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015337Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015338Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015339Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015340Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015348Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015349Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015350Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015352Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015353Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300015354Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017408Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017412Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017414Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017421Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017422Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017432Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017435Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017439Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017440Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017445Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017446Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017447Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300017691Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_03OCT2016_LD1 MGHost-AssociatedOpen in IMG/M
3300020023Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_22AUG2016_LD2 MGHost-AssociatedOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028049Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028050Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028056Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028064Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028142Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_28AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028143Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_18SEP2017_LD1Host-AssociatedOpen in IMG/M
3300028151Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028262Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028467Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028468Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_26JUN2017_LD1Host-AssociatedOpen in IMG/M
3300028469Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_07AUG2017_LD1Host-AssociatedOpen in IMG/M
3300028470Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_15MAY2017_LD1Host-AssociatedOpen in IMG/M
3300028476Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1Host-AssociatedOpen in IMG/M
3300028529Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1Host-AssociatedOpen in IMG/M
3300032465Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032466Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032490Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032625Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032697Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032757Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032761Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032790Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032823Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032845Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_05JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300032875Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033526Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033531Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033533Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_18SEP2017_LR1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0068860_10273636913300005843Switchgrass RhizosphereMTMIGEIDEGNYVPVEEDKLKEDQQKELREAVDKYKQESLMSYSSTRSGDVVKKFDFPKLQPLTETQHENKMTDTIYQAGGQAFVKSATVMGNILHNAVVKTFAEGTFPDCVGPSYIQPDQMNFD
Ga0105250_1018810013300009092Switchgrass RhizosphereVLIFASTHLLARSMGPQSFNMVELTDKSAVSEENQIPVPEDKLKEEQKKKYEELVERFKRECLKLYSVNRSGEVIKKFNLPSFQPLTEAQRESKMIDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTLSGCMSPYYIQSDQMQYTPLEVSMA
Ga0105136_10952723300009973Switchgrass AssociatedEEQEKEYEELVEKFKRECLKSYSINRSGKVIKKFDLPTFQPLKEAQHENKMMDAVGQAVAQAFIKSATVMDNTVHNTVVKTFAEGTLPGCMGPCYVQPDQMQYIPLEASMAAALSAQDS*
Ga0105129_11925413300009975Switchgrass AssociatedGTPSGTESFNMVEITDKSAVSEENHIPVLKDKLKEEQKKEYEEVVEKFKRECLKSYSVNRSGEVIKKFDLPTFQPLTEAQHENKMMDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPDCMGPCYI*
Ga0105133_13161413300009981Switchgrass AssociatedMVDITDKSAIIEENHIPVPEDKLKLEQKKEYEELVEKFKRECLKSYSITRSGGVIKKFDLPSFQPLIEAQRDNKMMDAVGQAVAHAFIKSATVMGNMVHNAIVKTFADGMFTGCMGPCYI
Ga0105131_12617113300009989Switchgrass AssociatedAISEENQIPVLEDKLKEEQKKEYDELVEKFKSECLKSYSVNRSGEVIKKFNLPSFQSLTEAQHESKMIDTVGQAVAKAFIKSATVMVNTVHNAVV*
Ga0105132_11682813300009990Switchgrass AssociatedMVELDDPSAVNEENYVPVPGDKLKEDQRKEYEELVENFKRECLKSYSNTRSGDVIKKFNLPSFQPLTEAQHENKIMDAVGQAVAQVFIKSATVMGNTVHNAVVKTFTEGTFLGCMVPCYI
Ga0105132_14150213300009990Switchgrass AssociatedMAKISTKTEVHEDNYVPIEEDKLKEDQQKEYLEAVEKYKRECLKSYSITRSGDVIKKFDLPSFQPLTETQHENKMIDAVSQAVAQVFVKSSTVMGTAVHNAI
Ga0105120_101305323300009992Switchgrass AssociatedFNMTRIGDEIEVNEDNYVPVGENMLKEDQHKEYLEVIERYKRECLKSYSTTRSGDVIKNFDFPSFQPLTEAQRENKMVDTISQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPNCVGPCYIQPD*
Ga0105120_102456413300009992Switchgrass AssociatedVDFCVNTSFGTPDGTESFKMAELGDPSVVNEENYVLVPEDKLKEDQKKEYEELVEKFKRECLKSYSVTRSGDVIKKFNLPSFQPLTEAQRENKMMDAVGQAVAQAFVKSSKVMGNTLHNAVVKTFAE
Ga0105120_102627323300009992Switchgrass AssociatedMVEFGDQSEVNEGNYVPVDEDKLKEDQKQEYLDLVERFKSECLKSYNVTRSGDMIKKFNLSSFQPLTEAQRDNKMIDVVSQAVAQAFVKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYIQPD*
Ga0105120_102965323300009992Switchgrass AssociatedMVEFTDKSAVSEENHIPIPEDKLKEEQKKEYEELVERFKCECLKSYNVNRSGKVIKKFDLPTLQPLTEAQHENKMMDAVGQAVAQAFIKSAIVMGNTIHNAV
Ga0105120_103237923300009992Switchgrass AssociatedYIPVDEDKLKEDQKNELLEVVEKFKRECLKSYSVTRYGDVIKKFNLPSFQPLSETQRENKMMDAVGQAVAQAFVKSATVMGNIVQNAVVKTFAEGTFPGCMGP*
Ga0105126_100445313300009994Switchgrass AssociatedGGTESFNMVDITDKSAVSEENQIPVPEDKFKEEDKKEYEELVEMFKHECLKLYSITRSGEVIKKFDLPSFQLLTEAQRENKMVDVVGQAVAQAFIKSATVMGNTVHNAVVKTFAEDTFPGCMGPCYIQPDQMQYIPFEVSMVAALLAQIS*
Ga0105126_102211713300009994Switchgrass AssociatedMMEIIDKSTVSEENQILVPEDMLKEEQKKEYEELVEKFKRECLKSYSVTRSSEVIKKFDHPSFQPLIKAQRENKMIDVVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFQG*
Ga0105126_104383713300009994Switchgrass AssociatedLALGFQCVDFCVNTSFGTPGGTESFNMVDIGDASKVNEGNCVPVDEDKLKEDQKQEYLELVERFKRECLKSYSVTRSGNLPSFQPLTEAQRDNKMIDAVSQAVAQAFVKSATVMGNTVHNAVVKTFAEGTFPDYMGPCYI*
Ga0105126_104882013300009994Switchgrass AssociatedMAKISTETEVNEDNYVPVDENKLKEDQQKEYLEAVERYKRECLKSFNTTRSGDVTKKFDFPSFQSLTEVQHENKMIDTVSQAVAQAFIKSTTVMGNTVHNAVVKTF
Ga0105139_100252643300009995Switchgrass AssociatedMVDIGDASEVNKGNYVPIDEDKLKEDQKQEYLELVERFKRECLKSYSVTRSGDVIKKFNLPSFQPLTEVQRDNKMIDAVSLAVEQAFVKSATVMGNTVHNAVVKTFAEGTLPGCMGPCYI
Ga0105139_103222313300009995Switchgrass AssociatedVTIIGEIDEGNYVPVEEDKLKEDQQKEYLDAVEKYKRECLKSYNTTRSGEVVKKFDFPSFQPFTETQRENKMTDTIYQAMGQAFIKSATVMGNTVHNAVVKTFAEDTFPGCVGASYIQPDQMNFVLLEMAMAAALSAPN
Ga0105139_108031223300009995Switchgrass AssociatedMTIISEVDDDNYVPVEEDKLKEDQQKEYLEAVERYKRECLKSYSMTRSGDVIKKFDFPSFQSLTEAQRDNKMIDAVSQAVAQAFIKSATVMGNTVHNAVVKTFAKGTFPGCMGPCYIQPD
Ga0105139_108958813300009995Switchgrass AssociatedMVDITDKSAVSEENHIPVPEDKLKEEQKKEYEELVERFKRECLKSYSINRSGKVIKKFDLPTFQPLKEAQHENKMMDAVGQAVAQAFIKSATVMDNTVHNTVVKTFAEGTFLGCMGPCYIQPDQMQYVPLEISMAAALSAQNSQAGT
Ga0134125_1308553123300010371Terrestrial SoilVPEDKLKEDQKKEYEELVEKFKRECLKSYSVTRSGDMIKKFNLPSFQPLTEAQCEGKMIDAVDQAVAQAFIKSATVMGNTMHNAVVKTFAEGTFPGCMGPCYI*
Ga0134126_1146031723300010396Terrestrial SoilMVDITEKSVVSEENQIPIPKDNLKEEQKKEYEELVEKFKRECLKSYSVARSGEVIKKFDLPTFQPLTEAQHENKMMDAVGQAVAQAFIKSATVMGNTVHNTVVKTFAEGTLPECMGPCYIQPDQM*
Ga0157379_1159881713300014968Switchgrass RhizosphereMTKPVDAASVSEENYVPVDESKIKEDQQKELFEAMEKYKRECLKSFSATRYGDVVKKFDFPTLQPLTEAQHENKMIDTVHQAMGHAFIKSASVMGNAVHNAVVKTFAEGTFPGCVEP
Ga0157379_1236980813300014968Switchgrass RhizosphereLVDFSELGEHLPSDSSVLIFASTHLLELGDHSEVNEGNYIPVDEDKLKEDQKQEYLELVERFKRECLKSYSVTRSGDVIKKFNLPSFQPLTEAQCDNKMMDAVSQAVAQAFVKSATVMSNTVHNAVVETFAEGTFLGCM
Ga0182183_105137623300015270Switchgrass PhyllosphereMVEITDKSAVSEENQIPVPEDKLKEKQKKEYEELVERFKCECLKSYCVNRSGEVIKKFNLLFFQPLTEAQCESKMIDAVGQSVAQAFIKSATIMGNMVHNAVVKTFAEGT
Ga0182102_100953913300015273Switchgrass PhyllosphereMKKTTFLFLKTSSKKIRKEYEELVEKFKRECLKSYSVTRSGDMIKKFNLPSFQPLTEAQHKNKMMDAVGQAVAQAFVKSATVMGNIVHNAVVKTFAEGTFPGCMGPFCI*
Ga0182100_100092533300015280Switchgrass PhyllosphereMVDITDKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEDRSA*
Ga0182100_102705423300015280Switchgrass PhyllosphereMVELTDKSEVNEENYVPVPEDKLKEDQKKEYEVLVEKFKRECLKSYSVTRSGDVIKKFNLPSFQPLTEAQREGKMIDVVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYIQPDQI*
Ga0182101_107559713300015284Switchgrass PhyllosphereMVDITDKSAVSEENQIPVPEDKLKEEQKKEYEELVEKFKCECLKSYSITRSGDVIKKFDLPSFQPLTEAQHESKMIDAVGQAMAQAFTKSATVMGNTVHNAIVKTFAEGTLPG
Ga0182101_108032813300015284Switchgrass PhyllosphereSSNMTKTGAESEVSEDNYIPADESKLKEDQQKKYLEAVERFKRECLKSYSVTRSGEVIKKFSLPSFQPLTEAQRESKMIDTVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYIQPDQI*
Ga0182105_103900523300015290Switchgrass PhyllosphereMVDIGDASEVNEGNYVPVGENKLKEDQKKEYLELVEKFKHECLKSYSVTRSGDVIKKFNLPSFQPPTEAQCDNKMIDAVSQAVAKAFVKSAIVIGNTVHNAVVKTFVEGTFPGCMDLVTYSQIRCNISP*
Ga0182105_110840613300015290Switchgrass PhyllosphereMVDITDKSELSEENYIPIPEDKLKEDQKKEYEECVEQFKRECLKSYSITRSGDVIKKFNLPSFQPLTETQRENKMMDAVGQAVAQAFVKSATVMGNTVHNALVQTFAEGTFSGCMGPYYI
Ga0182103_106019713300015293Switchgrass PhyllosphereNTFFGMPGWTENFIMVDIIDKSAVNEENQIPVPKDNLKEEQKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA*
Ga0182103_109506213300015293Switchgrass PhyllosphereMVDITDKSEVNGENYVPVPEDKLKGEQKKEYEEFVEKFKCECLKSYSISRSGEVIKKFNLPSFQPLTEAQRENKMIDAVGQAVAQAFIKSATVMGNMAHNAVVKTFAEGTFPGCMGPCYIQLDQMPYIPI
Ga0182104_103532613300015297Switchgrass PhyllosphereMVDIGDASEVSEDNYIPVDENKLKEDQKQEYQDLVERFKRECLKSYNITRSGDVMKKFNIPSFQPLTEAQRDNKMIDAVSQAVAQAFVKSAIVMDNTVHNAVVKTFGEGTFPGCIGPC
Ga0182184_101407533300015301Switchgrass PhyllosphereMVELGDHYEVNEENYVPVPKDKLKEDQKQEYLELVEKFKRECLKSYSVTRSGDVIKKFNLPSFQPPTEVQCDNKMIDAVSQAVAKAFVKRTTVMGNTVHNAVVMTFVEGTFPGCVGLVTYSQIRCNISP*
Ga0182184_108812213300015301Switchgrass PhyllosphereVLGEHLPLDSSLLIFMSTYLLARAVGHESFNMVELIDKSAVSEENQIPIPEDKLKEEQKKEYEELVEKFKCECLKSYSVNRSGEVIKKFNLPSFQPLTEAQRENKMMNAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYIQPDPIQYVSL
Ga0182180_105202723300015306Switchgrass PhyllosphereMVQIGDKSEVSENNYVSADESKLKEDQKQEYLDLVERFKLECLKSYSVTRSGDVIKKFNLPSFQPLTEAQRDNKMIDAVSQAVAQAFVKSTTVMGNTVHNVVVKTFAEGTFPGCMGPCYIQLDQMQYTPL*
Ga0182098_102710913300015309Switchgrass PhyllosphereMVDITDKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKCECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA*
Ga0182098_112973613300015309Switchgrass PhyllosphereVKKNQIPIPEDKLKEEQKKEYEELVEKFKRECLNSYSVTRSGEVIKKFNLPSFQPLTEAQRENKMMDAVGQAVAQAFIKSATVMGNTVHNAVVKTF
Ga0182162_103015523300015310Switchgrass PhyllosphereMTIISEVDDANYVPVEEDKLKEDQQKEYLEAVEKYKRECLKSDSVTRSGDVIKKFDFPSFQPLKEAQRDNKMIDAVSQAVAQAFIKSVTVMGNTVHNAVVKTFTEGTFPGCMGPC*
Ga0182162_110142523300015310Switchgrass PhyllosphereMVDIGDKSEVNEDNYVPVDERKLKEDQQKEYFGLVERFKRECLKSYSVTRFGDIIKKFSLPSFQPLTEAQRDNKMIDAMSQAVAQAFVKSATVMGNTVHNAVVKTFAEGMFPGCMGPCYVQLDQMQYIPLEVSMAAALSAQNS
Ga0182182_104691013300015311Switchgrass PhyllosphereMVELGDHSEVNEENYIPIPEDKLKEEQKEYKELVEKFKCECLKSYSVTRSGDVIKKFNLSSFQPLTEAQSENKMIDAVGQAVAQAFVKSATVMSNTVQNVVVKTFAEGTFLGCMGPCY
Ga0182168_100211443300015312Switchgrass PhyllosphereMVDITDKSAVNEENQISVPKDNLKEEKKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA*
Ga0182164_103413313300015313Switchgrass PhyllosphereMTIIGEIDEGNYVPVEEDKLKEDQQKEYLDAVEKYKRECLKSYNTTRSGEVVKKFDFPSFQPFTETQRENKMTDTIYQAMGQAFIKSATVMGNTVHNAVVKTFAEGTFPGCVGPSY
Ga0182164_105028423300015313Switchgrass PhyllosphereMVDITDKSELNEENYVPVPEDKLKEDQKKEYEKHVEQFKCECLMSYSITRSGDVIKKFNLPSFQPLTETQRENKMMDAVGQAVAQAFVKTATVMGNTVHNAVVKTFAEGMFPGCMGPCYIQSN*
Ga0182164_109476213300015313Switchgrass PhyllosphereMVDITDKSAVSEKNQIPVPEDKLKEEQKKEYEELVEKFKYECIKSYSVTRSGEVINKFDLPSFQPLTEDQRENKLMDAVGQAVAQAFIKSATVMGNTVHNAVVKTFTEGTFLGCMSPCY
Ga0182164_112880913300015313Switchgrass PhyllosphereMVQIGAESEVSEDNYVHVDESKLKEDQQKEYLEAVERYKRECLKSYSVTRSGDVIKKFDLPSFQPLTEAQRENKMVDSISQVVAQAFIKSAIVMDNTVHNAVVKTFAEGTFPGCVGPCYIQPDQMNYVPLDVTVAAALS
Ga0182120_100247823300015315Switchgrass PhyllosphereMVDITDKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA*
Ga0182120_101784813300015315Switchgrass PhyllosphereMTRIVDETEINEDNYVPIDGNKLKEDQQKEYLEAVERYKHECLKSYSTTRSGDVIKKFDFPSFQPLTEAQCENKMVDMISQAVAQAFISSAIVMGNTVHNTVVKTFVEGT
Ga0182120_105364413300015315Switchgrass PhyllosphereMVDISDKSAVSEENQIPVPEDKLKEEQKKKYEELVEKFKRECLKSYNINRSGEVIKKFDLPTFQPLTEAQHENKMMDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYIQPN*
Ga0182120_108715513300015315Switchgrass PhyllosphereLVDFSELGEHLPSDSSVLIFCVNTSFGTPSGTESFNMVDITNKSEVNGENYVPVPEDKLKEDQKKEYEELVEKFKRECLKSYSVTRSGDVIKKFNLPSFQPLIEAQRENKMMDAVGQAVAQAFIKSATVMGNTVHNVVVKTFTEGTFPGCMGACYIQPNQI*
Ga0182136_103469513300015317Switchgrass PhyllosphereMVKIGAESEVSEDNYVPVDESKLKEDQQKEYLEAVERYKREFLKSYNTTRSGDVIKKFDFPSFQPLTEAQRDNKMIDAVSQAVSQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYIRPDQMNYVPLEVSMAAA
Ga0182136_111943823300015317Switchgrass PhyllosphereDHYEVNEENYVPVPKDKLKEDQKQEYLELVEKFKRECLKSYSVTRSGDVIKKFNPPFFQPLTEAQCENKMIDAVGQAVAQAFVKSATVMGNTLHNAVVKTFAEGTFPECMGPCYV*
Ga0182130_102820113300015319Switchgrass PhyllosphereMVDITDKSAASEENQIPIPEDKLKEEQRKEYEELVEKFKRKYLKSYSVNRSGEVIKKFNLSSFQPLTEAQREIKMMDAVGQDVAKAFIKSATVMGNTVHNAMVKTFAEGTFPGCMGP
Ga0182130_104631313300015319Switchgrass PhyllosphereMARIGDETEVNEDKYIPIDENKLKEDQQKEYLEAVERYKRECLKSYTMTRSGDVIKKFDFSSFQPLTEAQCENKMVDTISQVVAQAVIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYIKPDQMNYVPVEVSMAAA
Ga0182130_106706313300015319Switchgrass PhyllosphereMTIIGEVEDGNYVLVEEDKLKEDQHKEYLEAVERYKRECLKSYSTTRSGDVIKKFDLPSFLPLTEAQRENKMVDTISQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYI*
Ga0182130_108256323300015319Switchgrass PhyllosphereGTRSFNMIIISEVEDGNYVPIDESKLKEDQQREYLDAVERYKHECLKSYSTTRSGDVIKKFDFPSFQPLTEAQRDNKMIDAMSQAMAQAFVKSAIVMGNTVHNVVVKTFAEGAFPSCMGPCYIQPD*
Ga0182130_110193623300015319Switchgrass PhyllosphereVPIPEDKLKEEQKKEYDALVEQFKRQCIKSYSITRSGDVIKKFDLPSFQPLTEAQRDNKMMDVVGQAVAQAFIKSATIMGNTIHNAVVKTFAEGTFPGCMGPCYI*
Ga0182165_100395713300015320Switchgrass PhyllosphereVDFCINTFFGIPGWTKNFIMVDITDKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA*
Ga0182165_104085223300015320Switchgrass PhyllosphereMVELGNHSEVNEDNYVPVGEDKLKEDQKQEYLELVEKFKRECLKSYSVTRSGDVIKKFNLPSFQPLIEAQCENKMIDAVGQAVAQAFVKSAIVMGNTVHNAVVKTFAEGTFPGCMGPFCI
Ga0182165_111650313300015320Switchgrass PhyllosphereMLGGTGSFYMVEFGDQSEVIEDNYVPVPEDKLREEHKKEYEELVEKFKHECLKSYSVTRSGDVIKKFNLPSFQPLTETQRENKMIDAVGQAVGQAFVISATVMGNTVHNAV
Ga0182134_106013423300015324Switchgrass PhyllosphereMVDITDKSEVNGENYVPVPEDKLKEEQKKEYEELVEKFKCECLKSYSITRSGDVIKKFDLPSFQPLTEAQRENKMVDAVGQAVAQAFTKSATVMGNTVHNAVVKTFAEGTFPRCMGPCYIQPDQMQYIPL
Ga0182134_109235113300015324Switchgrass PhyllosphereMTKTGAESEVSEDNYIPADESKLKEDQQKEYLEAVERFKCECLKSYSVTRSGDVIKKFSLPSFQLLTEAQRENKMVDAIGQVVAHAFINSATVMGNTVHNAVIKTFTEGTFLGCVDPCYMQPSQMQ
Ga0182166_103817223300015326Switchgrass PhyllosphereMVELGDHSDVNEENYVPVPEDKLKEDQKKEYEELVEKFKRECLKSYSVTRSGDMIKKFNLPSFQPLTEAQHKNKMMDAVGQAVAQAFVKSATVMGNIVHNAVVKTFAEGTFPGCMGPCSIYNQVKLNMYH*
Ga0182166_105454213300015326Switchgrass PhyllosphereRKEYEELVEKFKRECLKLYRVTRSGEIIKKFNLPSFQPLIEAQRENKMMDAVGQAVIQAFIKSATVMGNMVHNAVVKTFAEGTFPGCMGPCYIHPNQIQCPLGNVYGSSSVGSK*
Ga0182166_108140023300015326Switchgrass PhyllosphereSYVPVEEDKLKEDQQKEYLEAVEKYKRECLKSDSMTWSGDVIKKFDFPSFQSLTEAQCDNKMIDAVSQAVAQAFVKSATVMGNTMHNAVVKTFTEGTFPGCMGPCYIQPDQMQYIPFEVSMATALSAQNSQRLLL*
Ga0182114_105754723300015327Switchgrass PhyllosphereDKGKEDQRKEYEELVEKFKCECLKSYRVTRSGDVIKKFNLPSFQPLTEAQRENKMMDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFLGCMGPCYIQPDQMQYVPLEVSMAAALLA
Ga0182114_110805413300015327Switchgrass PhyllosphereMLSGTESFNMVDITDKSAVSEGNQIPAPEDTLKEEQKKEFEELVEKFKSECLKLYCVTRSGEVIKKFDLPSFQPLTETQRENKMIDAVGQAVAQAFIKSATVTGNTVHNAVVKTFTEGTFLGFMGPCYIQPDQ
Ga0182114_114566713300015327Switchgrass PhyllosphereMVELTDKSVVSEENQIPVPEDKLKEEQKKKYEELVERFKCECLKSYSVNRSGEVIKKFNLPSFQPLTEDQRENKMIDAVGQTVAQAFIKSATVMDNTVHNAVVKTFAEGTLPG
Ga0182153_103908113300015328Switchgrass PhyllosphereMVELIDKSAVSEENQILVPEDKLKEEQKKEYGELVERFKCECLKSYSINRSGEVIKKFNLPSFQSLTETQRESKMIDAVGQAVAQAFIKSATVMGNTVHNAVVRTFVEGMLPGCMGTCYI
Ga0182153_108071413300015328Switchgrass PhyllosphereMTIISEVDDDNYVPVKEDKLKEDQQKEYLEAVERYKRECLKSYSTTRSGDVIKKFDLPSFQLLTEVQRENKMVDTISQTVAQAFIKSATIMGNTVHNAVVKTFVEGTFPGCVGPCHIQPDQMNYVPLEVSMAAALSAQNSQP
Ga0182153_109833723300015328Switchgrass PhyllosphereMPGGTESFNTVEFGDPSAVNEENYVPVPEDKLKEDQKKEYEELVEKFKRECLKSYSVTRSGNVIKKFNLPSFQPFTETQRENKMIDAVGQAVAQAFIKSATVMGNTVHNAVVKTFTEGTFLGFMGPCYIQPDQMQYIPLEVSMIAALSAQDS*
Ga0182153_113793913300015328Switchgrass PhyllosphereVLQARLVDFSELGEHLPSDSSVFDFCVNTSFGTPGGIENFNMVELGDHSKVNEDNYVPVAEEKLKEDQKQEYLELAERFKRECLKAYSVTRFGDIIKKFSLPSFQPLTEAQRDNKMIDAMSQAVAQAFVKSATVMGNTVHNAVVKTFAEGTFLG
Ga0182135_103001713300015329Switchgrass PhyllosphereMVELGDHSEVNEENYIPIPEDKLKEEQKEYKELVEKFKCECLKSYSVTRSGDVIKKFNLSSFQPLTEAQSENKMIDAVGQAVAQAFIKSAMVMGNTVHNAVVKTFAEGTFPGCVGPCYIQPDQMQYVPLEVSMAAALLA*
Ga0182135_103722623300015329Switchgrass PhyllosphereMPGWTKNFIMVDITDKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVARAFIKSATVMGNTVHNAVVKTFTEARSA*
Ga0182152_105851413300015330Switchgrass PhyllosphereMVDIGDASEVNEGNYVPVDEDKLKEDQKQEYLELVEKFKRECLKSYSIIRSGDVINKFNLPSFQPLTEAQRDNKMIDAVSQAVAQAFVKSAIVTGNTVHNAVVKTFGEGTFPGCMGPCYIQPDQMQYVPLKVSMVAALSTQNSRAKASNS
Ga0182152_109076913300015330Switchgrass PhyllosphereMVDITDKSAVSEEIQIPVPEDKLKEEQKKEYEELVEKFKRECLKSYSITRSGGVIKKFDLPSFQPLTEAQRDNKMMDAVGQAMAQAFIRSAIVMGNTVHNAVVKTFAEGTFPGCMGPCYI
Ga0182152_113487913300015330Switchgrass PhyllosphereMIIISEVEDGNYVPIDESKLKEDQQREYLDAVERYKHECLKSYSTTRSGDVIKKFDFPCFQPLTEAQRENKMVDTISQAVAQAFIKGATVMGNTVHNAVVKTFTEGMFPDCVGTCLL*
Ga0182131_107632313300015331Switchgrass PhyllosphereMVELGDHSEVNEDNYVPVPEDKLKEDQKQEYLELVEKFKRECLKSYSITRSGDVIKKFNLPSFQPLTEAQRDNKMIDTVGQAVAQAFVKSATVMGNTVHNVVVKTFAEGTFPGCIGPCYIQPDQMQYVPLEVS
Ga0182131_109497723300015331Switchgrass PhyllosphereNMVDITDKSEVNKDNYVSVDENKIKEDQEKEYLELVERFRHECLKLYSITRSDDVIKKFNLPFFQPLTEVQRDNKMIDAVSQAVAQAFVKSATIMGNTVHNAVVKTFAEGTFPRCIGPCYMQPDQMQYIPLEVSMAAALLAQNS*
Ga0182131_112950813300015331Switchgrass PhyllosphereMIIISEVEDGNYVPIDESKLKEDQQREYLDAVERYKHECLKSYSTTRSGDVIKKFDFPCFQPLTEAQCENKMVDTISQAVAQAFIKGATVMGNTVNNAVVKT
Ga0182131_113257113300015331Switchgrass PhyllosphereVTRQTLALGFQCVDFCVNTSFGTPGGNEGFNMVDITDKSAVNEENQIPILEDKLKEEQKKEYEELVEKFKRECLKSYSVTRSGDVIKNFNLSSFQLLTEAQCENKMIDAVGQAVAQAFIKSATVMSNTVHNTVVKTFAKGTFQGCMGPCYIQPDQM
Ga0182147_103447413300015333Switchgrass PhyllosphereMTIIGEVDEGNYVTIEEDKLKENQQKEYLEAVEKYKRECLKSYSTTRSGDVIKKFDFPSFLPLTETQRENKMTDTIYQAVGQAFVKSATVMRNTVHNAVVKTFAEGTFPACVGPC
Ga0182147_113030813300015333Switchgrass PhyllospherePEDKLKEEQKRKYEELVEKFKSECLKSYSINRSGEVIKKFDLPSFQPLTEAQRENKMMDAVGQAVAQAFIKSATIMSNTVHNAVVKTFAEGTFPGCMGPCYIQPDQMQYILLEVSMAAALSAQNSQQK*
Ga0182132_107924223300015334Switchgrass PhyllosphereMVDITDKSEVNGENYVPVPEDKLKEEQKKEYEELVEKFKRECLKSYSITRSGDVIKKFDLPSFQPLTEAQRESKMIDAVGQAVAQAFIKSATVLGNIVHNEVVKTFAKGTFPGCMGPCYI
Ga0182116_101020433300015335Switchgrass PhyllosphereMVDITDKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKSECLKSYSITRSSEVIKKFDLPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA*
Ga0182116_104510213300015335Switchgrass PhyllosphereEDKLKEDQQKEYLEAIERYKRECLKSYNMTRSGDVIKKFDFPSFQSLTEAQCDNKMIDAVSQAVAQAFINSATVMGNTVHNAVVKIFAEGTFPGCMGPCYIARSDELCASRSVNGSSFVGLK*
Ga0182116_108416913300015335Switchgrass PhyllosphereMARIGDETEVNEDKYIPIDENKLKEDQQKEYLEAVERYKRECLKSFNTTRSGDVTKKFDFPSFQSLTEAQHENKMIDTVSQAVAQAFIKSTTVMGNTVHNTVVKTFAEGTFQGCVGPSYIQPNLMNYFPLESAMAAALAAPNS
Ga0182116_109871713300015335Switchgrass PhyllosphereVLGEHLPLDSSLLIFMSTYLLARAVGHESFNMVEITDKSAVSEEKQILVPKGKLKEEQKKEYEELVEKFKRECLKSYNVNRSGEVIKKFNLPSFQLLTEAQRENKMVDIASQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGTCYIQPDQIQYVPLE
Ga0182151_111497913300015337Switchgrass PhyllosphereVLIFASTHLLARPVGHERFNMVELTDKSIVSEENQIPVPEDKLKEEQKKEFEDLVEKFKSECLKSYSINRSGEVIKKFNLPSFQPLTEAQRKSKMIDTVGQAVAQAFIKSATVMGNTVHNAVIKTFAEGTFPGCMGPCYIQLDQMQYTPLEVS
Ga0182137_112853413300015338Switchgrass PhyllosphereWRTLALGFQYVDFCINTFFGTPGWTKNFIMVDITDKSAVNEENQISVPKDNLKEEPKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA*
Ga0182137_113217913300015338Switchgrass PhyllosphereMVELGDHSEVNEENYVLVPEEKLKDDQKKEYEELVEKFKHECLKYYSVTRSGDVIKKFNIPSFQPLTEAQRDNKMMDAVGQAVAQAFIKSSTVMGNTVHNAVVKTFVEGTFPYCMGPCY
Ga0182137_115088713300015338Switchgrass PhyllosphereMVDITDKSAVSEENQIPVPEDKLKEEQKKEYEELVDRFKRECLKSYSVNRSGEVINKFNLPSFQPLTEAQRENKMMDAVGQAVAQAFIKSATVMGNMVHNAVVKTFAEGTFLGCM
Ga0182149_104277213300015339Switchgrass PhyllosphereMTIIDEVEEGNYVPVEEDKLKEDQQKEYLELMDRFKRECLKSYSVTRSGDVIKKFDLPSFQPLTETQHENKMIGAVSQAVAQAFVKSSTVIGNAVHNAVVKTFAEGTFPGCVGPCYIQLD
Ga0182149_105989113300015339Switchgrass PhyllosphereHSEVNEENYVPVPEDKLKEEQKKEYKELVEKFKRECHKSCSVTRSGDVIKKFNLPSFQPLIEAQCENKMIDAVGQAVAQAFVKSAIVMGNTVHNAVVKTFAEGTFPGCMGPFCI*
Ga0182149_107967113300015339Switchgrass PhyllosphereMVDITDKSEVNKDNYVSVDENKIKEDQEKEYLELVERFRHEFLKLYNITRSDDVIKKFNLPFFQPLTEVQRDNKMIDAVSQAVAQAFVKSATIMGNTVHNAVVKTFAEGTFPRCIGPCCMQPDQMQYIPLEVSMAAALLAQNS*
Ga0182149_108194213300015339Switchgrass PhyllosphereMTKPVDGSEVIEENYVPVDKSKLKEDQQKELRESVDRYERECLKSYSITRSGDVIKKFDFPSFQPLTETQRENKMIDMISQAVVQAFIKSSTVMGNTVHNAVVKTFTEGTFPGCMGPC*
Ga0182149_108981513300015339Switchgrass PhyllosphereMVELTDKSAVSEENQILVPEDKLKEEQKKEFEDLVEKFKRECLKSYSINRSGEVIKKFNLPSFQPLTEAQRESKMIDVVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTLPGCMGPCYIQPDQMQYTPLEV
Ga0182149_109806113300015339Switchgrass PhyllosphereMTKPTDGSDVSEENYVPVEEEKLKDEQKTELAKALEAYKRECLKSYSVNRSGEVIKKFDLPSFHPLTEAQCESKMIDAVGQTVAQAFIKGATVMGNMVHNAVVKTFAEGTLPG
Ga0182149_110511413300015339Switchgrass PhyllosphereMVDITDKSELNEENYVSVPEGKLKEDQKKEYEEHVEQFKCECLKSYSITRSGDVIKKFNLPSFQPLTEAQHDNKMMDGVGQAVAQAFIKSATVMGNTVHNTVVKTFIEGTFPGSMGPCYI
Ga0182133_104786823300015340Switchgrass PhyllosphereMPSGTESFNMVEITDKYAVSEENQIPVPDDKLKEEQKKEYEELVEKFKRECLKLYSVTRSGEVIKKFNLPSFQPLTEAQRENKMMDAVGQAVAQAFIKSATAMGNTVHKAVVKTFAERTFPGCMGPCYIQPDQIQYVPLKVSMAAALSA*
Ga0182133_109805813300015340Switchgrass PhyllosphereVLIFASTHLLARPVGHESFNMVELTDKSAVSEENHIHVPEDKLKEEQKKKFEELVERFKRECLKSCSVNRSGEVIKKFSLPSFQPLTEAHRESKMMDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGM
Ga0182133_112108113300015340Switchgrass PhyllosphereMVDITDKSEVSEDNYIPADESKLKEDQKQEYLDLVERFKRECLKSYNVTRSGDVIKKFNLPSFQPLTEAQHDNKMIDAVSQVVAQAFVKSATVMGNTVHKAIVKTFAEGTFPGCMGPC
Ga0182133_112109113300015340Switchgrass PhyllosphereLGYQCVGFCVNTSFGTPGGTESFHMVDITDKSAVSEENQIPVPEDKLKEKQKKEYEELVEKFKRECLKSYNINRSGEVIKKFDLPTFQPLTEAQHENKMMDVVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGMFPDCMGPCYI*
Ga0182133_115759313300015340Switchgrass PhyllosphereTPSGTESFNMVEITDKSADGEENQIPVPKDKLKEEQKKEYEDLVDRFKRECLKSYSINRSGEVIKKFNLPSFQPLTEAQCESKMIDAVGQAVAQAFIKSATVMDNTVHNAVVKTFAEGTLPGCMGP*
Ga0182115_112702313300015348Switchgrass PhyllosphereMPGGTRGFNMVKIGAESEVNEDNYVPVDENKLKEDQRKEYLEAVERYKRECLKSYSITRSGDVIKKFDLPSFQPLTETQRENKMIDMISQAVVQAFIKSSTVMGNTVHNAVVKTFTEGTFPGCMGPC*
Ga0182115_122139013300015348Switchgrass PhyllosphereMVELTNKSDVNEENYVAVPEDKLKEDQRKEYEELVEKFKCECLKSYSITRSGDVIKKFNLPSFQPLTEAQRENKMMDAVGQAVAQAFIKSATVMGNTVHNVVVKTFAEGMFPGCMGPCYIQPDQMQYVPLEVSMAAVL
Ga0182115_124890523300015348Switchgrass PhyllosphereMVELGNHSEVNEDNYVPVGEDKLKEDQKQEYLELVEKFKRECLKSYSVTRSGDVIKKFNLPSFQLLTEAQRDNKMIDAVSQAVAQAFVKSATVMGNTVHNVVVKTFAEGTFPGCVGPCCNTRFIKGHKPSNHIRARIKSHVYTTE*
Ga0182115_127826013300015348Switchgrass PhyllosphereEDNYIPVDENKLKEDKKQEYQDLVERFKRECLKSYNVTRSGDVIKKFDLPSFQPLTEVQRDNKMIDAVSLAVEQAFVKSATVMGNTVHNAVVKTFAEGTLPGCMGPCYI*
Ga0182115_128153313300015348Switchgrass PhyllosphereNMTKPVDGSEVDEGNYVPVDENKLKEDQQKDLNDAVERYKGECLKSYSATRSGEVVKKFDFPALQLLTEAQRENKMTDTIYQAVGQAFMKSAIFMGNTVHNVVVKTFADGTFLGCVGPSYI*
Ga0182185_106198513300015349Switchgrass PhyllosphereMVDITDKSEVNGENYVPVPEDKLKGEQKKEYEEFVEKFKCECLKSYSISRSGEVIKKFNLPSFQPLTEAQRENKMIDAVGQAVAQAFTKSATVMGNTVHNAVVKTFAEGTFPGCMG
Ga0182185_106463613300015349Switchgrass PhyllosphereVDFCINTFFGTPGWTKNFIMVDITDKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKHECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA*
Ga0182185_112398413300015349Switchgrass PhyllosphereMVDITDKSEVNKDNYVSVDENKIKEDQEKEYLELVERFRHEFLKLYNITRSDDVIKKFNLPFFQPLMEVQRDNKMIDAVSQAVAQAFVKSATIMGNTVHNAVVKTFAEGTFPRCIGPCYM
Ga0182163_108578713300015350Switchgrass PhyllosphereMVDITDKSEVNKDNYVSVDENKIKEDQEKEYLELVERFRHECLKLYSITRSDDVIKKFNLPFFQPLTEVQRDNKMIDAVSQAVAQAFVKSATVMGNTVHNA
Ga0182163_111442513300015350Switchgrass PhyllosphereMAKISTETEVNEDNYVPIDENKLKEDQQKEYLEAVERYKHECLKSYSTTRSGDVIKKFDFPSFQPLTEAQHENKMVDTISQAVAEAFIKSAAVMGNTVHNAVVKTFAEGTFPNCVGPCYIQPD*
Ga0182163_129417923300015350Switchgrass PhyllosphereDESKLKEDQQKEYLEAIERYKRECLKSFSTTRSGDVIKKFHFPSFQPLTEAQRDNKMIDAMSQAVAQAFIKSSTVMGNTVHNAVVKTFAEGGMFLGCMGSCYIQPDQINYVPLEVSGYWVRYAT*
Ga0182169_130709623300015352Switchgrass PhyllosphereMVDITDKSEVNKDNYVSVDENKIKEDQEKEYLELVERFRHECLKLYSITRSDDVIKKFNLPFFQPLMEVQRDNKMIDAVSQAVAQAFVKSATIMGNTVHNAVVKTFAEGTFPRCIGPCYMQPDQMQY
Ga0182179_103242023300015353Switchgrass PhyllosphereMVNIGDASEVNEENYVPVPEHKLKEYQKKEYEELVEKFKRECLKSYSVTRSGDVIKKFNLPSFQPLTEAHRENKMIDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFLGCMGPCYI
Ga0182179_112201313300015353Switchgrass PhyllosphereMARIGDETEVNEDKYIPIDENKLKEDQQKEYLEAVERYKRECLKSYTMTRSGDVIKKFDFSSFQPLTEAQCENKMVDMISQAVAQAFISSAIVMGNTVHNTVVKTFVEGTFPGYVSPYYIQPDQMNYVPLEVSMSAALSAPNSQP
Ga0182179_113757223300015353Switchgrass PhyllosphereMVDIGDQSEVSEDNYVPVDENKLKEDQQKEYLELVEKFKRECLKSYSVTRSGDIIKKFNLPSFQPLTETQRDNKMIDAVCQAVAQALVKSATVMGNTVHKALVKTFAEGTFQGCMGPCYVQPDQM*
Ga0182179_121103223300015353Switchgrass PhyllosphereVLIFASTHLLARPVGHQSFNMVDITDKYAVSEENQILVPEDKLKEEQKKEYKELVEKFKHECLKSYSVNRSGEMIKKFNLPSFQPLTEAQRENKMVDIVSQAVTQAFIKNATVMGDTVHTFAEGKFPGCIGPCYIHPDQMQYVSLEVSMAAALSAQNSQAGTS
Ga0182179_123429013300015353Switchgrass PhyllosphereDFCVNTSFGMPGGTESFNMVELGDHYEVNEENYVPVPKDKLKEDQKQEYLELVEKFKRECLKSYSVTRSGDVIKKFNPPFFQPLTEAQCENKMIDAVGQAVAQAFVKSATVMGNTVHNAVVKTFA*
Ga0182167_103008423300015354Switchgrass PhyllosphereMPGGTRGFNMVKIGAESEVNEDNYVPVDENKLKEDQQKEYLEAVERYKRECLKSYSITRSGDVIKKFDFPSFQPLTETQRENKMIDMISQAVVQAFIKSSTVMGNTVHNAVVKTFTEGTFPGCMGPC*
Ga0182167_111080513300015354Switchgrass PhyllosphereAWRTLALGFQCVDFCVNTSFGMPGGIESFNMVELGDHSEVNEENYIPIPEDKLKEEQKEYKELVEKFKRECHKSCSVTRSGDVIKKFNLPSFQPLTEAQCENKMIDAVGQAVAQAFVKSAIVMGNTVHNAVVKTFAEGTFPGCMGPFCI*
Ga0182167_116274313300015354Switchgrass PhyllosphereLTGTLGSLSVLGEHLPSDSSVLIFASTHLLARSVGHESFNIVELTDKSAVSEENQILVPEDKLKEEQNKEFEELVEKFKCECLKSYNINRSSEVIKKFNLPSFQSLTEAQRENKMIDAVGQAVAQAFIKIATVMGNTVHNAVVKTFAEGTLPGCMGPCYIQPD
Ga0182167_120685313300015354Switchgrass PhyllosphereMPGGTESFNMVELGDHYEVNEENYVPVPKDKLKEDQKQEYLELVEKFKRECLKSYSVTRSGDVIKKFNPPFFQPLTEAQCENKMIDAVGQAVAQAFVKSATVMGNTVHNAVV
Ga0182167_123195913300015354Switchgrass PhyllosphereMVDITDKSAVSEENQIPVPEDKFKEEDKKEYEELVEMFKHECLKLYSITRSGEVIKKFDLPSFQLLTEAQRENKMVDVVGQAVAQAFIKSATVMGNTVHNAVVKTFAEDTFP
Ga0182167_132350413300015354Switchgrass PhyllosphereMVDIGDASKVNEGNYVLVDENKLKEDEKKEYLELVEKFKHECLKSYNVTRSGDVIKKFNLISFQPSTETQCDNKMIDAVSQAVAQAFVKSATVMGNTVHNAVVRTFVEGTFPGCMDPCYMQPYQMQYI
Ga0182197_105801013300017408Switchgrass PhyllosphereMTIIGEVQEGNYVPVEEDKLKEDQQKEYLEAIERYKRECLKSYNMTRSGDVIKKFDFPSFQSLTEAQCDNKMIDAVSQAVAQAFINSATVMGNTVHNAVVKIFAEGTFPGCMGPC
Ga0182199_100426723300017412Switchgrass PhyllosphereMVDITDKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEDRSA
Ga0182199_108720013300017412Switchgrass PhyllosphereMVEITDKSAVSKENQIPVSEDKLKEEQKKEYEELVERFKRECLKSYIVNRSGEVIKKFNLPSFQSFTEAQRESKMIDAVGQAVAQAFIRSATVMGNTVHNAVVKTFA
Ga0182199_108860913300017412Switchgrass PhyllosphereMVDITDKSAVSEGNQIPAPEDTLKEEQKKEFEELVEKFKRECLKSYSVTRSGEVIKKFDLPSFQPLTEAQHENKMMDAVGQAVAQAFIKSATVMGNTVHNAVVKTFA
Ga0182199_108960213300017412Switchgrass PhyllosphereGDASEVNKGNYVPVDEDKIKEDQKQEYLELVERFKRECLKSYSVTRYGDVIKKFNLPSFQPLTEAQRDNKMIDAVSQAVAQAFVKSATVMGNTMHNAVVKTFTEGTFPGCMGPCYIQPDQMQYIPFEVSMATALSAQNSQRLLL
Ga0182199_110347613300017412Switchgrass PhyllosphereVSVNTSFGTPGGTESFNMVDIGDASEVNEGNCVPVDEDKLKEDQKQEYLELVERFKRECLKSYSVTRSGNLPSFQPLTEAQHDNKMIDAMSQAMAQAFVKSATVMGNTVHNIVVKTFAEGTFPGCMGPCYIQPDQINYVPLEVSGYWVRYAT
Ga0182199_117969713300017412Switchgrass PhyllosphereMARIGDETEVNEDKYIPIDENKLKEDQQKEYLEAVERYKRECLKSYSTTRSGDVIKKFDFSSFQPLTEAQCENKMVDTISQVVAQAVIKSATVMGNTVHSAVVKIFAEGT
Ga0182195_119939613300017414Switchgrass PhyllosphereMPGGTESFNMVELCDHYEVNEENYVPVPKDKLKEDQKQEYLELVEKFKRECLKSYSVTRSGDVIKKFNPPFFQPLTEAQCENKMIDAVGQAVAQAFVKSATVMGNTVHNAVVKTFAEGMFPGCMG
Ga0182213_108533313300017421Switchgrass PhyllosphereMVDITDKSAVSEENHIPVPEDKLKEEQKKEYEELVERFKRECLKSYSINRSGEVIKKFHLPTFQPLTEAQHENMMMDAVGQTVAQAFIKSATVMGNTVHNAVVKTFAEGTFTGCMGPCYIQPDQMQYVLLEISMAAALSAQDS
Ga0182213_116592113300017421Switchgrass PhyllosphereMVEITDKSAVSEENWIPIPEDKLKEGEKKEYEELVERFKHECLKSYNVNRSDEVIKKFNLPSFHPLTEAQHESKMKDAVGQAVAQVFIKSAIVMGNTVHNAVVKTFAEGTFPGCMGPCYIQPDQMRYVPLEVSMVAALSAQNSQIETSN
Ga0182213_121285913300017421Switchgrass PhyllosphereHIFWHAGGTESFNMVDITDKSKVNGENYVPVPEDKLKEEQKKEYEELVEKFKCECLKSYNVTRSSEVIKKFDLPSFQPLTESQRENKMMDAVGQAVSQAFIKSSTVMGNTVHNAVVKTFAEGTFPGCMGPCYIQLD
Ga0182213_124184213300017421Switchgrass PhyllosphereEVSEDNYIPVDENKLKEDQKQEYQDLMERFKCECLKSYSVTRSGDVIKKFNLASFQPLTEAQPDNKMIDAVSQAVAQAFVKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYI
Ga0182201_106853423300017422Switchgrass PhyllosphereAVSEENQIPVPEDKLKEEQKKEYEELVGKFKRECLKSYSINRSGEVIKKFNLPSFQPLTEAQRENKMVDALSQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYIQPDQMQYVPLEVSMVAALSAQNSQIETSNSQAPS
Ga0182196_102295513300017432Switchgrass PhyllospherePELGEHLPLDSSVLIFCVNTSFGMPGGIESFNVVDITDKSVVSEENQIPVPADKLKEEQKKEYEELVEKFKSECLKSYSVTRSGEVIKEFDLPSFQPLTEAQRENKMIDAVGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA
Ga0182196_106144013300017432Switchgrass PhyllosphereMTIIDEIDEGNYVPVEEDKVKEDQQKEYLEAVEKYKRECLKSYSITRSGDVIKKFDLPSFQPLTETQHENKMIEMVSQAVAQAFIKSPTVMGNMVHNAVVKTFAEGTLPGCVG
Ga0182196_109288513300017432Switchgrass PhyllosphereVDITEKSAVSEENQIHAPEDKLKEEQKKECEDLVERFKRGCLKSYIVNRSGKVIKKFDLPTFQPLTEAQHENKMMDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYI
Ga0182196_110510213300017432Switchgrass PhyllosphereMVELGDPSAVNEENYVPVPEDKLKEDQKKEYEELVEMFKRECLKSYCVTRSGDVIKKFNLPSFQLLTEAQRENKMIDVVGQAVGQAFVKSTTVMGNIVQNAVVKTFAEGTFPGCMGPCYIQPDQMHYVSLEVSMAAALSALNSQQKR
Ga0182194_104569313300017435Switchgrass PhyllosphereMVDIGDASEVSEDNYIAADESKLKEDQQKEYLELVERFKRECLKSYSVTRSGDVIKKFNLPSFQPLTEAQRDNRMIDAVSQAVAQVFVKSATVMGNTVHNAVVKTFAEGT
Ga0182200_113927223300017439Switchgrass PhyllosphereVDITDKSELNEENYVPVPEDKLKEDQKKEYEKHVEQFKCECLMSYSITRSGDVIKKFNLPSFQPLTETQRENKMMDAVGQAVAQAFVKTATVMGNTVHNAVVKTFAEGTFPGCIGPCYIQSN
Ga0182200_115600313300017439Switchgrass PhyllosphereLVGPESFNMVELGDHSEVNEENYIPIPEDKLKEEQKEYKELVEKFKCECLKSYSVTRSGDVIKKFNLPSFQPLTEAQCENKMIDAVGQAVAQAFVKSAIVMGNTVHNAVVKTFAEGTFPGCMGPFCI
Ga0182214_114084613300017440Switchgrass PhyllosphereMVDITDKSAVSEENQIPVPEDKLKEEQKKEYEELVERFKCECLKSYSINRSGEVIKKFNLPTFQPLTEAQHKNKMMDAVGQAVAQTFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYI
Ga0182198_115849413300017445Switchgrass PhyllosphereVVSEENQIPVPEDKLKVEEKKEYEDLVERLKRECLKSYSVNRSGEVIKKFNLPSFQLLTEVQCESKMIDAVGHAVAQAFIKSATVMGNTVHNAVVK
Ga0182198_118077813300017445Switchgrass PhyllosphereMARIGDETEVNEDKYIPIDENKLKEDQQKEYLEAVERYKRECLKSYTMTRSGDVIKKFDLPSFHPLTEAQRENKMVDTISQAVAQAFIKSAVVMGNTVHNAVVKTFAEGTFPGCMGPCYIQPDQMNYVPLEVSMTAALSAQR
Ga0182217_108569323300017446Switchgrass PhyllosphereVLIFASTHLLARSVGHERFNMMELTDKSTVSEENQIPVPEDKLKEEQKKEFEDLVEKFKRECLKSYSINRSGEVIKKFNLPSFQPLTEAQRENKMIDVVGQVVAQAFIKGATIMGNTVHNAVVKTFTEVTFPGCMGPCYIQQDQMQY
Ga0182215_112158913300017447Switchgrass PhyllosphereAVSEENQILVPEDKLKEEQKKKYEELVEKFKRECLKSYSVNRSGEVIKKFNLPSFQPLTEAQHESKMIDAVGQAVAQAFIKSATVMGNMVHNAVVKTFAEGTFLGCMGPCYIQLDQMQYVPWKYLWQ
Ga0182215_116021613300017447Switchgrass PhyllosphereQFQVKLTGTLGSLFVLGEHLPSDSSVLIFTSTHLLACLVGHESFNMVDITDTSAVSDENQIPVPEDKLKEEQKKEYKELVERFKRECLKSYSINRSGEVIKRFNLPSFQSLTEAQHESKMIEAVGQAVAQAFIKSATVMGNMVHNTVVKTFAEGTLPGCMGPCYIQLDEMQYTP
Ga0182215_117532413300017447Switchgrass PhyllosphereVLIFASTHLVELGDHSEVNEGNYIPVDEDKLKEDQKQEYLELVEKFKRECLKSYSVTRSGDVIKKFNLPSFQPLTKAQRDNKMIDAVSQAVAQAFVKSATVMGNTVHNAVDKTFAEGTFPGCMG
Ga0182212_109803223300017691Switchgrass PhyllosphereVLIFTSTHLLARLVGHLSFNMVELTDKSAVSEENQISIPEDKLNEEQKKEYAELVEKFKRECLKSYSVNRSGEVIKKFNLPSFQPLTVAQRESKMIDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYI
Ga0182178_101105423300020023Switchgrass PhyllosphereVSVPEDKLKEDQKEYEELVEKFKRQCLKSYSVTRSGNVINKFNLPSFQPLIEAQCENKMIDAVGQVVAQAFVKSATVMGNTVHNAMVKTFAEGTFPGCMDPCYI
Ga0207641_1074087513300026088Switchgrass RhizosphereITDKSAVSEENRIPVPEDKLKEEQKKEYEELVEKFKCECLKLYSINRSGEVIKMFDLPTFQPLTKAQHENKMMDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYIQPDQMQYIRLEVSMAAALSAPNS
Ga0268322_102153913300028049PhyllosphereMTKTGAESEVSEDNYIPADESKLKEDQQKKYLEAVERFKRECLKSYSITRSGDIIKKFDLPSFQPLTEAQRENKMVETISQAVAQAFIKSTTVMGNTVHNAVVKTFAEGTFPGCVGPCYIQLDQMNYVPL
Ga0268322_103766513300028049PhyllosphereVLIFASTHLLARLVGHERFNMVDIKDKSAVDEENQIPVPKDKLKEEQKKEYEDLVDRFKRECLKSYNINRSGEVIKKFNLPSFQPLTEAQRENKMMDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEDKFPGCMGPCYI
Ga0268328_100573723300028050PhyllosphereDITDKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA
Ga0268328_105070913300028050PhyllosphereMTVIGEVEEGNYVLVEEDKLKEDQHKEYLEAVEKYKRECLKSYRITXSGDVIKKFDLPSFQPLTKAQRENKMVDTISQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYI
Ga0268330_100035823300028056PhyllosphereMVDITDKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA
Ga0268330_105624713300028056PhyllosphereVLIFASTHLLARPVGHERFNMVKLIDKSAVSEENQIPIPEDKLKEEQKKEFEDLVEKFKRECLKSYNSNRSGEVIKKFNLPSFQPLTEAQRESKMIDAVGQAVAQAFIKSATIMGNTVHNVVVKTFAEGTLPRCMGPCYI
Ga0268340_102962313300028064PhyllosphereVLIFVSTHLLACLMGPESFNMVELGDHSEVNEENYIPIPEDKLKEEQKEYKELVEKFKCECLKSYSVTRSGDVIKKFNLSSFQPLTEAQSENKMIDAVGQAVAQAFVKSATIMGNTVHNAVVKTFTEGTFLGCMGPCYIQPDQMQ
Ga0268347_100284413300028142PhyllosphereMVELGDHSDVNEENYVPVPEDKLKEDQKKEYEELVEKFKRECLKSYNISRSGEVIKKFNLPSFQPLMEAQRENKMMDAVGQAVAQAFIKSATVMGNMVHNAVVKTFAESTFPGCMGPCYIQP
Ga0268347_103391113300028142PhyllosphereLGEHLPSDSSVLIFASTHFLARLVGLERFNMVELTDKSVVSEENQIPVSEDKLKEEQKKEYKELVEKFKREYLKSYNVNRSSEVIKKFNLSSFQPLTEAQRESKMIDAVGQAVAQAFIKSATAMGNTAHNAVVKTFAEVTLPGCMVPCYIQPDQMQYTSLKMFMAAAL
Ga0268348_101264023300028143PhyllosphereIPIPEDKLKEEQKKEYEELVERFKRECLKSYSINRSGEVIKKFDLPTFQPLTEAQHENKMMDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTFPGCMGPCYIQLDQMQYTPL
Ga0268348_102326413300028143PhyllosphereITDKSAVSEENQIPVPEDKFKEEDKKEYEELVEMFKHECLKLYSITRSGEVIKKFDLPSFQLLTEAQRENKMVDVVGQAVAQAFIKSATVMGNTVHNAVVKTFAEDTFPGCMGPCYIQPDQMQYIPFEVSMVAALLAQNS
Ga0268308_100090513300028151PhyllosphereKSAVNEENQISVPKDNLKEEQKKEYEELVEKFKRECLKSYSVARSGEVIKKFDFPSFQPLTEAQRENKMIDAIGQAVAQAFIKSATVMGNTVHNAVVKTFTEARSA
Ga0268310_105312313300028262PhyllosphereVLIFASTHLLARSVGHESFNMVELTDKSAVSEEKQILVPEDKLKEEQNKEFEELVEKFKCECLKSYIINRSSEVIKKFNLPSFQSLTEAQCENKMIDAVRQAVAQAFIKIATVMGNTVYNAVVKNFAEGTLPGCMGPCYI
Ga0268333_100890513300028467PhyllosphereMVDITDKSAVSEENHIPVPEDKLKEEQKKEYEELVERFKRECLKSYSVNRSGEVIKKFNLPSFQPLTEAQRESKMIDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAEGTLPGCMGPCYIQPDQMQYTPLEVSMA
Ga0268317_100132813300028468PhyllosphereMVDITDKSAVNEENQISVPKDNLKEEKKKEYEELVEKFKHECLKSYSVARSGELIKKFDFPSFQPLTEAQRENKTIHAVGQAVAQAFIKSATVMGNTVHNAVVKTFAKGTLPGCMGPCYIQPD
Ga0268317_100643913300028468PhyllosphereMVDITDKSEVSEGNYIPADESKLKEDQKQEYLDLVERFKCECLKSYSVIRSGDVIKKLNLPSFQPLMEAQRDNKMIDAVSQAVAQAFVKSATVMGNTMHNAVVKTFTEGTFPGCMGPCYIQPDQMQYIPFEV
Ga0268337_101873513300028469PhyllosphereVLIFASTHLLELGDHSEVNEGNYIPVDEDKLKEDQKQEYLELVEKFKHECLKLYSVTRSGDVIKKFNLPSFQPLTEAQRDNRMIDAVSQAVAQVFVKSATVMGNTVHNAVVKTFAEGTFPGCMGSCYI
Ga0268307_101772623300028470PhyllosphereMVKIGAESEVNEDNYVPVDENKLKEDQQKEYLEAVERYKRECLKSYSTTRSGDVIKKFDFSSFQPLTEAQCENKMVDMISQAVAQAFISSAIVMGNTVHNAVVKTFAEGTFPNCVGPCYIQPD
Ga0268329_100936223300028476PhyllosphereLVLEDKLKEEQKKEYEELVEKFKCECLKSYSVNRSGEVIKKFNLSSFQPLTEAQRESKMIDAVGQAMAQAFIKSATVMGNTVHNAVVKTFAEGTLLGCMGPYYIHPD
Ga0268311_100546813300028529PhyllosphereMVDITDKSAVNEENQIPVPKDKLKEEQKKEYEELVERLKRECLKSYSVNRSGEVIKKFNLPSFQSLTEAQHESKMIDAVGQAVAQAFINSPTVMGNTVHNAVVKTFAEGMFPGCMGPCYIQPDQMQYTLLEVSIAEALSAQDS
Ga0214493_106628413300032465Switchgrass PhyllosphereMEKIGAETEVNEDNYVSVDENKLKEDQQKEYLEAVERYKRECLKSYSITGSGDVIKKFDLPSFQPLTEAQRENKMIDTISKAVAQAFIKSSTVMGNTLHNAVVKTFTEGMFPGCMGPCYIQLD
Ga0214493_109517713300032465Switchgrass PhyllosphereESFNMVDITDKSAVSEEIQIPVPEDKLKEEQKKEYEELVEKFKRECLKSYSVTRSGEVIKKFDLPSFQPLTEVQRENKMTDAVGQAVAQAFIKSATVMGNTVHNAVVKTFTEGTFLGCMGPTRSDAVCPLGSVYGSSSVGSK
Ga0214493_110088223300032465Switchgrass PhyllosphereMVELTDKSAVSEENHIPVPEDKLKEEQKKEYEDLVEKFKRECLKSYSVNRSGEVIKKFNLPSFQPLTEAQHESKMIDAVGQTVAQAFIKSATVMDNTVHNAVVKIFVEGTLTGCMGP
Ga0214503_125378213300032466Switchgrass PhyllosphereVLIFASTHLLAHSVGHESFNMVELTDKSAISEENQIPVPEDRLKEEQKKEFEELVEKFKCECLKSYNVNRSGEVIKKFNLSSFQPLTEAQRESKMIDAVGQAMAQAFIKSATVMGNTVHNAVVKTFAEGTLPGCMSPCYIQPDQMQYTPLEVSMAAAL
Ga0214495_101954333300032490Switchgrass PhyllosphereRPVGPESFNMVDITDKSAVSEENQIPILEDKLKEEQRKEYEELVEKFKRECLKSYSVTRSGEVIKKFDLPSFQPLTEVQRENKMTDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAESTFPGCMGPCYIQPD
Ga0214501_129190613300032625Switchgrass PhyllosphereLTDKYAISEENQIPVPEDKLKKEQKKEYEELVEKFKRECLKSYNINRSGEVIKKFNLPSFQPLTEAQRESKMIDAVGQAVAQAFIKSAIVMGNTMHNAVVKTFDEGTLPGCMGPC
Ga0214499_100033213300032697Switchgrass PhyllosphereMVDIGDASEVNEGNYVPVGENKLKEDQKKEYLELVEKFKHECLKSYSVTRSGDIIKKFNLPSFQSLMEMQRDNKMIDAVSQAVAQAFVKSATVMGNTVHIAVVKTFAEGTFLGCKGPCYIQPDQMQYIPMEVSMAAALSALNSQTE
Ga0314753_105777313300032757Switchgrass PhyllosphereVTQRTLALGFQCVDFCVNTSFGTPGGTESFNIVDITDKSAVSEKNQIPVPEDKLKEEQKKEYEELVEKFKRECLKSYSVTRSGEVIKKFDLPSFQPLTEVQRENKMIDAVGQAVAQAFIKSATVMGNMVHNAVVKTFAEGTFPGCMGPCYIQPD
Ga0314733_107245813300032761Switchgrass PhyllosphereMVELTDKSAISEENQIPVPEDKLKKEQKKEYEELVEKFKRECLKSYNVNRSGEVIKKFNLPSFPSLAEAQRESKMIDAVGQAVAQAFIKSAAVMGNTVHNAVVKTFAEGTFPGCMGP
Ga0314731_103673623300032790Switchgrass PhyllosphereVLIFASTHLLAHLVGHESFNMVELTDKSAVSEENQIPILEDKLKEEQRKEYEELVEKFKRECLKSYSVTRSGEVIKKFDLPSFQPLTEVQRENKMIDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAESTFPGCMGPCYIQPD
Ga0314723_100040413300032823Switchgrass PhyllosphereLNGTLGLLSVLGEHLSSDSSVLIFASIHLLARPVGPESFNMVDITDKSAVSEENQILVPEDKLKEEQRKEYEELVEKFKRECLKSYSVTRSGEVIKKFDLPSFQPLTEVQRENKMTDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAESTFPGCMGPCYIQPD
Ga0314727_105501313300032845Switchgrass PhyllosphereMVDITDKSEVNEENYVPVDENKLKEDQKQEYVELMEKFKRECLKSYSVTRSGDVIKKFDLPSFQPLTETQRDNKMIDAVSQAVAQAFVKSATVMGNTVHNAVVNFCRRHVSRLHGSLLYT
Ga0314737_101461323300032875Switchgrass PhyllosphereMVDITDKSEVNEENYVPVDENKLKEDQKQEYVELMEKFKRECLKSYSVTRSGDVIKKFDLPSFQPLTETQRDNKMIDAVSQAVAQAFVKSATVMGNTVHIAVVKTFAEGTFLGCKGPCYIQPDQMQY
Ga0314761_103760013300033526Switchgrass PhyllosphereMVDIGDASEVNEGNYVPVGENKLKEDQKKEYLELVEKFKHECLKSYSVTRSGDIIKKFNLPSFQSLMEMQRDNKMIDAVSQAVAQAFVKSATVMGNTVHIAVVKTFAEGTFLGCKGPCYIQPDQMQYIP
Ga0314756_101395723300033531Switchgrass PhyllosphereVVITDKSAVSEENQIPVPEDKLKEEQKKKYEELVEKFKRECLKSYSVTRSGEVIKKFDLPSFQPLTEVQRENKMIDAVGQAVAQAFIKSATVMGNTVHNAVVKTFAESTFPGCMGPCYIQPD
Ga0314770_125713313300033533Switchgrass PhyllosphereMVDITDKSEVNEENYVPVDENKLKEDQKQEYVELMEKFKRECLKSYSVTRSGDVIKKFDLPSFQPLTETQRDNKMIDAVSQAVAQAFVKSATVMGNTVHNAVVK


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.