| Basic Information | |
|---|---|
| Family ID | F026737 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MVLPYFVLWATLMNALFVKAKWLPPNCARCGRRPKEGDHCYCEYGR |
| Number of Associated Samples | 148 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 64.97 % |
| % of genes near scaffold ends (potentially truncated) | 18.78 % |
| % of genes from short scaffolds (< 2000 bps) | 84.77 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.310 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (16.244 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.919 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.777 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 32.43% β-sheet: 0.00% Coil/Unstructured: 67.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF02625 | XdhC_CoxI | 39.09 |
| PF13478 | XdhC_C | 10.66 |
| PF13523 | Acetyltransf_8 | 7.61 |
| PF13302 | Acetyltransf_3 | 2.54 |
| PF07712 | SURNod19 | 2.54 |
| PF00082 | Peptidase_S8 | 2.54 |
| PF00596 | Aldolase_II | 1.02 |
| PF00764 | Arginosuc_synth | 1.02 |
| PF03734 | YkuD | 0.51 |
| PF00202 | Aminotran_3 | 0.51 |
| PF03972 | MmgE_PrpD | 0.51 |
| PF02518 | HATPase_c | 0.51 |
| PF07676 | PD40 | 0.51 |
| PF13229 | Beta_helix | 0.51 |
| PF02371 | Transposase_20 | 0.51 |
| PF05977 | MFS_3 | 0.51 |
| PF00583 | Acetyltransf_1 | 0.51 |
| PF13426 | PAS_9 | 0.51 |
| PF01321 | Creatinase_N | 0.51 |
| PF04255 | DUF433 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG1975 | Molybdoenzyme maturation factor PaoD (Mo cofactor insertion), XdhC/CoxF family | Posttranslational modification, protein turnover, chaperones [O] | 39.09 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 1.02 |
| COG0006 | Xaa-Pro aminopeptidase | Amino acid transport and metabolism [E] | 0.51 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.51 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.51 |
| COG2814 | Predicted arabinose efflux permease AraJ, MFS family | Carbohydrate transport and metabolism [G] | 0.51 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.31 % |
| Unclassified | root | N/A | 12.69 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090008|P3_DRAFT_NODE_33186_len_3346_cov_18_892408 | All Organisms → cellular organisms → Bacteria | 3396 | Open in IMG/M |
| 2124908045|KansclcFeb2_ConsensusfromContig1230752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 537 | Open in IMG/M |
| 2199352025|deepsgr__Contig_40407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2486 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c1996013 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300001538|A10PFW1_10329065 | All Organisms → cellular organisms → Bacteria | 2951 | Open in IMG/M |
| 3300001686|C688J18823_10285403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1088 | Open in IMG/M |
| 3300002568|C688J35102_117897440 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300002568|C688J35102_119523108 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300004081|Ga0063454_101458095 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300004114|Ga0062593_100502522 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1124 | Open in IMG/M |
| 3300004114|Ga0062593_103452198 | Not Available | 507 | Open in IMG/M |
| 3300004153|Ga0063455_101489991 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300004157|Ga0062590_100687721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 918 | Open in IMG/M |
| 3300004157|Ga0062590_100952614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300004157|Ga0062590_102691639 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 530 | Open in IMG/M |
| 3300004643|Ga0062591_102050533 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300005093|Ga0062594_100841306 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300005167|Ga0066672_10679731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 662 | Open in IMG/M |
| 3300005172|Ga0066683_10146976 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300005174|Ga0066680_10388662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 887 | Open in IMG/M |
| 3300005179|Ga0066684_10443236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 873 | Open in IMG/M |
| 3300005184|Ga0066671_10573911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 729 | Open in IMG/M |
| 3300005184|Ga0066671_10843498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 584 | Open in IMG/M |
| 3300005327|Ga0070658_11428656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 600 | Open in IMG/M |
| 3300005332|Ga0066388_100964764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1421 | Open in IMG/M |
| 3300005332|Ga0066388_102368404 | All Organisms → cellular organisms → Bacteria | 962 | Open in IMG/M |
| 3300005347|Ga0070668_101392964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 639 | Open in IMG/M |
| 3300005364|Ga0070673_102283176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 514 | Open in IMG/M |
| 3300005444|Ga0070694_101635135 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005445|Ga0070708_100102771 | All Organisms → cellular organisms → Bacteria | 2619 | Open in IMG/M |
| 3300005445|Ga0070708_102102458 | Not Available | 522 | Open in IMG/M |
| 3300005446|Ga0066686_10319123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1058 | Open in IMG/M |
| 3300005451|Ga0066681_10784616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 576 | Open in IMG/M |
| 3300005457|Ga0070662_101902944 | Not Available | 514 | Open in IMG/M |
| 3300005467|Ga0070706_100072227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3193 | Open in IMG/M |
| 3300005467|Ga0070706_101726934 | Not Available | 570 | Open in IMG/M |
| 3300005468|Ga0070707_100068480 | All Organisms → cellular organisms → Bacteria | 3417 | Open in IMG/M |
| 3300005471|Ga0070698_100289543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1569 | Open in IMG/M |
| 3300005471|Ga0070698_100460676 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300005471|Ga0070698_100633878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
| 3300005526|Ga0073909_10003999 | All Organisms → cellular organisms → Bacteria | 4355 | Open in IMG/M |
| 3300005526|Ga0073909_10050530 | All Organisms → cellular organisms → Bacteria | 1507 | Open in IMG/M |
| 3300005526|Ga0073909_10482953 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300005526|Ga0073909_10509692 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300005530|Ga0070679_100883996 | Not Available | 837 | Open in IMG/M |
| 3300005534|Ga0070735_10014323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5910 | Open in IMG/M |
| 3300005552|Ga0066701_10470618 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 780 | Open in IMG/M |
| 3300005558|Ga0066698_10295309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
| 3300005560|Ga0066670_10539409 | All Organisms → cellular organisms → Bacteria | 714 | Open in IMG/M |
| 3300005561|Ga0066699_10511388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 859 | Open in IMG/M |
| 3300005563|Ga0068855_102232156 | Not Available | 549 | Open in IMG/M |
| 3300005576|Ga0066708_11026932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 512 | Open in IMG/M |
| 3300005577|Ga0068857_100367108 | All Organisms → cellular organisms → Bacteria | 1335 | Open in IMG/M |
| 3300005587|Ga0066654_10389715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
| 3300005598|Ga0066706_10720210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 792 | Open in IMG/M |
| 3300005614|Ga0068856_100764821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 986 | Open in IMG/M |
| 3300005713|Ga0066905_100838457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 800 | Open in IMG/M |
| 3300005764|Ga0066903_100341847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2411 | Open in IMG/M |
| 3300005764|Ga0066903_103120935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 897 | Open in IMG/M |
| 3300005764|Ga0066903_104676573 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300005764|Ga0066903_105973556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 638 | Open in IMG/M |
| 3300005937|Ga0081455_10925288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300005985|Ga0081539_10006615 | All Organisms → cellular organisms → Bacteria | 11007 | Open in IMG/M |
| 3300006032|Ga0066696_11007122 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300006046|Ga0066652_100274716 | All Organisms → cellular organisms → Bacteria | 1486 | Open in IMG/M |
| 3300006046|Ga0066652_101764106 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300006049|Ga0075417_10123617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1189 | Open in IMG/M |
| 3300009012|Ga0066710_100042330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5514 | Open in IMG/M |
| 3300009012|Ga0066710_101425714 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1073 | Open in IMG/M |
| 3300009012|Ga0066710_101768312 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300009038|Ga0099829_10087043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2405 | Open in IMG/M |
| 3300009088|Ga0099830_10049240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2965 | Open in IMG/M |
| 3300009088|Ga0099830_11631068 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 538 | Open in IMG/M |
| 3300009090|Ga0099827_10210180 | All Organisms → cellular organisms → Bacteria | 1622 | Open in IMG/M |
| 3300009090|Ga0099827_10358687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1241 | Open in IMG/M |
| 3300009090|Ga0099827_11095693 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 692 | Open in IMG/M |
| 3300009094|Ga0111539_11595354 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300009137|Ga0066709_102313526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 736 | Open in IMG/M |
| 3300009137|Ga0066709_102717189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 659 | Open in IMG/M |
| 3300009137|Ga0066709_104586425 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300009148|Ga0105243_10355044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1347 | Open in IMG/M |
| 3300009176|Ga0105242_11077398 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300009553|Ga0105249_11948707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 660 | Open in IMG/M |
| 3300009789|Ga0126307_10012355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia | 6261 | Open in IMG/M |
| 3300009789|Ga0126307_10042926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3517 | Open in IMG/M |
| 3300009792|Ga0126374_10857049 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 700 | Open in IMG/M |
| 3300009840|Ga0126313_10347848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1167 | Open in IMG/M |
| 3300009840|Ga0126313_10890459 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 726 | Open in IMG/M |
| 3300009840|Ga0126313_11769919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 516 | Open in IMG/M |
| 3300010039|Ga0126309_10143858 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1275 | Open in IMG/M |
| 3300010040|Ga0126308_10056070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2304 | Open in IMG/M |
| 3300010041|Ga0126312_10434172 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 936 | Open in IMG/M |
| 3300010041|Ga0126312_10960671 | Not Available | 624 | Open in IMG/M |
| 3300010041|Ga0126312_11031791 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300010044|Ga0126310_10786716 | All Organisms → cellular organisms → Bacteria | 730 | Open in IMG/M |
| 3300010045|Ga0126311_11089127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 657 | Open in IMG/M |
| 3300010359|Ga0126376_13100177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 514 | Open in IMG/M |
| 3300010362|Ga0126377_10959571 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300010364|Ga0134066_10410317 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300010375|Ga0105239_11725188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 725 | Open in IMG/M |
| 3300010403|Ga0134123_11350921 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
| 3300011003|Ga0138514_100002916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2315 | Open in IMG/M |
| 3300011269|Ga0137392_10624758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 894 | Open in IMG/M |
| 3300012011|Ga0120152_1067589 | All Organisms → cellular organisms → Bacteria | 1090 | Open in IMG/M |
| 3300012011|Ga0120152_1107809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 781 | Open in IMG/M |
| 3300012204|Ga0137374_10005000 | All Organisms → cellular organisms → Bacteria | 15752 | Open in IMG/M |
| 3300012204|Ga0137374_10016050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8610 | Open in IMG/M |
| 3300012204|Ga0137374_10016337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8528 | Open in IMG/M |
| 3300012204|Ga0137374_10027616 | All Organisms → cellular organisms → Bacteria | 6279 | Open in IMG/M |
| 3300012204|Ga0137374_10058421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3898 | Open in IMG/M |
| 3300012204|Ga0137374_10938867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 631 | Open in IMG/M |
| 3300012206|Ga0137380_10729293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 859 | Open in IMG/M |
| 3300012208|Ga0137376_10188830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1781 | Open in IMG/M |
| 3300012208|Ga0137376_10263885 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300012209|Ga0137379_10254732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1667 | Open in IMG/M |
| 3300012211|Ga0137377_11154864 | Not Available | 704 | Open in IMG/M |
| 3300012212|Ga0150985_107569042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 608 | Open in IMG/M |
| 3300012212|Ga0150985_110607516 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300012212|Ga0150985_113568421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 648 | Open in IMG/M |
| 3300012212|Ga0150985_120991762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 681 | Open in IMG/M |
| 3300012285|Ga0137370_10907154 | Not Available | 545 | Open in IMG/M |
| 3300012350|Ga0137372_10154286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1873 | Open in IMG/M |
| 3300012350|Ga0137372_10244118 | All Organisms → cellular organisms → Bacteria | 1416 | Open in IMG/M |
| 3300012350|Ga0137372_11181575 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 518 | Open in IMG/M |
| 3300012355|Ga0137369_10992924 | Not Available | 557 | Open in IMG/M |
| 3300012358|Ga0137368_10435605 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300012360|Ga0137375_10631757 | All Organisms → cellular organisms → Bacteria | 886 | Open in IMG/M |
| 3300012406|Ga0134053_1279706 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300012469|Ga0150984_100132632 | Not Available | 521 | Open in IMG/M |
| 3300012469|Ga0150984_112691123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1078 | Open in IMG/M |
| 3300012469|Ga0150984_117858240 | All Organisms → cellular organisms → Bacteria | 1261 | Open in IMG/M |
| 3300012469|Ga0150984_122687051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
| 3300012532|Ga0137373_10004879 | All Organisms → cellular organisms → Bacteria | 14633 | Open in IMG/M |
| 3300012532|Ga0137373_10028312 | All Organisms → cellular organisms → Bacteria | 5484 | Open in IMG/M |
| 3300012909|Ga0157290_10278215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 607 | Open in IMG/M |
| 3300012955|Ga0164298_11619249 | Not Available | 511 | Open in IMG/M |
| 3300012957|Ga0164303_11438194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 517 | Open in IMG/M |
| 3300012960|Ga0164301_10946286 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300012975|Ga0134110_10221153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300012987|Ga0164307_10543216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 886 | Open in IMG/M |
| 3300012989|Ga0164305_12212777 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300013297|Ga0157378_10799109 | All Organisms → cellular organisms → Bacteria | 969 | Open in IMG/M |
| 3300013501|Ga0120154_1135274 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300013763|Ga0120179_1015814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1895 | Open in IMG/M |
| 3300013768|Ga0120155_1107302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 777 | Open in IMG/M |
| 3300013772|Ga0120158_10053971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 2745 | Open in IMG/M |
| 3300014058|Ga0120149_1219889 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300014150|Ga0134081_10026123 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1669 | Open in IMG/M |
| 3300014497|Ga0182008_10605050 | Not Available | 616 | Open in IMG/M |
| 3300015371|Ga0132258_11898184 | All Organisms → cellular organisms → Bacteria | 1500 | Open in IMG/M |
| 3300015372|Ga0132256_101148696 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
| 3300015373|Ga0132257_101945769 | Not Available | 757 | Open in IMG/M |
| 3300015374|Ga0132255_105761738 | Not Available | 524 | Open in IMG/M |
| 3300018027|Ga0184605_10524918 | Not Available | 513 | Open in IMG/M |
| 3300018061|Ga0184619_10330755 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300018071|Ga0184618_10167985 | Not Available | 905 | Open in IMG/M |
| 3300018073|Ga0184624_10430038 | Not Available | 582 | Open in IMG/M |
| 3300018076|Ga0184609_10127128 | All Organisms → cellular organisms → Bacteria | 1162 | Open in IMG/M |
| 3300018081|Ga0184625_10028214 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2731 | Open in IMG/M |
| 3300018433|Ga0066667_10586236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 928 | Open in IMG/M |
| 3300018468|Ga0066662_12786921 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300019361|Ga0173482_10441748 | Not Available | 616 | Open in IMG/M |
| 3300021073|Ga0210378_10093050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1176 | Open in IMG/M |
| 3300024246|Ga0247680_1063551 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
| 3300025910|Ga0207684_10142281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2062 | Open in IMG/M |
| 3300025922|Ga0207646_10263638 | All Organisms → cellular organisms → Bacteria | 1557 | Open in IMG/M |
| 3300025922|Ga0207646_11087290 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 704 | Open in IMG/M |
| 3300025932|Ga0207690_10569819 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 922 | Open in IMG/M |
| 3300025934|Ga0207686_11081057 | Not Available | 653 | Open in IMG/M |
| 3300025935|Ga0207709_11364125 | Not Available | 587 | Open in IMG/M |
| 3300026035|Ga0207703_11406701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 671 | Open in IMG/M |
| 3300026118|Ga0207675_101534490 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300026327|Ga0209266_1273300 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 535 | Open in IMG/M |
| 3300026343|Ga0209159_1134559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1010 | Open in IMG/M |
| 3300026530|Ga0209807_1353062 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300027821|Ga0209811_10345560 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300027862|Ga0209701_10634763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 561 | Open in IMG/M |
| 3300027875|Ga0209283_10510190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 773 | Open in IMG/M |
| 3300027875|Ga0209283_10561617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 728 | Open in IMG/M |
| 3300027882|Ga0209590_10014656 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3802 | Open in IMG/M |
| 3300027882|Ga0209590_10235972 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1164 | Open in IMG/M |
| 3300027986|Ga0209168_10062746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1965 | Open in IMG/M |
| 3300028722|Ga0307319_10214722 | Not Available | 631 | Open in IMG/M |
| 3300028755|Ga0307316_10024379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1950 | Open in IMG/M |
| 3300028811|Ga0307292_10101884 | All Organisms → cellular organisms → Bacteria | 1129 | Open in IMG/M |
| 3300028811|Ga0307292_10523533 | Not Available | 509 | Open in IMG/M |
| 3300028875|Ga0307289_10048232 | All Organisms → cellular organisms → Bacteria | 1700 | Open in IMG/M |
| 3300028878|Ga0307278_10533288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 512 | Open in IMG/M |
| 3300028885|Ga0307304_10417113 | Not Available | 608 | Open in IMG/M |
| 3300031152|Ga0307501_10211882 | Not Available | 559 | Open in IMG/M |
| 3300031170|Ga0307498_10253385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
| 3300031226|Ga0307497_10015117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2273 | Open in IMG/M |
| 3300031564|Ga0318573_10420166 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300031938|Ga0308175_100611469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1174 | Open in IMG/M |
| 3300031939|Ga0308174_10369634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1148 | Open in IMG/M |
| 3300032002|Ga0307416_100063489 | All Organisms → cellular organisms → Bacteria | 3025 | Open in IMG/M |
| 3300032177|Ga0315276_11061152 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 859 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.24% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.63% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 6.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.09% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 4.06% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.06% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.55% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.55% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.54% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.03% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 2.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.03% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 2.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.52% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.02% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.51% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.51% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3 | Environmental | Open in IMG/M |
| 2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010364 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09212015 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012011 | Permafrost microbial communities from Nunavut, Canada - A30_65cm_6M | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012406 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_5_4_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013501 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0.25M | Environmental | Open in IMG/M |
| 3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
| 3300013768 | Permafrost microbial communities from Nunavut, Canada - A35_65cm_0M | Environmental | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014058 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0.25M | Environmental | Open in IMG/M |
| 3300014150 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300024246 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK21 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027986 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028722 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_368 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028875 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P3_DRAFT_01119060 | 2088090008 | Soil | MQSWMILPYFVLWATLMNALLVKAKFLPACCAHCGRRPHEGDACFCEYGR |
| KansclcFeb2_11919800 | 2124908045 | Soil | MQAWMILPYFVLWAVLINALFVKAKILPPSCIRCGRRPDGDACYCEQHSAEQHPA |
| deepsgr_00337650 | 2199352025 | Soil | VTVWMVLPYFVMWATLMNALFVKAKWLPPVCIRCGRRPTEGDHCYCEYGR |
| ICChiseqgaiiDRAFT_19960132 | 3300000033 | Soil | MQAWMILPYFVLWAVLXNALFVKAKILPPSCIRCGRRPXGDACYCEQHTAQQL* |
| A10PFW1_103290653 | 3300001538 | Permafrost | VQIWMVLPYFVLWATFMNALFVKAKWLPPNCVQCGRRPKEGDHCYCEYGR* |
| C688J18823_102854032 | 3300001686 | Soil | VQVWMILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPAEGDSCFCEYGR* |
| C688J35102_1178974401 | 3300002568 | Soil | ILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPAEGDSCFCEYGR* |
| C688J35102_1195231081 | 3300002568 | Soil | MLLPYFVLWATLMNALFVKAKWLPACCARCGRRPPEGDHCFCEYGRR* |
| Ga0063454_1014580952 | 3300004081 | Soil | VLQVWMILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPAEGDSCFCEYGR* |
| Ga0062593_1005025222 | 3300004114 | Soil | MVLPYFVLWATLMNALFVKAKWLPPCCAQCGRRPKEGDHCYCEYGR* |
| Ga0062593_1034521981 | 3300004114 | Soil | VTVWMVLPYFVMWATLMNALFVKAKWLPPVCIRCGRRPKEGDHCYCEYGR* |
| Ga0063455_1014899912 | 3300004153 | Soil | MLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRR* |
| Ga0062590_1006877212 | 3300004157 | Soil | MVLPYFVLWATLMNALFVKAKWLPPCCARCGRRPKEGDHCYCEYGR* |
| Ga0062590_1009526142 | 3300004157 | Soil | MILPYFVLWATLMNALFVKAHWLPPNCARCGRRPAQGNDCFCEYGR* |
| Ga0062590_1026916392 | 3300004157 | Soil | VQVWMILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPSQGDSCFCEYGR* |
| Ga0062591_1020505332 | 3300004643 | Soil | VQVWMILPYFVLWATLMNALFVKAHWLPPHCLRCGRRPSQGDSCFCEYGR* |
| Ga0062594_1008413061 | 3300005093 | Soil | LLPYFVLWATLMNALFVKAKWLPPCCARCGRRPAQGDHCFCEYGR* |
| Ga0066672_106797312 | 3300005167 | Soil | VTASLILPYFVLWATLVNALLVKAKLVPPNCVRCGRRPPQGDACFCEYERA* |
| Ga0066683_101469762 | 3300005172 | Soil | MLLPYLVLWATLMNALFVKARWLPPNCARCGRRPNQGDHCYCEYGR* |
| Ga0066680_103886623 | 3300005174 | Soil | MQAWMILPYFVLWATLMNALLVKSKLLPASCIRCGRRPAEGDDCFCEYGRV* |
| Ga0066684_104432361 | 3300005179 | Soil | LILPYFVLWATLVNALLVKAKLVPPNCVRCGRRPAQGDACFCEYERA* |
| Ga0066671_105739111 | 3300005184 | Soil | MQPWMILPYFVLWAVLINALFVKAKLLPPSCAHCGRRPQADVCACGRQSARSS* |
| Ga0066671_108434982 | 3300005184 | Soil | VTASLILPYFVLWATLVNALLVKAKLVPPNCVRCGRRPAQGDACFCEYERA* |
| Ga0070658_114286561 | 3300005327 | Corn Rhizosphere | SLPFAKESCVQVWMILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPSQGDSCFCEYGR* |
| Ga0066388_1009647641 | 3300005332 | Tropical Forest Soil | MLLPYFVLWATLMNALFVKAKWLPPSCARCGRRPAQGEHCFCEYGRR* |
| Ga0066388_1023684042 | 3300005332 | Tropical Forest Soil | MLLPYFVLWATLMNALFVKAKWLPPSCARCGRRPAQGDHCFCEYGRH* |
| Ga0070668_1013929642 | 3300005347 | Switchgrass Rhizosphere | MLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPTEGDHCFCEYGRY* |
| Ga0070673_1022831762 | 3300005364 | Switchgrass Rhizosphere | VQVWMILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPSQGDSC |
| Ga0070694_1016351351 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VWMVLPYFVMWATLMNALFVKARWLPPNCVRCGRRPKEGDHCYCEYDR* |
| Ga0070708_1001027711 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VQVWMVLPYFVMWATLMNALFVKAKWLPPNCARCGRRPKEGDFCYCEYGR* |
| Ga0070708_1021024582 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | VQVWMVLPYFVMWATLMNALFVKAKWLPPNCARCGRRPKEGDHCYCEYGR* |
| Ga0066686_103191231 | 3300005446 | Soil | VHASMLLPYLVLWATLMNALFVKARWLPPNCARCGRRPNQGDHCYCEYGR* |
| Ga0066681_107846162 | 3300005451 | Soil | MSTWLLLPYFVLAATLANALFVKSKLLPPNCVRCGRRPKEGDTCYCEYGR* |
| Ga0070662_1019029442 | 3300005457 | Corn Rhizosphere | MLLPYFVMWATLMNALFVKAKWLPATCARCGRRPKEGDHCYCEY |
| Ga0070706_1000722272 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAWMILPYFVLWATLMNALLVKSKLLPASCIRCGRRPPEGDDCFCEYGGV* |
| Ga0070706_1017269342 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLPYFVMWATLMNALFVKAKWLPPNCARCGRRPKEGDHCYCEYGR* |
| Ga0070707_1000684802 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLPYFVMWATLMNALFVKAKWLPPNCARCGRRPKEGDFCYCEYGR* |
| Ga0070698_1002895432 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAWMILPYFVLWATLMNALLVKSKLLPASCIRCGRRPADGEDCFCEYGRV* |
| Ga0070698_1004606762 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VPIWMVLPYFVMWATLMNALFVKAKWLPPNCVQCGRRPKEGDHCYCEYGRY* |
| Ga0070698_1006338782 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | VQVWMVLPYFVMWATLMNALFVKARWLPPNCARCGRRPKEGDHCYCEYGR* |
| Ga0073909_100039992 | 3300005526 | Surface Soil | VTVWMVLPYFVMWATLMNALFVKAKWLPPSCARCGRRPTEGDHCYCDYGR* |
| Ga0073909_100505303 | 3300005526 | Surface Soil | MLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPAEGDHCFCEYGRY* |
| Ga0073909_104829532 | 3300005526 | Surface Soil | MQSWMILPYFVLWATLVNALLVKAKFVPACCVHCGRRPTQGDACFCEHGP* |
| Ga0073909_105096922 | 3300005526 | Surface Soil | MWATLMNALFVKAKWLPPSCARCGRRPKEGDHCYCEYGR* |
| Ga0070679_1008839961 | 3300005530 | Corn Rhizosphere | VHVWMLLPYFVLWATLMNALFVKAKWLPPCCALCGRRPTEGDHCFCEYGRY* |
| Ga0070735_100143234 | 3300005534 | Surface Soil | VLNAWLVLTYFVLWATLMNALFVKAKFVPPNCSTCGRRPRQGDTCYCEYGR* |
| Ga0066701_104706182 | 3300005552 | Soil | VQAWLILPYFVLWATLVNALLVKAKLLPPNCVRCGRRPLKGDDCFCEYERA* |
| Ga0066698_102953092 | 3300005558 | Soil | MQAWMILPYFVLWATLMNALLVKSKLLPASCIRCGRRPAEGEDCFCEYGRV* |
| Ga0066670_105394092 | 3300005560 | Soil | VQVWMLLPYFVLWATLMNALFVRAKWLPPCCARCGRRPPEGDHCFCEYGRS* |
| Ga0066699_105113882 | 3300005561 | Soil | VQAWLILPYFVLWATLVNALLVKAKLLPPNCVRCGRRPLKGDACFCEYERA* |
| Ga0068855_1022321562 | 3300005563 | Corn Rhizosphere | VQVWMLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPAEGDHCFCEYGRY* |
| Ga0066708_110269321 | 3300005576 | Soil | MQAWMILPYFVLWATLMNALLVKSKFLPASCIRCGRRPAEGNDCFCEYGRV* |
| Ga0068857_1003671082 | 3300005577 | Corn Rhizosphere | MILPYFVLWATLANALFVKAQLVPPACASCGRRHSAEDTSFCRR* |
| Ga0066654_103897151 | 3300005587 | Soil | VQVWMLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRR* |
| Ga0066706_107202101 | 3300005598 | Soil | MSTWLLLPYFVLAATLANALFVKSKLLPPNCVRCGRRPKEGDTCY |
| Ga0068856_1007648212 | 3300005614 | Corn Rhizosphere | VPPWMILPYLVLWAVFANALFVKAQLVPACCARCGRRPTGDACYCGEHAHR* |
| Ga0066905_1008384572 | 3300005713 | Tropical Forest Soil | MVLPYLVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRH* |
| Ga0066903_1003418472 | 3300005764 | Tropical Forest Soil | MILPYFVLWATLMNALFVKARWLPPLCARCGRRPSKGDVCFCEYPGRR* |
| Ga0066903_1031209351 | 3300005764 | Tropical Forest Soil | VEVWMILPYFVLWATLMNALFVKARWLPPLCARCGRRPSQGDVCYCEYPNHG* |
| Ga0066903_1046765732 | 3300005764 | Tropical Forest Soil | VQVWLLLPYFVLWATLMNALFVKAKWLPPSCARCGRRPVEGDHCFCEYGRR* |
| Ga0066903_1059735561 | 3300005764 | Tropical Forest Soil | MNALFVKAKWLPPCCARCGRRPAEGDHCFCEYGRG* |
| Ga0081455_109252881 | 3300005937 | Tabebuia Heterophylla Rhizosphere | VQVWMILPYFVLWATLMNALFVKARWLPPVCAQCGRRPAQGEHCYCQYGR* |
| Ga0081539_1000661512 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VQTWMILPYFVLWAVLINALFVKAKILPPSCIRCGRRPEGEACYCEHHPA* |
| Ga0066696_110071221 | 3300006032 | Soil | VQLWMVLPYFVLWATLMNALFVKAKWLPPNCIRCGRRPKQGDHCYCEYGR* |
| Ga0066652_1002747161 | 3300006046 | Soil | YFVLWATLMNALFVKAKWLPPTCAQCGRRPKEGDHCYCEYGR* |
| Ga0066652_1017641061 | 3300006046 | Soil | VQIWMILPYFVLWATLMNALFVKARWLPANCLRCGRRPAQGDSCFCEYGR* |
| Ga0075417_101236172 | 3300006049 | Populus Rhizosphere | MQAWMILPYFVLWAVLINALFVKAKILPPSCIRCGRRPDGDACYCEQHSAEQHPA* |
| Ga0066710_1000423302 | 3300009012 | Grasslands Soil | VQAWLILPYFVLWATLVNALLVKAKLLPPNCVRCGRRPLKGDDCFCEYERA |
| Ga0066710_1014257142 | 3300009012 | Grasslands Soil | MQAWMILPYFVLWATLMNALLVKSKLLPASCIRCGRRPAEGEDCFCEYGRV |
| Ga0066710_1017683123 | 3300009012 | Grasslands Soil | MVLPYFVLWATLMNALFVKAKWLPPNCARCGRRPNEGDHCYCEYGR |
| Ga0099829_100870434 | 3300009038 | Vadose Zone Soil | MILPYFVLWATLMNALLVKSKLLPASCIRCGRRPAEGDDCFCEYGRV* |
| Ga0099830_100492404 | 3300009088 | Vadose Zone Soil | MILPYFVLWATLMNALLVKSKLLPASCIRCGRRPAEGDDCLCEYGRV* |
| Ga0099830_116310682 | 3300009088 | Vadose Zone Soil | MAAWMILPYFVLWATLMNALLVKSKLLPASCVRCGRRPAEGDDCFCEYGRV* |
| Ga0099827_102101803 | 3300009090 | Vadose Zone Soil | MQAWMILPYFVLWATLMNALLVKSKLLPASCVRCGRRPVEGDDCLCEYGRV* |
| Ga0099827_103586873 | 3300009090 | Vadose Zone Soil | MILPYFVMWATLMNALFVKARWLPPSCVRCGRRPKEGDHCYCEYGR* |
| Ga0099827_110956932 | 3300009090 | Vadose Zone Soil | MILPYFVLWATLMNALLVKSKLLPASCVRCGRRPVEGDDCLCEYGRV* |
| Ga0111539_115953541 | 3300009094 | Populus Rhizosphere | MILPYFVLWATLANALFVKAKLVPPACASCGRRHAADDSPFCRR* |
| Ga0066709_1023135261 | 3300009137 | Grasslands Soil | MILPYFVLWATLMNALLVKSKLLPASCIRCGRRPAEGEDCFCEYGRV* |
| Ga0066709_1027171892 | 3300009137 | Grasslands Soil | MILPYFVLWATLASALFVKAKWLPPDCARCGRRPKEGDHCYCEYGR* |
| Ga0066709_1045864252 | 3300009137 | Grasslands Soil | QAWLILPYFVLWATLVNALLVKAKLLPPNCVRCGRRPLKGDACFCEYERA* |
| Ga0105243_103550442 | 3300009148 | Miscanthus Rhizosphere | MLLPYFVMWATLMNALFVKAKWLPATCARCGRRPKEGDHCYCEYGR* |
| Ga0105242_110773982 | 3300009176 | Miscanthus Rhizosphere | MLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPAQGDHCFCEYGR* |
| Ga0105249_119487072 | 3300009553 | Switchgrass Rhizosphere | MILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPSQGDSCFCEYGR* |
| Ga0126307_100123552 | 3300009789 | Serpentine Soil | VQSSMILPYFVLWASLANALFVKAQLVPPLCAGCGRRRPKDDTCHCQH* |
| Ga0126307_100429263 | 3300009789 | Serpentine Soil | MILPYFVLWATLANALFVKAQLVPPLCAHCGRRRRENHTCFSDRVTR* |
| Ga0126374_108570492 | 3300009792 | Tropical Forest Soil | MILPYFVLWATLMNALFVKARWLPPLCARCGRRPSQGDICYCEYPTHR* |
| Ga0126313_103478481 | 3300009840 | Serpentine Soil | VQAWMILPYFVLWATLANALFVKAQLVAPLCASCGRRPSRGDTCHCQV* |
| Ga0126313_108904592 | 3300009840 | Serpentine Soil | MILPYFVLWASLANALFVKAQLVPPLCAGCGRRRPKDDTCHCQH* |
| Ga0126313_117699192 | 3300009840 | Serpentine Soil | MILPYFVLWATLANALFVKAQLVPQVCATCGRRPAKGDTCYCTH* |
| Ga0126309_101438583 | 3300010039 | Serpentine Soil | MILPYFVLWATLANALFVKAKLLPPLCADCGRRPVQGDNCYCASH* |
| Ga0126308_100560702 | 3300010040 | Serpentine Soil | MLLPYFVLWATLMNALFVKAKWLPPSCARCGRRPSEGDNCFCEYGRR* |
| Ga0126312_104341721 | 3300010041 | Serpentine Soil | VYDVWMLLPYFVLWATLMNALFVKAKWLPPSCARCGRRPPEGDHCFCEYGR* |
| Ga0126312_109606711 | 3300010041 | Serpentine Soil | MILPYFVLWATLANALFVKAKLVPPLCVACGRRPPQGDTCYCTH* |
| Ga0126312_110317912 | 3300010041 | Serpentine Soil | MVLAYFVLWATLMNALFVKARWLPPSCLRCGRRPKEGDHCYCEYGR* |
| Ga0126310_107867162 | 3300010044 | Serpentine Soil | MILPYFVLWATLANALFVKAKLVAPLCASCGRRPSKGDTCHCQH* |
| Ga0126311_110891272 | 3300010045 | Serpentine Soil | MVLPYFVLWATLMNALFVKAKWLPPLCARCGRRPKEGDHCYCEYGR* |
| Ga0126376_131001772 | 3300010359 | Tropical Forest Soil | MILPYFVLWATLMNALFVKARWLPPLCARCGRRPSQGDVCYCEYPTHR* |
| Ga0126377_109595712 | 3300010362 | Tropical Forest Soil | MILPYFVLWATLMNALFVKAKWLPPSCARCGRRPAQGDHCFCEYGRH* |
| Ga0134066_104103172 | 3300010364 | Grasslands Soil | MLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRY* |
| Ga0105239_117251882 | 3300010375 | Corn Rhizosphere | MQAWMILPYFVLWAVLINALFVKAKILPPSCIRCGRRPDGDACYCEQRSAEQHPA* |
| Ga0134123_113509212 | 3300010403 | Terrestrial Soil | MLLPYFVMWATLMNALFVKAKWLPPICARCGRRPNQGDHCYCEYGR* |
| Ga0138514_1000029162 | 3300011003 | Soil | MILPYFVMWATLMNALFVKAKWLPPSCVRCGRRPKEGDHCYCEYGRY* |
| Ga0137392_106247582 | 3300011269 | Vadose Zone Soil | MILPYFVLWATLMNALLVKSKLLPASCVRCGRRPAEGDDCFCEYGRV* |
| Ga0120152_10675892 | 3300012011 | Permafrost | MVLPYFVLWATFMNALFVKAKWLPPNCVQCGRRPKEGDHCYCEYGR* |
| Ga0120152_11078092 | 3300012011 | Permafrost | MHGWMILPYFVLWATLMNALLVRAKFLPACCTRCGRRPVEGDACFCEYGR* |
| Ga0137374_100050004 | 3300012204 | Vadose Zone Soil | MILPYFVLWAVLINALFVKAKILPASCVRCGRRPEGDACFCEEHPA* |
| Ga0137374_100160504 | 3300012204 | Vadose Zone Soil | MILPYFVLWATLANALFVKAKLVPPLCATCGRRPPQGDTCYCSH* |
| Ga0137374_100163379 | 3300012204 | Vadose Zone Soil | MNAWLILPYFVLAATLANALFVKSKLLPPNCVRCGRRPKEGDACYCEYGR* |
| Ga0137374_100276165 | 3300012204 | Vadose Zone Soil | MILAYFVLWATLMNALFVKARWLPPSCLRCGRRPTEGDHCYCEYGR* |
| Ga0137374_100584215 | 3300012204 | Vadose Zone Soil | MVLPYFVLWATLVNALFVKAKWIPPNCAQCGRRPIEGDHCYCEYGR* |
| Ga0137374_109388671 | 3300012204 | Vadose Zone Soil | MVLPYFVLWATLMNALFVKAKWLPPTCAQCGRRPKEGDHCYCEYGR* |
| Ga0137380_107292931 | 3300012206 | Vadose Zone Soil | LILPYFVLWATLVNALLVKAKLVPPNCARCGRRPLEGDDCFCEYERA* |
| Ga0137376_101888302 | 3300012208 | Vadose Zone Soil | MVLPYFVLWATLMNALFVKAKWLPPNCAHCGRRPKEGDHCYCVYGR* |
| Ga0137376_102638853 | 3300012208 | Vadose Zone Soil | MQAWLILPYFVLWATLVNALLVKAKLLPPNCVRCGRRPLKGDACFCEYERA* |
| Ga0137379_102547323 | 3300012209 | Vadose Zone Soil | LILPYFVLWATLVNALLVKAKLVPPNCVRCGRRPLQGDACFCEYERA* |
| Ga0137377_111548643 | 3300012211 | Vadose Zone Soil | MILPYFVMWATLMNALFVKAKWLPPSCVRCGRRPKEGDHCYCEYGR* |
| Ga0150985_1075690422 | 3300012212 | Avena Fatua Rhizosphere | AKESCVQVWMILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPAEGDSCFCEYGR* |
| Ga0150985_1106075162 | 3300012212 | Avena Fatua Rhizosphere | SPFAKGALAVQVWMVLPYFVLWATLMNALFVKAKWLPPLCAHCGRRPKEGDHCYCEYGR* |
| Ga0150985_1135684211 | 3300012212 | Avena Fatua Rhizosphere | HVQVWMLLPYFVLWATLMNALFVKAKWLPTCCARCGRRPPEGDHCFCEYGRR* |
| Ga0150985_1209917621 | 3300012212 | Avena Fatua Rhizosphere | MILPYFVLWAVLLDALFVKAKILPASCSHCGRCADGQACAC |
| Ga0137370_109071542 | 3300012285 | Vadose Zone Soil | MVLPYFVLWATLMNALFVKAKWLPPNCVQCGRRPKEGDHCYCEYGRH* |
| Ga0137372_101542862 | 3300012350 | Vadose Zone Soil | MQTWMILPYFVLWATLVNALLVKAKLLPPSCVRCGRRPAAGDDCFCEYGRA* |
| Ga0137372_102441181 | 3300012350 | Vadose Zone Soil | MVLPYFVLWATLMNALFVKAKWLPPLCAQCGRRPKEGDHCYCEYGR* |
| Ga0137372_111815752 | 3300012350 | Vadose Zone Soil | VQVWMVLPYFVLWATLMNALFVKAKWLPPSCARCGRRPKVGDHCYCEYGR* |
| Ga0137369_109929242 | 3300012355 | Vadose Zone Soil | MILPYFVLWATLANALFVKPKLVPPLCATCGRRPPQGDTCYCSH* |
| Ga0137368_104356051 | 3300012358 | Vadose Zone Soil | SHVQVWMILAYFVLWATLMNALFVKARWLPPSCLRCGRRPKEGDHCYCEYGR* |
| Ga0137375_106317572 | 3300012360 | Vadose Zone Soil | MILAYFVLWATLMNALFVKARWLPPSCLRCGRRPKEGDHCFCEYGR* |
| Ga0134053_12797062 | 3300012406 | Grasslands Soil | VQIWMVLPYFVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRR* |
| Ga0150984_1001326322 | 3300012469 | Avena Fatua Rhizosphere | MLLPYFVLWATLMNALFVKAKWLPACCAQCGRRPPQGDHCFCEYGRR* |
| Ga0150984_1126911232 | 3300012469 | Avena Fatua Rhizosphere | MILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPAEGDSCFCEYGR* |
| Ga0150984_1178582401 | 3300012469 | Avena Fatua Rhizosphere | RSPHVQLWMLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRR* |
| Ga0150984_1226870512 | 3300012469 | Avena Fatua Rhizosphere | LARRQRSLHVQVWMLLPYFVLWATLMNALFVKAKWLPACCARCGRRPTEGDHCFCEYGRR |
| Ga0137373_1000487913 | 3300012532 | Vadose Zone Soil | MILAYFVLWATLMNALFVKARWLPPSCLRCGRRPKEGDHCYCEYGR* |
| Ga0137373_100283123 | 3300012532 | Vadose Zone Soil | MILPYFVLWATLVNALLVKAKLLPPSCVRCGRRPAAGDDCFCEYGRA* |
| Ga0157290_102782153 | 3300012909 | Soil | FVLWATLMNALFVKAHWLPPNCIRCGRRPVQGNDCFCEYGR* |
| Ga0164298_116192492 | 3300012955 | Soil | MLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPAEGDHCFCAYGRY* |
| Ga0164303_114381941 | 3300012957 | Soil | LPYFVLWAVLINALFVKAKILPPSCIRCGRRPDGDSCHCEQHPEHHPA* |
| Ga0164301_109462862 | 3300012960 | Soil | MVLPYFVMWATLMNALFVKAKWLPPICIRCGRRPKEGDHCYCEYGR* |
| Ga0134110_102211532 | 3300012975 | Grasslands Soil | MSTWLLLPNFVLAATLANALFVKSKLLPPNCVRCGRRPKEGDTCYCEYGR* |
| Ga0164307_105432162 | 3300012987 | Soil | MILPYFVLWATLMNALFVKARWLPPNCLRCGRRPSEGDSCFCEYGR* |
| Ga0164305_122127772 | 3300012989 | Soil | YFVLWATLMNALFVKAKWLPPCCARCGRRPAEGDHCFCEYGRY* |
| Ga0157378_107991092 | 3300013297 | Miscanthus Rhizosphere | MLLPYFVMWATLMNALFVKAKWLPANCARCGRRPKEGDHCYCEYGR* |
| Ga0120154_11352742 | 3300013501 | Permafrost | MQGWMILPYFVLWATLMNALLVKAKLLPACCVRCGRRPHEGDACFCEYGR* |
| Ga0120179_10158145 | 3300013763 | Permafrost | MQSWMILPYFVLWATLMNALLVKAKFLPACCARCGHRPSEGDACYCEYGR* |
| Ga0120155_11073022 | 3300013768 | Permafrost | MQSWMILPYFVLWATLMNALLVKAKFLPACCARCGHRPSEGGACYCEYGR* |
| Ga0120158_100539712 | 3300013772 | Permafrost | MQTWMILPYFVLWATLMNALLVRAKFLPACCTRCGRRPVEGDACFCEYGR* |
| Ga0120149_12198891 | 3300014058 | Permafrost | GWMILPYFVLWATLMNALLVRAKFLPACCTRCGRRPVEGDACFCEYGR* |
| Ga0134081_100261233 | 3300014150 | Grasslands Soil | MLLLYFVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRR* |
| Ga0182008_106050502 | 3300014497 | Rhizosphere | MVLPYFVLWATLMNALFVKAKWLPPNCARCGRRPKEGDHCYCEYGR* |
| Ga0132258_118981843 | 3300015371 | Arabidopsis Rhizosphere | MLLTYFVLWATLMNALFVKAKWLPPCCARCGRRPAEGDHCFCEYGRY* |
| Ga0132256_1011486962 | 3300015372 | Arabidopsis Rhizosphere | MVLPYFVLWATLMNALFVKARWLPPVCAQCGRRPAQGEHCYCQYGR* |
| Ga0132257_1019457691 | 3300015373 | Arabidopsis Rhizosphere | MLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPAEGDHCFCEYGRD* |
| Ga0132255_1057617381 | 3300015374 | Arabidopsis Rhizosphere | LQVWMILPYFVMWATLMNALFVKAHWLPPLCARCGRRPAQGDVCYCEYPRHEVLRTSSRD |
| Ga0184605_105249182 | 3300018027 | Groundwater Sediment | MILPYFVMWATLMNALFVKAKWLPPNCVQCGRRPKEGDHCYCEYGR |
| Ga0184619_103307551 | 3300018061 | Groundwater Sediment | MVLPYFVMWATLMNALFVKAKWLPPNCIRCGRRPKEGDFCYCEYGR |
| Ga0184618_101679852 | 3300018071 | Groundwater Sediment | VHVWMILPYFVMWATLMNALFVKAKWLPPSCVRCGRRPKEGDHCYCEYGRY |
| Ga0184624_104300382 | 3300018073 | Groundwater Sediment | VTVWMVLPYFVMWATLMNALFVKAKWLPPVCIRCGRRPKEGDHCYCEYGR |
| Ga0184609_101271282 | 3300018076 | Groundwater Sediment | FVKESHVQIWMVLPYFVMWATLMNALFVKAKWLPPNCVQCGRRPKEGDFCYCEYGR |
| Ga0184625_100282143 | 3300018081 | Groundwater Sediment | VTLWMVLPYFVMWATLMNALFVKAKWLPPVCIRCGRRPKEGDHCYCEYGR |
| Ga0066667_105862362 | 3300018433 | Grasslands Soil | VQAWLILPYFVLWATLVNALLVKAKLLPPNCVRCGRRPLKGDACFCEYERA |
| Ga0066662_127869211 | 3300018468 | Grasslands Soil | MQAWMILPYFVLWATLMNALLVKSKLLPASCIRCGRRPAEGDDCFCEYGRV |
| Ga0173482_104417482 | 3300019361 | Soil | MLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPAEGDHCFCEYGRY |
| Ga0210378_100930501 | 3300021073 | Groundwater Sediment | VDVWMVLPYFVMWATLMNALFVKAKWLPPNCIRCGRRPKEGDFCYCEY |
| Ga0247680_10635512 | 3300024246 | Soil | MSTWLILPYFVLAATLANALFVKSKLLPPSCIRCGRRPSEGDHCYCEYGR |
| Ga0207684_101422813 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPAWMILPYFVLWATLMNALLVKSKLLPASCIRCGRRPPEGDDCFCEYGGV |
| Ga0207646_102636383 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MVLPYFVMWATLMNALFVKAKWLPPNCARCGRRPKEGDHCYCEYGR |
| Ga0207646_110872901 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VLNAWLILIYFVLWATLMNALFVKAKVLPPNCSTCGRRPHQGDTCYCEYGR |
| Ga0207690_105698192 | 3300025932 | Corn Rhizosphere | VQVWMILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPSQGDSCFCEY |
| Ga0207686_110810572 | 3300025934 | Miscanthus Rhizosphere | MLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPTEGDHCFCEYGRY |
| Ga0207709_113641251 | 3300025935 | Miscanthus Rhizosphere | MLLPYFVMWATLMNALFVKAKWLPATCARCGRRPKEGDHCYCEYGR |
| Ga0207703_114067012 | 3300026035 | Switchgrass Rhizosphere | VQVWMILPYFVLWATLMNALFVKAHWLPPNCLRCGRRPSQGDSCFCEYGR |
| Ga0207675_1015344902 | 3300026118 | Switchgrass Rhizosphere | MVLPYFVLWATLMNALFVKAKWLPPCCARCGRRPTEGDHCFCEYGRY |
| Ga0209266_12733002 | 3300026327 | Soil | MLLPYLVVWATLMNALFVKARWLPPNCARCGRRPNQGDHCYCEYGR |
| Ga0209159_11345592 | 3300026343 | Soil | MLLPYLVLWATLMNALFVKARWLPPNCARCGRRPNQGDHCYCEYGR |
| Ga0209807_13530622 | 3300026530 | Soil | LILPYFVLWATLVNALLVKAKLVPPNCVRCGRRPAQGDACFCEYERA |
| Ga0209811_103455601 | 3300027821 | Surface Soil | VTVWMVLPYFVMWATLMNALFVKAKWLPPSCARCGRRPKEGDHCYCEYGR |
| Ga0209701_106347632 | 3300027862 | Vadose Zone Soil | MPAWMILPYFVLWATLMNALLVKSKLLPASCIRCGRRPAEGDDCFCEYGRV |
| Ga0209283_105101902 | 3300027875 | Vadose Zone Soil | MILPYFVLWATLMNALLVKSKLLPASCIRCGRRPAEGDDCFCEYGRV |
| Ga0209283_105616172 | 3300027875 | Vadose Zone Soil | LWATLMNALLVKSKLLPASCIRCGRRPAEGDDCFCEYGRV |
| Ga0209590_100146561 | 3300027882 | Vadose Zone Soil | MQAWMILPYFVLWATLMNALLVKSKLLPASCVRCGRRPVEGDDC |
| Ga0209590_102359723 | 3300027882 | Vadose Zone Soil | MILPYFVMWATLMNALFVKARWLPPSCVRCGRRPKEGDHCYCEYGR |
| Ga0209168_100627462 | 3300027986 | Surface Soil | VLNAWLVLTYFVLWATLMNALFVKAKFVPPNCSTCGRRPRQGDTCYCEYGR |
| Ga0307319_102147222 | 3300028722 | Soil | MLLPYFVLWATLMNALFVKAKWLPPSCARCGRRPAQGDHCFCEYGRR |
| Ga0307316_100243794 | 3300028755 | Soil | VQLWMLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRR |
| Ga0307292_101018842 | 3300028811 | Soil | PSKESAVQLWMLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRR |
| Ga0307292_105235331 | 3300028811 | Soil | MILPYFVMWATLMNALFVKAKWLPPSCVRCGRRPKEGDHCYCEYGRY |
| Ga0307289_100482324 | 3300028875 | Soil | WMLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRR |
| Ga0307278_105332882 | 3300028878 | Soil | MILPYFVLWAVLINALFVKAKILPASCVRCGRRPDGDACFCEEHPA |
| Ga0307304_104171131 | 3300028885 | Soil | VHVWMILPYFVMWATLMNALFVKAKWLPPSCVRCGRRPKEGDHCYC |
| Ga0307501_102118822 | 3300031152 | Soil | MLLPYFVLWATLMNALFVKAKWLPPCCARCGRRPSEGDHCFCEYGRR |
| Ga0307498_102533851 | 3300031170 | Soil | MQSWMILPYFVLWATLVNALLVKAKFVPACCARCGRRPTQGDACFCEHGP |
| Ga0307497_100151172 | 3300031226 | Soil | VTVWMVLPYFVMWATLMNAMFVKAKWLPPVCIRCGRRPTEGDHCYCEYGR |
| Ga0318573_104201662 | 3300031564 | Soil | MILPYFVLWATLMNALFVKARWLPPLCARCGRRPAQGDVCFCEYPGRR |
| Ga0308175_1006114691 | 3300031938 | Soil | MILPYLVLWAVFANALFVKAQLVPPTCIRCGRRPDGDACYCGEHAHR |
| Ga0308174_103696343 | 3300031939 | Soil | MQAWMILPYLVLLAVFANALFVKAQLVPPNCARCGRRPQGDACYCREHANR |
| Ga0307416_1000634893 | 3300032002 | Rhizosphere | MILPYFVLWATLANALFVKAQLVPPLCAHCGRRRRENHTCFSDRVTR |
| Ga0315276_110611521 | 3300032177 | Sediment | SWMILPYFVLWATLMNALLVKAKFLPACCARCGRRPAEGDACFCEYGR |
| ⦗Top⦘ |