| Basic Information | |
|---|---|
| Family ID | F026713 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 40 residues |
| Representative Sequence | MSWDDFLNPHEQAEYECSECGAAMQTDKGVCSGTCFEASMI |
| Number of Associated Samples | 137 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 11.68 % |
| % of genes near scaffold ends (potentially truncated) | 23.86 % |
| % of genes from short scaffolds (< 2000 bps) | 58.88 % |
| Associated GOLD sequencing projects | 122 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (72.589 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (18.782 % of family members) |
| Environment Ontology (ENVO) | Unclassified (68.020 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (77.665 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 21.74% β-sheet: 5.80% Coil/Unstructured: 72.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF04466 | Terminase_3 | 24.87 |
| PF04438 | zf-HIT | 14.72 |
| PF08299 | Bac_DnaA_C | 3.05 |
| PF02195 | ParBc | 2.54 |
| PF13481 | AAA_25 | 2.03 |
| PF14550 | Peptidase_S78_2 | 2.03 |
| PF02739 | 5_3_exonuc_N | 2.03 |
| PF00145 | DNA_methylase | 1.52 |
| PF08291 | Peptidase_M15_3 | 1.52 |
| PF13730 | HTH_36 | 1.02 |
| PF12518 | DUF3721 | 1.02 |
| PF00041 | fn3 | 0.51 |
| PF13392 | HNH_3 | 0.51 |
| PF04404 | ERF | 0.51 |
| PF07463 | NUMOD4 | 0.51 |
| PF01510 | Amidase_2 | 0.51 |
| PF04860 | Phage_portal | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG1783 | Phage terminase large subunit | Mobilome: prophages, transposons [X] | 24.87 |
| COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 3.05 |
| COG0258 | 5'-3' exonuclease Xni/ExoIX (flap endonuclease) | Replication, recombination and repair [L] | 2.03 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.52 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 72.59 % |
| All Organisms | root | All Organisms | 27.41 % |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 18.78% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.63% |
| Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 7.61% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 6.60% |
| Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 6.09% |
| Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 5.58% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 5.08% |
| Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 4.57% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 4.57% |
| Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 4.57% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 3.05% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.05% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 2.54% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.03% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 2.03% |
| Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 1.52% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine | 1.52% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 1.52% |
| Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 1.52% |
| Marine | Environmental → Aquatic → Marine → Coastal → Sediment → Marine | 1.02% |
| Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.02% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 1.02% |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.51% |
| Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.51% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.51% |
| Sea-Ice Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine | 0.51% |
| Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.51% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.51% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.51% |
| Freshwater And Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine | 0.51% |
| Diffuse Hydrothermal Flow Volcanic Vent | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Hydrothermal Flow Volcanic Vent | 0.51% |
| Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.51% |
| Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
| 3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
| 3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
| 3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
| 3300000121 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego - site MC sample ARG 03_11.3m | Environmental | Open in IMG/M |
| 3300000127 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 05_45m | Environmental | Open in IMG/M |
| 3300000133 | Marine microbial communities from chronically polluted sediments in Adventfjord, Norway - Svalbard Archipelago station 1 sample NOR 02_45m | Environmental | Open in IMG/M |
| 3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
| 3300000928 | Marine plume microbial communities from the Columbia River - 25 PSU | Environmental | Open in IMG/M |
| 3300000947 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY92 | Host-Associated | Open in IMG/M |
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
| 3300002153 | Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Metagenome | Environmental | Open in IMG/M |
| 3300003543 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS898_N3Area_DNA | Environmental | Open in IMG/M |
| 3300003580 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA | Environmental | Open in IMG/M |
| 3300003620 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_125m_DNA | Environmental | Open in IMG/M |
| 3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
| 3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
| 3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
| 3300005588 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd47.1 | Environmental | Open in IMG/M |
| 3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
| 3300005920 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 | Environmental | Open in IMG/M |
| 3300006029 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006164 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG002-DNA | Environmental | Open in IMG/M |
| 3300006165 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG006-DNA | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006752 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG | Environmental | Open in IMG/M |
| 3300006789 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG | Environmental | Open in IMG/M |
| 3300006793 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
| 3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
| 3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
| 3300006925 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG | Environmental | Open in IMG/M |
| 3300006947 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007540 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG | Environmental | Open in IMG/M |
| 3300007647 | Estuarine microbial communities from the Columbia River estuary - metaG 1370B-02 | Environmental | Open in IMG/M |
| 3300007655 | Estuarine microbial communities from the Columbia River estuary - High salinity metaG S.579 | Environmental | Open in IMG/M |
| 3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
| 3300009003 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 | Environmental | Open in IMG/M |
| 3300009076 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100511 | Environmental | Open in IMG/M |
| 3300009079 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 | Environmental | Open in IMG/M |
| 3300009080 | Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 | Environmental | Open in IMG/M |
| 3300009193 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 | Environmental | Open in IMG/M |
| 3300009423 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100423 | Environmental | Open in IMG/M |
| 3300009505 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 | Environmental | Open in IMG/M |
| 3300009526 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 | Environmental | Open in IMG/M |
| 3300010149 | Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaG | Environmental | Open in IMG/M |
| 3300010150 | Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaG | Environmental | Open in IMG/M |
| 3300010392 | Coastal sediment microbial communities from Rhode Island, USA. Combined Assembly of Gp0121717, Gp0123912, Gp0123935, Gp0139423, Gp0139424, Gp0139388, Gp0139387, Gp0139386, Gp0139385 | Environmental | Open in IMG/M |
| 3300010430 | Marine sediment microbial communities from Gulf of Thailand under amendment with organic carbon and nitrate - JGI co-assembly of 8 samples | Environmental | Open in IMG/M |
| 3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
| 3300017706 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaG | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017713 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 | Environmental | Open in IMG/M |
| 3300017714 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
| 3300017735 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21 | Environmental | Open in IMG/M |
| 3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
| 3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
| 3300017752 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22 | Environmental | Open in IMG/M |
| 3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
| 3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
| 3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
| 3300020169 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160419_1 | Environmental | Open in IMG/M |
| 3300020185 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160517_1 | Environmental | Open in IMG/M |
| 3300020317 | Marine microbial communities from Tara Oceans - TARA_B100000767 (ERX555998-ERR599027) | Environmental | Open in IMG/M |
| 3300020382 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX556058-ERR599059) | Environmental | Open in IMG/M |
| 3300020438 | Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942) | Environmental | Open in IMG/M |
| 3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
| 3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
| 3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
| 3300021371 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO497 | Environmental | Open in IMG/M |
| 3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
| 3300021378 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO131 | Environmental | Open in IMG/M |
| 3300021957 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18D | Environmental | Open in IMG/M |
| 3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
| 3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
| 3300022053 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2) | Environmental | Open in IMG/M |
| 3300022072 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (v3) | Environmental | Open in IMG/M |
| 3300022164 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2) | Environmental | Open in IMG/M |
| 3300022201 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022202 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_21 | Environmental | Open in IMG/M |
| 3300022308 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_24 | Environmental | Open in IMG/M |
| 3300023112 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MG | Environmental | Open in IMG/M |
| 3300023210 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_4_MG | Environmental | Open in IMG/M |
| 3300023271 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_oxic_1_MG | Environmental | Open in IMG/M |
| 3300024062 (restricted) | Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_1 | Environmental | Open in IMG/M |
| 3300024221 | Seawater microbial communities from Monterey Bay, California, United States - 80D | Environmental | Open in IMG/M |
| 3300024226 | Seawater microbial communities from Monterey Bay, California, United States - 81D | Environmental | Open in IMG/M |
| 3300024228 | Seawater microbial communities from Monterey Bay, California, United States - 41D | Environmental | Open in IMG/M |
| 3300024244 | Seawater microbial communities from Monterey Bay, California, United States - 125D_r | Environmental | Open in IMG/M |
| 3300024255 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MG | Environmental | Open in IMG/M |
| 3300024264 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MG | Environmental | Open in IMG/M |
| 3300024314 | Seawater microbial communities from Monterey Bay, California, United States - 70D | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300025070 | Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025085 | Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025103 | Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025108 | Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025276 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG Antarct_55 (SPAdes) | Environmental | Open in IMG/M |
| 3300025483 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025543 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025620 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110516 (SPAdes) | Environmental | Open in IMG/M |
| 3300025640 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110519 (SPAdes) | Environmental | Open in IMG/M |
| 3300025645 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 (SPAdes) | Environmental | Open in IMG/M |
| 3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300026421 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 20R (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300026479 | Seawater microbial communities from Monterey Bay, California, United States - 26D | Environmental | Open in IMG/M |
| 3300027780 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_90 (SPAdes) | Environmental | Open in IMG/M |
| 3300027810 | Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027845 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027861 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MG | Environmental | Open in IMG/M |
| 3300027881 (restricted) | Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_27 | Environmental | Open in IMG/M |
| 3300027967 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdDd00.2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027996 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MG | Environmental | Open in IMG/M |
| 3300028045 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MG | Environmental | Open in IMG/M |
| 3300028125 | Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - SB | Environmental | Open in IMG/M |
| 3300028127 | Seawater microbial communities from Monterey Bay, California, United States - 49D | Environmental | Open in IMG/M |
| 3300028135 | Seawater microbial communities from Monterey Bay, California, United States - 7D | Environmental | Open in IMG/M |
| 3300028287 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI060_120m | Environmental | Open in IMG/M |
| 3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
| 3300031589 | Marine microbial communities from David Island wharf, Antarctic Ocean - #35 | Environmental | Open in IMG/M |
| 3300031629 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #80 | Environmental | Open in IMG/M |
| 3300031631 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #181 | Environmental | Open in IMG/M |
| 3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
| 3300032088 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 21515 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| DelMOSum2010_1000132612 | 3300000101 | Marine | MSWDDFLNPHEQAEYECYECGAEMQEDKQYCCGKCFESSMR* |
| DelMOSum2010_100592781 | 3300000101 | Marine | DDFLNPHEQSEYECYECGADMEEDKQYCCSKCFESSMR* |
| DelMOSum2010_100656382 | 3300000101 | Marine | MEWYDCLNPHEQKEXECSECGKPLXTDDGYCSGTCFEASML* |
| DelMOSum2011_100820373 | 3300000115 | Marine | DFLNPHEQAEYECYECGAEMQEDKQYCCGKCFEASTR* |
| DelMOSum2011_101170924 | 3300000115 | Marine | MSWDDFLNPHEQTEYECSECGAAMQTDKGVCSGACFEASMI* |
| DelMOSum2011_101582941 | 3300000115 | Marine | MSWDDFLNPHEQTEYECSECGATMQTDKGVCSGTCFEASMI* |
| DelMOSum2011_101881671 | 3300000115 | Marine | MIWDDFLNPHEQSEYECYQCGADMEEDKQYCCSKCFESSMR* |
| DelMOSpr2010_100214971 | 3300000116 | Marine | MSWDDFLNPHEQSEYECYECGADMEEDKQYCCSKCFES |
| DelMOSpr2010_100310645 | 3300000116 | Marine | NPHEQSEYECYECGADMEEDKQYCCSKCFESSMR* |
| DelMOSpr2010_100997851 | 3300000116 | Marine | MSWDDFLNPHEQTEYECSECGAAMQTDKGVCSGTCFEASMI* |
| DelMOSpr2010_101142963 | 3300000116 | Marine | MSWDDFLNPHEQAEYECYECGADMQEDKQYCCSKCFESSMR* |
| DelMOWin2010_100062232 | 3300000117 | Marine | MSWDDFLNPHEQAEYECSECGAAMQTDKGVCSGTCFEASMI* |
| TDF_OR_ARG04_113mDRAFT_10028261 | 3300000121 | Marine | MSWDDFLNPHEQPEYECYECGADMEEDKQYCCSKCFESSMR* |
| SA_S1_NOR05_45mDRAFT_100101064 | 3300000127 | Marine | MAWDDYLNPHEQKEFECSECGEPLETDKGYCSGTCFEASML* |
| SA_S1_NOR02_45mDRAFT_10076853 | 3300000133 | Marine | DYLNPHEQKEFECSECGEPLETDKGYCSGTCFEASML* |
| TDF_OR_ARG05_123mDRAFT_10087523 | 3300000242 | Marine | MSWDEFLNPHEQPEYECYECGADMEEDKQYCCSKCFESSMR* |
| OpTDRAFT_101547651 | 3300000928 | Freshwater And Marine | MSWDDFLNTHEQSEYECYECGADMEEDKQYCCSKCFESSMR* |
| BBAY92_100007923 | 3300000947 | Macroalgal Surface | MEWYDAFNPNEQKEFECSECGKPLETDAGYCSGTCFEASMR* |
| BBAY93_100006116 | 3300000973 | Macroalgal Surface | MMEWYDAFNPNEQKEFECSECGKPLETDAGYCSGTCFEASMR* |
| JGI24003J15210_100064708 | 3300001460 | Marine | MAWDDYLNPHEQKEYECSECGEPLETDAGYXSGTCFXASMX* |
| JGI24540J26637_1000008935 | 3300002153 | Marine | MEWYDCLNPHEQKEFECSECGAPMDTDKDVCSGTCFEASMI* |
| FS898DNA_100793513 | 3300003543 | Diffuse Hydrothermal Flow Volcanic Vent | MIWDDFLNPHEQTEYECSECGAAMQTDKGVCSTSCFEASMI* |
| JGI26260J51721_10014702 | 3300003580 | Marine | MDWYDCLNPHEQKEFECSECGTPMDTDKGVCSGTCFEASMI* |
| JGI26260J51721_10033851 | 3300003580 | Marine | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFEASML* |
| JGI26273J51734_100570782 | 3300003620 | Marine | MSWDDFLNPHEQAEYECYECGAEMQEDKQYCCGRCFESSMR* |
| Ga0055584_1026546741 | 3300004097 | Pelagic Marine | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFEASMI* |
| Ga0065861_10494191 | 3300004448 | Marine | MAWDDYLNPHEQKEYECSECGEPLETDKGYCSGTCFEASMI* |
| Ga0073579_16542983 | 3300005239 | Marine | MSWDDFLNTHEQKEYECSECGVAMEKDKGVCSGTCFQASLL* |
| Ga0070728_102932614 | 3300005588 | Marine Sediment | MSWDDFLNPHEQSEYECYQCGADMEEDKQYCCSKCFESSMR* |
| Ga0070727_106800221 | 3300005590 | Marine Sediment | MEWYDCLNPHEQKEYECSECGTPLETDDGYCSGTCFEASML* |
| Ga0070725_100166005 | 3300005920 | Marine Sediment | MSWDDFLNPHEQSEYECYECGADMEEDKQYCCSKCFESSMR* |
| Ga0070725_100657931 | 3300005920 | Marine Sediment | MSWDDFLNPHEQKEYECSECGIAMEKDMGVCSGTCFESSLL* |
| Ga0070725_101001843 | 3300005920 | Marine Sediment | LNPHEQKEYECSECGEPLETDKGYCSGTCFEASMI* |
| Ga0075466_11544873 | 3300006029 | Aqueous | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFEASMR* |
| Ga0075441_103065871 | 3300006164 | Marine | MAWDDYLNPHEQKEYECSECGEPLETDAGYCSGTCFKASMI* |
| Ga0075443_103783181 | 3300006165 | Marine | MAWDDYLNPHEQKEYECSECGEPLEKDAGYCSGTCF |
| Ga0098038_10001645 | 3300006735 | Marine | MSDWDNYLNPHEQEEFECSECGKPMARDTGVCSGICFEASML* |
| Ga0098048_10038646 | 3300006752 | Marine | MWDDFLNPHEQAEYECSECGAAMQTDKGVCSGTCHEASMI* |
| Ga0098048_10931322 | 3300006752 | Marine | MEWHDFLNPHEQKEYECSECGKPLDTDDGYCSGTCFEASMI* |
| Ga0098048_11407221 | 3300006752 | Marine | MSWDDFLNPHEQADYECYECGAEMQEDKQYCCGKCF |
| Ga0098054_100457411 | 3300006789 | Marine | MSWDDFLNPHEQGDYECQECGTSMIHQRQYCSTTCFEASMR* |
| Ga0098054_10051499 | 3300006789 | Marine | MSWDDLLNPHEQKEYECSECGVAMEKDKGVCSGTCFEASLL* |
| Ga0098054_10890251 | 3300006789 | Marine | MSWDDFLNPHEQAEYECSECGATMQTDKGVCSGTCFEASMI* |
| Ga0098055_10131279 | 3300006793 | Marine | MSWDDFLNPHEQYEYQCSECGSKMQTDKGVCSGTCHEASLI* |
| Ga0098055_10289613 | 3300006793 | Marine | MSWDDLLNPHEQKEYECSECGVAMEKDKGVCSGTCFKASLL* |
| Ga0098055_10444343 | 3300006793 | Marine | MSWDDFLNPHEQKEYECSECGVAMEKDKGVCSGTCFEASLL* |
| Ga0098055_11237201 | 3300006793 | Marine | WDDFLNPHEQAEYECSECGAAMQTDKGVCSGTCFEASMI* |
| Ga0098055_13896633 | 3300006793 | Marine | MSWHDFLNPHEQTEYECSECGAAMQTDKGVCSGTCFEASMI* |
| Ga0070749_100038985 | 3300006802 | Aqueous | MEWYDCLNPHEQKEYECSECGKPLEKDDGYCSGTCFEASML* |
| Ga0070754_1000081135 | 3300006810 | Aqueous | MEWYDYLNPHEQKEYECSECGKPLEKDDGYCSGTCFEASML* |
| Ga0070754_100788464 | 3300006810 | Aqueous | MSWDDFLNPHEQAEYECSECGAAMQSDKGVCSGTCFEASMI* |
| Ga0070746_102842701 | 3300006919 | Aqueous | MSWDDFLNPHEQGDYECQECGTSMIHQRQYCSTSC |
| Ga0070748_10269152 | 3300006920 | Aqueous | MSWDDFLNPHEQGDYECQECGTSMIHQRQYCSTSCFEASMR* |
| Ga0098045_10707711 | 3300006922 | Marine | MEWYDCLNPHEQKEYECSECGKPLETDGGYCSGTCFEA |
| Ga0098051_10510515 | 3300006924 | Marine | MSWDDFLNPHEQAEYECSECGAAMQTDKGVCSGTCHEASMI* |
| Ga0098050_10513712 | 3300006925 | Marine | MNWDDFLNPHEQKEYECSECGVAMEKDKGVCSGTCFEASLL* |
| Ga0075444_100419891 | 3300006947 | Marine | MSEWYDFLDPAEQPEYECSECGKPLHHDKEYCSQSCFNASML* |
| Ga0075444_101819072 | 3300006947 | Marine | MAWDDYLNPHEQKEYECSECGEPLEKDAGYCSGTCFKASMI* |
| Ga0070747_10341441 | 3300007276 | Aqueous | NIFWNMSWDDFLNPHEQAEYECYECGAEMQEDKQYCCGKCFESSMR* |
| Ga0099847_10051416 | 3300007540 | Aqueous | MSWDNFLNPHEQAEYECYECGAEMQEDKQYCCGKCFESSMR* |
| Ga0099847_11195373 | 3300007540 | Aqueous | MEWYDCLNPHEQKEYECSECGKPLDTDDGYCSGTCFEASML* |
| Ga0102855_10217993 | 3300007647 | Estuarine | MEWYDCLNPHEQKEYECSECGKPLEKDEGYCSGTCFEASMI* |
| Ga0102825_11084922 | 3300007655 | Estuarine | MSWDDFLNPNEQTEYECSECGAAMQTDKGVCSGTCFEASMI* |
| Ga0115371_105014645 | 3300008470 | Sediment | MSWDDFLNPHEQAEYECYECGADMQEDKQYCCTKCFESSMR* |
| Ga0115371_107638831 | 3300008470 | Sediment | DYLNPHEQKEYECSECGKPLETDDGYCSGTCFEASML* |
| Ga0115371_108730123 | 3300008470 | Sediment | MSWDDFLNPHEQSEYECQQCGSDMEEDKQYCCSKCFEGSMR* |
| Ga0102813_10248654 | 3300009003 | Estuarine | MEWYDFLNPHEQKEYECSECGTPLETDKGYCSGTCFEASMI* |
| Ga0115550_10594632 | 3300009076 | Pelagic Marine | MEWYDFLNPNEQKEYECSECGKPLETDDGYCSGTCFEASMI* |
| Ga0115550_11685762 | 3300009076 | Pelagic Marine | MEWYDCLNPHEQKEYECSECGKPLGTDAGYCSGTCFEASMR* |
| Ga0102814_103314702 | 3300009079 | Estuarine | MAWDDYLNPHEQKEYECSECGEPLETDAGYCSGTCFKASML* |
| Ga0102815_104384593 | 3300009080 | Estuarine | MEWYDFLNPLEQDEFECSECGAPIAEDKQYCSQSCFSASMR* |
| Ga0115551_12025254 | 3300009193 | Pelagic Marine | MSWNDFLNPYEQDEFQCSECGVYMQKDTGVCSGICHEASMI* |
| Ga0115548_11573513 | 3300009423 | Pelagic Marine | MEWYDCLNPHEQKEYECSECGKPLGTDAGYCSGTCFEA |
| Ga0115564_1000124711 | 3300009505 | Pelagic Marine | MEWYDSLNPLEQDEFECSECGAPIATDKQYCSQSCFSASMR* |
| Ga0115564_102504392 | 3300009505 | Pelagic Marine | DCLNPHEQKEYECSECGKPLETDDGYCSGTCFEASMI* |
| Ga0115004_100445015 | 3300009526 | Marine | MAWDDYLNRHEQKEYECSECGEPLETDAGYCSGTCFKSSML* |
| Ga0098049_10195685 | 3300010149 | Marine | LNPHEQAEYECSECGAAMQTDKGVCSGTCHEASMI* |
| Ga0098049_10318074 | 3300010149 | Marine | MEWYDCLNPHEQKEYVCSECGKPLETDDGYCSGTCFEASMI* |
| Ga0098056_11307151 | 3300010150 | Marine | MSWHDFLNPHEQAEYECSECGAAMQTDKGVCSGTCFEASII* |
| Ga0098056_12660401 | 3300010150 | Marine | NMSWDDFLNPHEQAEYECSECGAAMQTDKGVCSGTCFEASMI* |
| Ga0118731_1013768992 | 3300010392 | Marine | MEWYDCLNPHEQKQYECSECGKPLETDDGYCSGTCFEASMI* |
| Ga0118731_1139785683 | 3300010392 | Marine | MSWDDFLNPHEQAEYECYECGAEMQEDKQYCCGKCFEASTR* |
| Ga0118733_1090900382 | 3300010430 | Marine Sediment | MSWDDFLNPHEQSDYECSECGVAMEKDKGVCSGTCFQASLL* |
| Ga0164320_100817734 | 3300013098 | Marine Sediment | MSWDDFLNPHEQSEYECSECGVAMEKDKGVCSGTCFEASLL* |
| Ga0181377_10719593 | 3300017706 | Marine | MSWYDFLNPHEQGEYECSECGAVMQTDKGVCSGTCHEASMI |
| Ga0181369_10280242 | 3300017708 | Marine | MSWDDFLNPHEQTEYECSECGAAMQTDKLVCSETCHEASMI |
| Ga0181391_10068915 | 3300017713 | Seawater | FWNMSWDDFLNPHEQAEYECSECGAAMQTDKGVCCGTCFEASMI |
| Ga0181412_10167202 | 3300017714 | Seawater | MSWDDFLNPHEQTEYACSECGAAMQTDKGVCSGTCFEASIR |
| Ga0181412_11274762 | 3300017714 | Seawater | WDDFLNPHEQAEYECYECGTEMQEDKQYCSTSCFEASMI |
| Ga0181390_100012945 | 3300017719 | Seawater | MSWDDFLNPHEQAEYECSECGAAMQTDKGVCCGTCFEASMI |
| Ga0181396_10066945 | 3300017729 | Seawater | MSWHDFLNPHEQTEYECSECGAAMETDKGVCSGTCFEASMI |
| Ga0181431_100007624 | 3300017735 | Seawater | MSWHDFLNPHEQDEYECTECGTSMPKDTGVCSGICFEASMI |
| Ga0181431_100014018 | 3300017735 | Seawater | MEWYDFLNPHEQDEFECSECGTPMAEDNRYCSGSCFEASMR |
| Ga0181421_11518303 | 3300017741 | Seawater | DDFLNPHEQTEYECSECGAAMQTDKGVCSGTCFEASMI |
| Ga0181399_10067738 | 3300017742 | Seawater | MSWDDFLNPNEQSEYECSECGVAMEKDKGVCSGTCFQASLL |
| Ga0181400_10953892 | 3300017752 | Seawater | MSWDDFLNPHKQSEYECSECGLAMERDNGVCSGNCFEASLL |
| Ga0181410_11295902 | 3300017763 | Seawater | MSWDDFLNPHEQAEYECYECGTEMQEDKQYCSTSCFKANMI |
| Ga0181423_13026984 | 3300017781 | Seawater | MSWYDFLNPHEQAEYECYECGTEMQEDKQYCSTSCFKA |
| Ga0206125_1001143612 | 3300020165 | Seawater | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFEASML |
| Ga0206125_100170691 | 3300020165 | Seawater | MMEWYDALNPNEQKEFECSECGKPLETDAGYCSGTCFEASMR |
| Ga0206125_101129533 | 3300020165 | Seawater | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFEASMI |
| Ga0206125_101291461 | 3300020165 | Seawater | MEWYDFLNPNEQKEYECSECGKPLETDDGYCSGTCFEASML |
| Ga0206125_102731691 | 3300020165 | Seawater | MEWYDCLNPHEQKEYECSECGTPLETDDGYCSGTCFEASMI |
| Ga0206127_12629842 | 3300020169 | Seawater | MEWYDFLNPNEQKEYECSECGKPLETDDGYCSGTCFEASMI |
| Ga0206131_100422881 | 3300020185 | Seawater | DMEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFEASMI |
| Ga0211688_10006568 | 3300020317 | Marine | MSWDDFLNPHEQSEYECYECGADMEEDKQYCCSKCFESSMR |
| Ga0211686_100217505 | 3300020382 | Marine | MSEWYDFLDPAEQPEYECSECGKPLHHDKEYCSQSCFNASML |
| Ga0211686_100722762 | 3300020382 | Marine | MAWDDYLNPHEQKEYECSECGEPLETDAGYCSGTCFKASMI |
| Ga0211576_105305411 | 3300020438 | Marine | MSWDDFLNPHEQAEYECYECGTEMQEDKQYCSTSCFKASM |
| Ga0211577_100253018 | 3300020469 | Marine | MSWDDFLNPHEQAEYECYECGTEMQEDKQYCSTSCFKASMI |
| Ga0206677_1000060419 | 3300021085 | Seawater | MSWDDFLNPHEQSEYECSECGVAMEKDKGVCSGTCFEASLL |
| Ga0206123_101378014 | 3300021365 | Seawater | MEWYDCLNPHEQKEYECSECGTPLETDDGYCSGTCFEASML |
| Ga0206123_103156721 | 3300021365 | Seawater | MEWYDALNPNEQKEFECSECGKPLETDAGYCSGTCFEASMR |
| Ga0206123_103307151 | 3300021365 | Seawater | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCF |
| Ga0213863_1000048934 | 3300021371 | Seawater | MSWDDFLNPHEQTEYECSECGAAMQTDKGVCSGTCFEASMI |
| Ga0213863_100558911 | 3300021371 | Seawater | MEWYDCLNPHEQKEYECSECGKPLEKDDGYCSGTCFEASML |
| Ga0213865_100012328 | 3300021373 | Seawater | MEWYDYLNPHEQKEYECSECGKPLEKDDGYCSGTCFEASML |
| Ga0213865_102449701 | 3300021373 | Seawater | MEWYDCLNPHEQKEFECSECGEPLETDAGYCSATCFKASMI |
| Ga0213861_105553674 | 3300021378 | Seawater | MSWDDFLNPHEQGEYECSECGAAMETDKGVCSGTCHEASMI |
| Ga0222717_100137006 | 3300021957 | Estuarine Water | MSWDDFLNPHEQSEYECYECGAEMQEDKQYCCGKCFESSIR |
| Ga0222717_100140796 | 3300021957 | Estuarine Water | MSWDDFLNPHEQAEYECYECGAEMQEDKQYCCGRCFESSMR |
| Ga0222717_101952712 | 3300021957 | Estuarine Water | MSWDDFLNPHEQTEYECSECGAAMQSDKGVCSGTCFEASMI |
| Ga0222717_103663111 | 3300021957 | Estuarine Water | MEWYDCLNPHEQKEYECSECGKPLEKDEGYCSGTCFEASMI |
| Ga0222718_101035505 | 3300021958 | Estuarine Water | MSWDDFLNPHEQAEYECYECGAEMQEDKQYCCGKCFESSIR |
| Ga0222716_102901015 | 3300021959 | Estuarine Water | MSWDDFLNPHEQAEYECSECGAAMQTDKGVCSGTCFEASMI |
| Ga0212030_10354044 | 3300022053 | Aqueous | MSWDDFLNPHEQAEYECYECGAEMQEDKQYCCGKCFESSMR |
| Ga0196889_10200311 | 3300022072 | Aqueous | MSWDDFLNPHEQAEYECYECGAEMQEDKQYCCGKCFESSM |
| Ga0212022_10425501 | 3300022164 | Aqueous | MSWDDFLNPHEQAEYECYECGAEMQEDKQYCCGKCFEASTR |
| Ga0212022_10691522 | 3300022164 | Aqueous | RNPHEQKEYECSECGKPLEKDDGYCSGTCFEASML |
| Ga0224503_102967573 | 3300022201 | Sediment | MSWDDFLNPNEQSEYECSECGVAMEKDNGVCSGTCFQASLLXKKKIL |
| Ga0224498_101184712 | 3300022202 | Sediment | MSWDDFLNPYEQSEYECYECGADMEEDKQYCCSKCFESSMR |
| Ga0224504_104675501 | 3300022308 | Sediment | MMEWYDALNPHEQKEYECSECGKPLETDDGYCSGTCFEASMI |
| (restricted) Ga0233411_1000009123 | 3300023112 | Seawater | MSWDDFLNPNEQSEYECSECGVAMEKDKGVCSGTCFEASLL |
| (restricted) Ga0233411_100510801 | 3300023112 | Seawater | MSWDDFLNPHEQSEYECYECGADMEEDKQYCCSKCFEISMR |
| (restricted) Ga0233412_100165235 | 3300023210 | Seawater | MSWDDFLNPHEQGDYECQECGTSMIHQRQYCSTSCFEASMR |
| (restricted) Ga0233403_100212382 | 3300023271 | Seawater | MEWYDFLNPLEQDEFECSECGAPIAEDKQYCSQSCFSASMR |
| (restricted) Ga0255039_100155355 | 3300024062 | Seawater | WDDFLNPHEQAEYECYECGAEMQEDKQYCCGRCFESSMR |
| Ga0228666_10220554 | 3300024221 | Seawater | MEWYDCLNPHEQKEYECSECGKPLEKDDGYCSGTCFEASM |
| Ga0228666_10665531 | 3300024221 | Seawater | MEWYDCLNPHEQKEYECSECGKPLEKDEGYCSGTCFEASML |
| Ga0228667_10342304 | 3300024226 | Seawater | MEWYDCLNPHEQKEYECSECGKPLEKDDGYCSGTCFEASMLRYSLCSS |
| Ga0228633_10792411 | 3300024228 | Seawater | MELYDFLNPHEQKEYECSECGKPLETDKGYCSGTCFEASMI |
| Ga0228678_10626532 | 3300024244 | Seawater | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFEASII |
| (restricted) Ga0233438_100055487 | 3300024255 | Seawater | MSWHFTFLNPHEQDEYECTECGTSMPKDTGVCSGTCHEASMI |
| (restricted) Ga0233444_100077543 | 3300024264 | Seawater | MSWDDFLNPHEQAEYECYECGAEMQEDKQYCCGKCFEASMR |
| (restricted) Ga0233444_101372583 | 3300024264 | Seawater | MSWDDFLNPHEQAEYECYECGADMQEDKQYCCSKCFESSMR |
| Ga0228657_10167061 | 3300024314 | Seawater | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTC |
| Ga0244775_100301072 | 3300024346 | Estuarine | MSWDDFLNPNEQTEYECSECGAAMQTDKGVCSGTCFEASMI |
| Ga0208667_10010493 | 3300025070 | Marine | MWDDFLNPHEQAEYECSECGAAMQTDKGVCSGTCHEASMI |
| Ga0208298_100486710 | 3300025084 | Marine | MSWDDLLNPHEQKEYECSECGVAMEKDKGVCSGTCFKASLL |
| Ga0208298_10213151 | 3300025084 | Marine | NIRGMSWDDFLNPHEQAEYECSECGAAMQTDKGVCSGTCHEASMI |
| Ga0208792_10035826 | 3300025085 | Marine | MSWDDFLNPHEQAEYECSECGAAMQTDKGVCSGTCHEASMI |
| Ga0208792_10042748 | 3300025085 | Marine | MNWDDFLNPHEQKEYECSECGVAMEKDKGVCSGTCFEASLL |
| Ga0208157_100030149 | 3300025086 | Marine | MSDWDNYLNPHEQEEFECSECGKPMARDTGVCSGICFEASML |
| Ga0208013_10049408 | 3300025103 | Marine | MSWDDFLNPHEQGDYECQECGTSMIHQRQYCSTTCFEASMR |
| Ga0208793_10114362 | 3300025108 | Marine | MSWDDFLNPHEQYEYQCSECGSKMQTDKGVCSGTCHEASLI |
| Ga0208793_11912471 | 3300025108 | Marine | MSWHDFLNPHEQTEYECSECGAAMQTDKGVCSGTCFEASMI |
| Ga0209535_10145445 | 3300025120 | Marine | MAWDDYLNPHEQKEYECSECGEPLETDAGYCSGTCFKASML |
| Ga0209336_100533714 | 3300025137 | Marine | MIWDDFLNPHEQTEYECSECGAAMQTDKGVCSTSCFEASMI |
| Ga0208814_100088411 | 3300025276 | Deep Ocean | MSEWYDFLDPAEQPEYECSECGKPLHHEKEYCSQSCFNASML |
| Ga0208814_100181514 | 3300025276 | Deep Ocean | MSWDDFLNPHEQLEYECQQCGSDMEEDKQYCCSKCFEGSMR |
| Ga0208814_10023135 | 3300025276 | Deep Ocean | MSWDDFLNPHEQSEYECQQCGADMEEDKQYCCSKCFEGSMR |
| Ga0208814_10196233 | 3300025276 | Deep Ocean | MAWDDYLNPHEQKEYECSECGEPLEKDAGYCSGTCFKASMI |
| Ga0208814_10327131 | 3300025276 | Deep Ocean | MAWDDYLNPHEQKEYECSECGEPLERDAGYCSGTCFKASMI |
| Ga0208814_11495781 | 3300025276 | Deep Ocean | SWDDFLNPHEQSEYECYECGADMEEDKQYCCSKCFEGSMR |
| Ga0209557_10116633 | 3300025483 | Marine | MDWYDCLNPHEQKEFECSECGTPMDTDKGVCSGTCFEASMI |
| Ga0208303_10848712 | 3300025543 | Aqueous | DCLNPHEQKEYECSECGKPLEKDDGYCSGTCFEASML |
| Ga0208303_10863173 | 3300025543 | Aqueous | MEWYDCLNPHEQKEYECSECGKPLDTDDGYCSGTCFEASML |
| Ga0209405_100180711 | 3300025620 | Pelagic Marine | MEWYDCLNPHEQKEYECSECGKPLGTDAGYCSGTCFEASMR |
| Ga0209198_10816264 | 3300025640 | Pelagic Marine | MAWDDYLNPHEQKEYECSECGEPLETDAGYCSGTC |
| Ga0208643_100096512 | 3300025645 | Aqueous | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFEASMR |
| Ga0209199_100146532 | 3300025809 | Pelagic Marine | MEWYDSLNPLEQDEFECSECGAPIATDKQYCSQSCFSASMR |
| Ga0208645_10790353 | 3300025853 | Aqueous | MSWDDFLNPHEQAEYECSECGAAMQSDKGVCSGTCFEASMI |
| Ga0247569_10205777 | 3300026421 | Seawater | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFE |
| Ga0228622_10542781 | 3300026479 | Seawater | MAWDDYLNPHEQKEYECSECGKPLETDDGYCSGTCFEASMI |
| Ga0209502_103272363 | 3300027780 | Marine | MAWDDYLNRHEQKEYECSECGEPLETDAGYCSGTCFKSSML |
| Ga0209302_100721604 | 3300027810 | Marine | MAWDDYLNPHEQKEYECSECGEPLETDKGYCSGTCFEASMI |
| Ga0209271_100162367 | 3300027845 | Marine Sediment | MSWDDFLNPHEQKEYECSECGIAMEKDMGVCSGTCFESSLL |
| Ga0209271_101719631 | 3300027845 | Marine Sediment | MSWDDFLNPHEQTEYECSECGAAMQTDKGVCSGTC |
| (restricted) Ga0233415_100232047 | 3300027861 | Seawater | MSWDDFLNPHEQSEYECSECGVAMEKDKGVCSGTCFQASLL |
| (restricted) Ga0255055_103638482 | 3300027881 | Seawater | MEWYDFLNPNEQKEFECTECGTSIESEGVCSRDCFNASML |
| Ga0209272_102200753 | 3300027967 | Marine Sediment | MSWDDFLNPHEQSEYECYECGADMEEDKQYCCSKCFESSMRXFKLVLRMN |
| (restricted) Ga0233413_101593091 | 3300027996 | Seawater | MSWDDFLNPHEQTEYECSECGAAMQTDKVVCSGTCFEASM |
| (restricted) Ga0233414_102621151 | 3300028045 | Seawater | MSWDDFLNPHEQTDYECSECGVAMEKDKGVCSGTCFE |
| Ga0256368_10029032 | 3300028125 | Sea-Ice Brine | MAWDDYLNPHEQKEYECSECGEPLKTDKGYCSGTCFEASMI |
| Ga0233401_11164691 | 3300028127 | Seawater | MEWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFK |
| Ga0228606_10875402 | 3300028135 | Seawater | EWYDCLNPHEQKEYECSECGKPLETDDGYCSGTCFEASML |
| Ga0257126_11040253 | 3300028287 | Marine | MSWDDFLNPHEQTEYECSECGAAMQTDKVVCSGTCFEASMR |
| Ga0265306_107599051 | 3300028598 | Sediment | MEWYDCLNPHEQKEYECSECGTPLETDDGYCSGTCF |
| Ga0307488_100058605 | 3300031519 | Sackhole Brine | MAWDDYLNPHEQKEYECSECGEPLETDAGYCSGTCFEASMI |
| Ga0307488_103396112 | 3300031519 | Sackhole Brine | MSWDDFLNPHEQSEYECYECGADMQEDKQYCSSKCFESSMR |
| Ga0307488_103485172 | 3300031519 | Sackhole Brine | MSWDDFLNPHEQAEYECYECGADMQEDKQYCCSKCFESSMM |
| Ga0307996_10198351 | 3300031589 | Marine | MSWDDFLNPHEQSEYECYECGADMEEDKQYCCSKCFEGSMR |
| Ga0307985_100398225 | 3300031629 | Marine | MEEWYDFLDPAEQAEYECSECGKPLQEDKGYCSGSCFESSMR |
| Ga0307987_11255461 | 3300031631 | Marine | MSWDDFLNPHEQAEFECHECGAEMQEDKQYCCSKCFESSMR |
| Ga0307987_11265544 | 3300031631 | Marine | MSWDDFLNPHEQAEFECYECGADMQEDKQYCSSKCFESSM |
| Ga0307377_100731265 | 3300031673 | Soil | MSWDDFLNPHEQAEYECYECGADMQEDKQYCCNKCFESSMR |
| Ga0315321_101293416 | 3300032088 | Seawater | MSWDDFLNPHEQSDYECSECGVAMEKDKGVCSGTCFEASLL |
| ⦗Top⦘ |