| Basic Information | |
|---|---|
| Family ID | F026679 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 46 residues |
| Representative Sequence | LTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Number of Associated Samples | 163 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 85.79 % |
| % of genes from short scaffolds (< 2000 bps) | 79.19 % |
| Associated GOLD sequencing projects | 157 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.142 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (19.289 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.919 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.162 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.00% β-sheet: 26.67% Coil/Unstructured: 69.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF01966 | HD | 4.57 |
| PF01464 | SLT | 4.06 |
| PF04075 | F420H2_quin_red | 3.05 |
| PF12840 | HTH_20 | 2.54 |
| PF00664 | ABC_membrane | 2.03 |
| PF13424 | TPR_12 | 2.03 |
| PF00171 | Aldedh | 2.03 |
| PF00561 | Abhydrolase_1 | 2.03 |
| PF12697 | Abhydrolase_6 | 1.02 |
| PF12867 | DinB_2 | 1.02 |
| PF05157 | T2SSE_N | 1.02 |
| PF07883 | Cupin_2 | 1.02 |
| PF13511 | DUF4124 | 1.02 |
| PF13508 | Acetyltransf_7 | 1.02 |
| PF05147 | LANC_like | 1.02 |
| PF00293 | NUDIX | 1.02 |
| PF00589 | Phage_integrase | 0.51 |
| PF10417 | 1-cysPrx_C | 0.51 |
| PF04978 | DUF664 | 0.51 |
| PF00005 | ABC_tran | 0.51 |
| PF01590 | GAF | 0.51 |
| PF01061 | ABC2_membrane | 0.51 |
| PF05726 | Pirin_C | 0.51 |
| PF01027 | Bax1-I | 0.51 |
| PF00082 | Peptidase_S8 | 0.51 |
| PF12681 | Glyoxalase_2 | 0.51 |
| PF10282 | Lactonase | 0.51 |
| PF01709 | Transcrip_reg | 0.51 |
| PF00932 | LTD | 0.51 |
| PF08241 | Methyltransf_11 | 0.51 |
| PF00291 | PALP | 0.51 |
| PF02861 | Clp_N | 0.51 |
| PF00165 | HTH_AraC | 0.51 |
| PF07508 | Recombinase | 0.51 |
| PF07837 | FTCD_N | 0.51 |
| PF01425 | Amidase | 0.51 |
| PF03167 | UDG | 0.51 |
| PF13408 | Zn_ribbon_recom | 0.51 |
| PF01152 | Bac_globin | 0.51 |
| PF13527 | Acetyltransf_9 | 0.51 |
| PF00873 | ACR_tran | 0.51 |
| PF00196 | GerE | 0.51 |
| PF03795 | YCII | 0.51 |
| PF00581 | Rhodanese | 0.51 |
| PF12802 | MarR_2 | 0.51 |
| PF01042 | Ribonuc_L-PSP | 0.51 |
| PF03992 | ABM | 0.51 |
| PF13602 | ADH_zinc_N_2 | 0.51 |
| PF06983 | 3-dmu-9_3-mt | 0.51 |
| PF01636 | APH | 0.51 |
| PF02771 | Acyl-CoA_dh_N | 0.51 |
| PF01609 | DDE_Tnp_1 | 0.51 |
| PF00392 | GntR | 0.51 |
| PF04191 | PEMT | 0.51 |
| PF03404 | Mo-co_dimer | 0.51 |
| PF08327 | AHSA1 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.03 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.03 |
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.03 |
| COG4403 | Lantibiotic modifying enzyme | Defense mechanisms [V] | 1.02 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.51 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.51 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.51 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.51 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.51 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 0.51 |
| COG3643 | Glutamate formiminotransferase | Amino acid transport and metabolism [E] | 0.51 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.51 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.51 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.51 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.51 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 0.51 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.51 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.51 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.51 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.51 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 0.51 |
| COG0542 | ATP-dependent Clp protease, ATP-binding subunit ClpA | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.51 |
| COG0217 | Transcriptional and/or translational regulatory protein YebC/TACO1 | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 76.14 % |
| Unclassified | root | N/A | 23.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2170459012|GOYVCMS02GAAKT | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300000858|JGI10213J12805_10147689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Intrasporangiaceae → Humibacillus → unclassified Humibacillus → Humibacillus sp. DSM 29435 | 532 | Open in IMG/M |
| 3300004114|Ga0062593_102646000 | Not Available | 570 | Open in IMG/M |
| 3300004463|Ga0063356_101857335 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300005105|Ga0066812_1006950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 734 | Open in IMG/M |
| 3300005171|Ga0066677_10093461 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300005174|Ga0066680_10838803 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300005332|Ga0066388_100420470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1980 | Open in IMG/M |
| 3300005332|Ga0066388_100702173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1618 | Open in IMG/M |
| 3300005345|Ga0070692_11049200 | Not Available | 573 | Open in IMG/M |
| 3300005434|Ga0070709_10128053 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300005434|Ga0070709_10297171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1178 | Open in IMG/M |
| 3300005434|Ga0070709_10302454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1169 | Open in IMG/M |
| 3300005434|Ga0070709_11600153 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005434|Ga0070709_11760358 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300005439|Ga0070711_100311240 | All Organisms → cellular organisms → Bacteria | 1255 | Open in IMG/M |
| 3300005445|Ga0070708_100668135 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300005468|Ga0070707_100273436 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300005471|Ga0070698_100260183 | All Organisms → cellular organisms → Bacteria | 1667 | Open in IMG/M |
| 3300005471|Ga0070698_100294655 | All Organisms → cellular organisms → Bacteria | 1553 | Open in IMG/M |
| 3300005530|Ga0070679_101707750 | Not Available | 578 | Open in IMG/M |
| 3300005556|Ga0066707_10505588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 784 | Open in IMG/M |
| 3300005564|Ga0070664_101852489 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300005564|Ga0070664_102149233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 530 | Open in IMG/M |
| 3300005614|Ga0068856_100443543 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1319 | Open in IMG/M |
| 3300005615|Ga0070702_100611456 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300005764|Ga0066903_100377586 | All Organisms → cellular organisms → Bacteria | 2314 | Open in IMG/M |
| 3300005764|Ga0066903_101446403 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1294 | Open in IMG/M |
| 3300005764|Ga0066903_103533153 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 842 | Open in IMG/M |
| 3300005764|Ga0066903_104607831 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005764|Ga0066903_105983012 | Not Available | 637 | Open in IMG/M |
| 3300005764|Ga0066903_106474307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 610 | Open in IMG/M |
| 3300005764|Ga0066903_108440195 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300006173|Ga0070716_100416244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 971 | Open in IMG/M |
| 3300006175|Ga0070712_100477802 | All Organisms → cellular organisms → Bacteria | 1041 | Open in IMG/M |
| 3300006175|Ga0070712_101596918 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300006237|Ga0097621_100905224 | All Organisms → cellular organisms → Bacteria | 822 | Open in IMG/M |
| 3300006844|Ga0075428_101654204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → environmental samples → uncultured Solirubrobacteraceae bacterium | 669 | Open in IMG/M |
| 3300006871|Ga0075434_100983925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 858 | Open in IMG/M |
| 3300006876|Ga0079217_10843991 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300006894|Ga0079215_10220428 | All Organisms → cellular organisms → Bacteria | 979 | Open in IMG/M |
| 3300006914|Ga0075436_100465370 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300009137|Ga0066709_103598334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300009156|Ga0111538_12991431 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009174|Ga0105241_11484056 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300009176|Ga0105242_10468912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1191 | Open in IMG/M |
| 3300009176|Ga0105242_11119461 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300009553|Ga0105249_12528740 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300009792|Ga0126374_10900337 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 685 | Open in IMG/M |
| 3300010043|Ga0126380_10073644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1948 | Open in IMG/M |
| 3300010047|Ga0126382_12497998 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010154|Ga0127503_10488201 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300010335|Ga0134063_10419938 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300010359|Ga0126376_11650939 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300010360|Ga0126372_10059419 | All Organisms → cellular organisms → Bacteria | 2649 | Open in IMG/M |
| 3300010360|Ga0126372_10207125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1640 | Open in IMG/M |
| 3300010361|Ga0126378_10462286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1383 | Open in IMG/M |
| 3300010366|Ga0126379_10996584 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 942 | Open in IMG/M |
| 3300010371|Ga0134125_11263713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → unclassified Thermoleophilia → Thermoleophilia bacterium | 806 | Open in IMG/M |
| 3300010376|Ga0126381_103116090 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300010398|Ga0126383_10837256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744 | 1004 | Open in IMG/M |
| 3300010398|Ga0126383_12672390 | All Organisms → cellular organisms → Bacteria | 582 | Open in IMG/M |
| 3300010399|Ga0134127_13222294 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300010400|Ga0134122_11297360 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300011270|Ga0137391_10445913 | All Organisms → cellular organisms → Bacteria | 1101 | Open in IMG/M |
| 3300012199|Ga0137383_11250713 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300012200|Ga0137382_10783241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea | 686 | Open in IMG/M |
| 3300012211|Ga0137377_11790549 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300012582|Ga0137358_10313520 | All Organisms → cellular organisms → Bacteria | 1064 | Open in IMG/M |
| 3300012929|Ga0137404_11260180 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012930|Ga0137407_12317115 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012951|Ga0164300_10865892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300012958|Ga0164299_11659032 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300012960|Ga0164301_10918309 | All Organisms → cellular organisms → Bacteria | 681 | Open in IMG/M |
| 3300012961|Ga0164302_10150469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1370 | Open in IMG/M |
| 3300012961|Ga0164302_10158927 | All Organisms → cellular organisms → Bacteria | 1341 | Open in IMG/M |
| 3300012971|Ga0126369_10313243 | All Organisms → cellular organisms → Bacteria | 1576 | Open in IMG/M |
| 3300012971|Ga0126369_12384678 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300012972|Ga0134077_10596545 | Not Available | 500 | Open in IMG/M |
| 3300012985|Ga0164308_12136683 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300012988|Ga0164306_10249142 | Not Available | 1272 | Open in IMG/M |
| 3300012988|Ga0164306_11665645 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012989|Ga0164305_11993454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
| 3300013297|Ga0157378_11295061 | All Organisms → cellular organisms → Bacteria | 770 | Open in IMG/M |
| 3300013306|Ga0163162_11372593 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300013307|Ga0157372_13300491 | Not Available | 514 | Open in IMG/M |
| 3300013308|Ga0157375_11405180 | Not Available | 822 | Open in IMG/M |
| 3300014969|Ga0157376_13025609 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300015197|Ga0167638_1041852 | Not Available | 1020 | Open in IMG/M |
| 3300015200|Ga0173480_10952202 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300015373|Ga0132257_103921124 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300015374|Ga0132255_103233396 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300016371|Ga0182034_11843450 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300017792|Ga0163161_10087346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2303 | Open in IMG/M |
| 3300018027|Ga0184605_10034480 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
| 3300018054|Ga0184621_10369176 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300018061|Ga0184619_10054204 | All Organisms → cellular organisms → Bacteria | 1749 | Open in IMG/M |
| 3300018076|Ga0184609_10158389 | Not Available | 1045 | Open in IMG/M |
| 3300018482|Ga0066669_11105773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 715 | Open in IMG/M |
| 3300019867|Ga0193704_1058726 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300019881|Ga0193707_1081077 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300020170|Ga0179594_10227303 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300020581|Ga0210399_11166783 | Not Available | 613 | Open in IMG/M |
| 3300021078|Ga0210381_10061326 | Not Available | 1152 | Open in IMG/M |
| 3300021344|Ga0193719_10123531 | Not Available | 1124 | Open in IMG/M |
| 3300021560|Ga0126371_10587276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1263 | Open in IMG/M |
| 3300021560|Ga0126371_10881588 | All Organisms → cellular organisms → Bacteria | 1039 | Open in IMG/M |
| 3300022694|Ga0222623_10060082 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1466 | Open in IMG/M |
| 3300025899|Ga0207642_11154906 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 502 | Open in IMG/M |
| 3300025912|Ga0207707_11248924 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300025919|Ga0207657_11428798 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300025921|Ga0207652_11420137 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300025922|Ga0207646_10372956 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300025927|Ga0207687_10481657 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300025929|Ga0207664_11307924 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300025932|Ga0207690_11680745 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300025934|Ga0207686_10506266 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 938 | Open in IMG/M |
| 3300025934|Ga0207686_10827768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 743 | Open in IMG/M |
| 3300025939|Ga0207665_10038070 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 3201 | Open in IMG/M |
| 3300025972|Ga0207668_10068533 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2523 | Open in IMG/M |
| 3300026023|Ga0207677_11169264 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300026285|Ga0209438_1071539 | All Organisms → cellular organisms → Bacteria | 1130 | Open in IMG/M |
| 3300026514|Ga0257168_1026144 | All Organisms → cellular organisms → Bacteria | 1231 | Open in IMG/M |
| 3300028380|Ga0268265_10678478 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Gaiellales → Gaiellaceae → Gaiella → unclassified Gaiella → Gaiella sp. SCGC AG-212-M14 | 993 | Open in IMG/M |
| 3300028708|Ga0307295_10113428 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 737 | Open in IMG/M |
| 3300028710|Ga0307322_10009456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2138 | Open in IMG/M |
| 3300028713|Ga0307303_10036735 | Not Available | 1002 | Open in IMG/M |
| 3300028715|Ga0307313_10000017 | All Organisms → cellular organisms → Bacteria | 22317 | Open in IMG/M |
| 3300028718|Ga0307307_10014100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 2157 | Open in IMG/M |
| 3300028720|Ga0307317_10022485 | Not Available | 1936 | Open in IMG/M |
| 3300028721|Ga0307315_10004845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3271 | Open in IMG/M |
| 3300028744|Ga0307318_10135065 | Not Available | 843 | Open in IMG/M |
| 3300028768|Ga0307280_10114503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Paenarthrobacter → unclassified Paenarthrobacter → Paenarthrobacter sp. DKR-5 | 907 | Open in IMG/M |
| 3300028771|Ga0307320_10149979 | Not Available | 901 | Open in IMG/M |
| 3300028778|Ga0307288_10014812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2442 | Open in IMG/M |
| 3300028784|Ga0307282_10609373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 529 | Open in IMG/M |
| 3300028787|Ga0307323_10079108 | Not Available | 1172 | Open in IMG/M |
| 3300028807|Ga0307305_10003950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6212 | Open in IMG/M |
| 3300028810|Ga0307294_10136888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 806 | Open in IMG/M |
| 3300028811|Ga0307292_10367233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 609 | Open in IMG/M |
| 3300028824|Ga0307310_10047282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1786 | Open in IMG/M |
| 3300028878|Ga0307278_10217262 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300028881|Ga0307277_10005758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 4765 | Open in IMG/M |
| 3300028881|Ga0307277_10164806 | Not Available | 964 | Open in IMG/M |
| 3300028884|Ga0307308_10497777 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300030904|Ga0308198_1096218 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1009453 | All Organisms → cellular organisms → Bacteria | 1958 | Open in IMG/M |
| 3300031170|Ga0307498_10008333 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1984 | Open in IMG/M |
| 3300031231|Ga0170824_103576905 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300031231|Ga0170824_117674268 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300031421|Ga0308194_10113832 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300031474|Ga0170818_102473770 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031474|Ga0170818_115213980 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300031668|Ga0318542_10257192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 889 | Open in IMG/M |
| 3300031679|Ga0318561_10685934 | Not Available | 563 | Open in IMG/M |
| 3300031720|Ga0307469_12480517 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031740|Ga0307468_102386973 | Not Available | 516 | Open in IMG/M |
| 3300031764|Ga0318535_10065448 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1547 | Open in IMG/M |
| 3300031805|Ga0318497_10452509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 719 | Open in IMG/M |
| 3300031819|Ga0318568_10979309 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300031859|Ga0318527_10164401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 934 | Open in IMG/M |
| 3300031890|Ga0306925_11446152 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300031896|Ga0318551_10595434 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300031941|Ga0310912_11266291 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031947|Ga0310909_10085229 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2513 | Open in IMG/M |
| 3300032008|Ga0318562_10548765 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300032010|Ga0318569_10028524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 2308 | Open in IMG/M |
| 3300032041|Ga0318549_10146235 | All Organisms → cellular organisms → Bacteria | 1050 | Open in IMG/M |
| 3300032060|Ga0318505_10122799 | All Organisms → cellular organisms → Bacteria | 1191 | Open in IMG/M |
| 3300033480|Ga0316620_11573520 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300034176|Ga0364931_0337254 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 19.29% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.68% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 10.15% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.12% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.57% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.54% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.54% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.03% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.03% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.03% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.03% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.52% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.02% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.02% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.51% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.51% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 0.51% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2170459012 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO1O1 lysis Rhizosphere grass | Environmental | Open in IMG/M |
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300005105 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPC | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015197 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G6B, Proglacial plain, adjacent to northern proglacial tributary) | Environmental | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019867 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m1 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022531 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028708 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
| 3300028721 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355 | Environmental | Open in IMG/M |
| 3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
| 3300028778 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_142 | Environmental | Open in IMG/M |
| 3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300030904 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_202 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031859 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032060 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300033480 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D5_B | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| N56_06839710 | 2170459012 | Grass Soil | GTFELTILEATGIYKPFVGGNNHMLDHLHLPASGPPDEYCFCNISHP |
| JGI10213J12805_101476892 | 3300000858 | Soil | EGTGIYRSVVGGHNHMVDRLHFLAPGDGSGGIDEYCFCFVSGP* |
| Ga0062593_1026460002 | 3300004114 | Soil | ATGIYRPFVGGHNHMVDKLHFLAPGDGSGGFEEYCFCFISRP* |
| Ga0063356_1018573352 | 3300004463 | Arabidopsis Thaliana Rhizosphere | LDVIEGTGIYRSVVGGHNHMVDRLHFLAPGDGSGGIDEFCFCFVSGP* |
| Ga0066812_10069503 | 3300005105 | Soil | EGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISGP* |
| Ga0066677_100934611 | 3300005171 | Soil | EGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGFDEYCFCFISGK* |
| Ga0066680_108388032 | 3300005174 | Soil | GGQFLEGTFELTVLEATGIYRPFVGGHNHMVDKLHFLAPGDGSGGVEEYCFCFISDS* |
| Ga0066388_1004204704 | 3300005332 | Tropical Forest Soil | TGIYKPFAGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISHP* |
| Ga0066388_1007021731 | 3300005332 | Tropical Forest Soil | EGTFELTILEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGLDEYCFCFISRQ* |
| Ga0070692_110492001 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | FLVGTFELTVTQATGIYRPFVGGHNHMVDRLHFLAPGDGSGGFEEYCFCFVSR* |
| Ga0070709_101280531 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | EGTFELTILDATGVYKPFVGGHNTMVDKLHFLAPGDGSGGLDEYCFCFISGP* |
| Ga0070709_102971712 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ* |
| Ga0070709_103024543 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISR* |
| Ga0070709_116001531 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | TILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ* |
| Ga0070709_117603581 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | ELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0070711_1003112402 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | TEELTILEATGIYRSFVGGHNHMVDKLHFLASGDIDEYCFCNISRP* |
| Ga0070708_1006681353 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | GIYKPFVGGHNHMVDKLHFLAPGDGSGGLDEYCFCFISRQ* |
| Ga0070706_1013562311 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VLEATGSFRSFEGGHNHMVDRLHRLANGTFDEYCFCFISRA* |
| Ga0070707_1002734361 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EEGTGIYRSFVGGHNHMVDHLHLLADGSADEYCFCFINRA* |
| Ga0070698_1002601833 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GTFELTILEGTGIYKRFAGGHNHMVDKLHFLAPGDGSGGFDEYCFCFISRP* |
| Ga0070698_1002946553 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | EGTGIYRSFVGGHNHMVDHLHLLADGSADEYCFCFISRA* |
| Ga0070698_1009909002 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | FELTVLEATGSFRSFEGGHNHMVDRLHRLANGTFDEYCFCFISRA* |
| Ga0070679_1017077502 | 3300005530 | Corn Rhizosphere | VGTFELTVIDATGIYRPFVGGHNHMVDRLHFLAPGDGSGGFEEYCFCFVSR* |
| Ga0070697_1001160231 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | IEEGTGIYRSFVGGHNHMVDHLHLLADGSADEYCFCFISRA* |
| Ga0068853_1019157761 | 3300005539 | Corn Rhizosphere | FLDGTFELAILEGTGIYRSFVGGHNHMVDHLHQRADGTFDEYCFCFISPA* |
| Ga0066661_109175652 | 3300005554 | Soil | VGGHNHMVDRLHFLAPGDGSGGADEYCFCFISRP* |
| Ga0066707_105055883 | 3300005556 | Soil | AGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRP* |
| Ga0070664_1018524891 | 3300005564 | Corn Rhizosphere | ELTVLEGTGIYKPFAGGHNHMVDRLHFLAPGDGSGGVDEYCFCFISRP* |
| Ga0070664_1021492332 | 3300005564 | Corn Rhizosphere | ATGTYRPFVGGHNHMVDKLHFLPPGDGSGGFDEYCFCFVSRP* |
| Ga0068856_1004435431 | 3300005614 | Corn Rhizosphere | TEELTILEATGIYRSFVGGHNHMVDKLHFLPPGDGSGGIDEYCFCNISSP* |
| Ga0070702_1006114561 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | GTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ* |
| Ga0066903_1003775861 | 3300005764 | Tropical Forest Soil | GTGIYKPFAGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRP* |
| Ga0066903_1014464031 | 3300005764 | Tropical Forest Soil | EGTFELTILEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRP* |
| Ga0066903_1035331532 | 3300005764 | Tropical Forest Soil | PFAGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRP* |
| Ga0066903_1046078311 | 3300005764 | Tropical Forest Soil | GTFELTILEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGADEYCFCFISRP* |
| Ga0066903_1059830122 | 3300005764 | Tropical Forest Soil | GIYKPFAGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRP* |
| Ga0066903_1064743071 | 3300005764 | Tropical Forest Soil | FAGGHNHMVDKLHFLAPGDGSGGINEYCFCFISRR* |
| Ga0066903_1084401951 | 3300005764 | Tropical Forest Soil | EGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGADEYCFCFISRP* |
| Ga0066651_104695883 | 3300006031 | Soil | EATGTYRSFEGGHNHMEDRLHQLANGNFDEYCFCFISRR* |
| Ga0070716_1004162441 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | GIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ* |
| Ga0070712_1004778021 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | EELTILEATGIYRSFVGGHNHMVDKLHFLASGDIDEYCFCNISRP* |
| Ga0070712_1015969181 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | PFAGGHNHMVDHLHFLAPGDGSGGLDEYCFCFISRP* |
| Ga0097621_1009052241 | 3300006237 | Miscanthus Rhizosphere | GQGGSFLEGTFELEVIEGTGNYRSLVGGHNHMVDKLHLLASGDADEYCFCFISGP* |
| Ga0079221_114666632 | 3300006804 | Agricultural Soil | FELTILEGTGIYQSFVGGHNHMVDKLHQLANGSFDEYCFCFISRA* |
| Ga0075428_1016542043 | 3300006844 | Populus Rhizosphere | YKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ* |
| Ga0075434_1009839253 | 3300006871 | Populus Rhizosphere | LEGTFELTILEGTGIYKHFAGGHNHMIDKLHFLAPGDGSGGADEYCFCFISRP* |
| Ga0079217_108439911 | 3300006876 | Agricultural Soil | GRFLEGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRP* |
| Ga0079215_102204281 | 3300006894 | Agricultural Soil | YQSLVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRP* |
| Ga0075436_1004653702 | 3300006914 | Populus Rhizosphere | IYRSFVGGHNHMVDHLHLLADGSADEYCFCFISRA* |
| Ga0066709_1035983342 | 3300009137 | Grasslands Soil | EGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGFDEYCFCFISGK* |
| Ga0114129_133968371 | 3300009147 | Populus Rhizosphere | GTFELTIEEGTGIYRSFVGGHNHMVDHLHLLADGSADEYCFCFISRA* |
| Ga0111538_129914311 | 3300009156 | Populus Rhizosphere | GIYQSFVGGHNHMVDRLHFLAPGDGSGGLDEYCFCFISRP* |
| Ga0105241_114840561 | 3300009174 | Corn Rhizosphere | GRFLEGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0105242_104689122 | 3300009176 | Miscanthus Rhizosphere | TILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRR* |
| Ga0105242_111194611 | 3300009176 | Miscanthus Rhizosphere | GGQFLVGTFELTVIDATGIYRPFVGGHNHMVDRLHFLAPGDGSGGFEEYCFCFVSR* |
| Ga0105249_125287402 | 3300009553 | Switchgrass Rhizosphere | TFDLTVLEATGIYRSFVGGQNHMVDRLHFLPPGDGSGGFDEYCFCFISRP* |
| Ga0126374_109003371 | 3300009792 | Tropical Forest Soil | LEGTFDLTILEGTGIYKPFAGGHNRMFDRLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0126380_100736441 | 3300010043 | Tropical Forest Soil | KPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0126382_124979981 | 3300010047 | Tropical Forest Soil | IYKPFAGGHNHMVDKLHFLASGGVDEYCFCFISRQ* |
| Ga0127503_104882011 | 3300010154 | Soil | GRFLEGTFELTILEATGIYRPFVGGHNHMVDKLHFLAPGDGSGGFEEYCFCFISHP* |
| Ga0134063_104199382 | 3300010335 | Grasslands Soil | LEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ* |
| Ga0134063_104267802 | 3300010335 | Grasslands Soil | YKPFVGGHNHMVDKLHFLAPGDGSGGADEYCFCVISRQ* |
| Ga0126376_116509392 | 3300010359 | Tropical Forest Soil | IYKPFAGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0126372_100594191 | 3300010360 | Tropical Forest Soil | GTGIYKPFAGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISHP* |
| Ga0126372_102071253 | 3300010360 | Tropical Forest Soil | GQFLEGTFELTILEGTGIYKPFAGGHNHMVDKLHFLASGGVDEYCFCFISRR* |
| Ga0126378_104622864 | 3300010361 | Tropical Forest Soil | VGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0126379_109965843 | 3300010366 | Tropical Forest Soil | LEGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0134125_112637132 | 3300010371 | Terrestrial Soil | FLEGTFELTILEGTGIYKPFVGGHNHMVDRLHFLPPGDGSGGFDEYCFCFISRQ* |
| Ga0126381_1031160901 | 3300010376 | Tropical Forest Soil | LTILEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0126383_108372562 | 3300010398 | Tropical Forest Soil | EGTFELTILEGTGIYKPFAGGHNHMVDKLHFLASGGVDEYCFCFISRH* |
| Ga0126383_126723901 | 3300010398 | Tropical Forest Soil | TGIYKPFAGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0134127_132222941 | 3300010399 | Terrestrial Soil | LTILEATGIYQSFVGGHNHMVDRLHFLAPGDGSGGLDEYCFCFISRS* |
| Ga0134122_112973601 | 3300010400 | Terrestrial Soil | ELNVIQATGIYRPFVGGHNHMVDRLHFLAPGDGSGGFEEYCFCFVSR* |
| Ga0134122_124887481 | 3300010400 | Terrestrial Soil | TGIYRSFVGGHNHMVDKLHFLASGDIDEYCFCNISRP* |
| Ga0137391_104459133 | 3300011270 | Vadose Zone Soil | GNFLDGTFELTIEEGTGIYRSFIGGHNHMVNHLHLLADGSADEYCFCFISRA* |
| Ga0137388_113462963 | 3300012189 | Vadose Zone Soil | FRSFEGGHNHMVDRLHQLANGTFDEYCFCFITRR* |
| Ga0137383_112507131 | 3300012199 | Vadose Zone Soil | GYYLEGTFELAILEATRAYRAFQGGHNHMVDKLHFLAPGDGSGGFDEYCFCFVSRP* |
| Ga0137382_107832412 | 3300012200 | Vadose Zone Soil | GQYDEGFLPLTILEATGVYRAFAGGHNHMVDKLHFLAPGDGSGGADEYCFCFISRP* |
| Ga0137377_117905491 | 3300012211 | Vadose Zone Soil | LTILEATGIYRSFEGGHNHIVDRLHPRADGSFDEYRFCFISRH* |
| Ga0137358_103135202 | 3300012582 | Vadose Zone Soil | FELTILEGTGIYRSFTGGHNHMVDKLHFLAPGDGSGGLDEYCFCFISRS* |
| Ga0137404_112601801 | 3300012929 | Vadose Zone Soil | LTVLEATGIYRSFVGGHNHMVDKLHFLAPGDGSGGLDEYCFCFISRA* |
| Ga0137407_123171152 | 3300012930 | Vadose Zone Soil | GGQFLEGTFELTVLEGTGIYKPFAGGHNHMVDRLHFLAPGDGSGGFDEYCFCFITRP* |
| Ga0164300_108658921 | 3300012951 | Soil | QATGVYRSFVGGHNHMVDKLHFLAPGDGSGGFEEYCFCFVSR* |
| Ga0164299_116590321 | 3300012958 | Soil | GTWELTILEGTGIYKPFVGGHNHMVDRLHFLAPGDGSGGADEYCFCFISRR* |
| Ga0164301_109183091 | 3300012960 | Soil | GVYRSFVGGHNHMVDKLHFLPPGDGSGGLDEYCFCFISGP* |
| Ga0164302_101504691 | 3300012961 | Soil | TGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFINRQ* |
| Ga0164302_101589271 | 3300012961 | Soil | FLEGTFELTILEGTGIYKPFVGGHNHMFDKLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0126369_103132431 | 3300012971 | Tropical Forest Soil | GTGIYKPFAGGHNHMVDKLHFLAPGDGSGGVDKYCFCFISRP* |
| Ga0126369_108908951 | 3300012971 | Tropical Forest Soil | ATGIYRSFVGGHNHMVDKLHFLASGDIDEYCFCHISRP* |
| Ga0126369_123846781 | 3300012971 | Tropical Forest Soil | EGTGIYKPFAGGHNHMVDKLHFLAPGDGSNGVDEYCFCFISRP* |
| Ga0134077_105965451 | 3300012972 | Grasslands Soil | VGGQNHMVDKLHFLAPGDGSGGRDEYCFCFISRP* |
| Ga0164308_121366831 | 3300012985 | Soil | GTWELTILEGTGIYKPFAGGHNHMVDRLHFLAPGDGSGGLDEYCFCFISRQ* |
| Ga0164306_102491421 | 3300012988 | Soil | FLEGTFELDVLEGTGVYRPFVGGHNHMVDKLHFLPPGDGSGGVDEYCFCFISRQ* |
| Ga0164306_116656452 | 3300012988 | Soil | YKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFINRQ* |
| Ga0164305_119934541 | 3300012989 | Soil | GTFELTVLEGTGIYRRFVGGHNHMVDKLHFLAPGDGSGGFEEYCFCFVTAP* |
| Ga0157378_112950612 | 3300013297 | Miscanthus Rhizosphere | VYKPFVGGHNHMVDKLHFLAPGDGSGGLDEYCFCFISGP* |
| Ga0163162_113725931 | 3300013306 | Switchgrass Rhizosphere | EGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ* |
| Ga0163162_117927131 | 3300013306 | Switchgrass Rhizosphere | TILEATGIYHSFVGGHNHMVDKLHQLANGSFDEYCFCFISRA* |
| Ga0157372_133004911 | 3300013307 | Corn Rhizosphere | PFVAGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ* |
| Ga0157375_114051801 | 3300013308 | Miscanthus Rhizosphere | VGGHNHMVDRLHFLAPGDGSGGLDEYCFCFISRP* |
| Ga0157376_130256091 | 3300014969 | Miscanthus Rhizosphere | YKPFVGGHNHMVDKLHFLAPGDGSGGLDEYCFCFISRQ* |
| Ga0167638_10418522 | 3300015197 | Glacier Forefield Soil | ILEATGWYRDFAGGHNHMQDRLQFLAPGDGSGGAVEHCLCNISKP* |
| Ga0173480_109522021 | 3300015200 | Soil | WVQYDEGTLPLTILEATGIYSAFAGGHNHMVDKLHFLANGSLDEHCFCIISH* |
| Ga0132257_1039211241 | 3300015373 | Arabidopsis Rhizosphere | ELTILEATGIYRSFVGGHNHMVDKLHYLPPGDGSGGIDEYCFCFISSP* |
| Ga0132255_1032333961 | 3300015374 | Arabidopsis Rhizosphere | LDVLEGTGIYRSLAGGHNHMVDRLHFLANGAVDEYCFCFVSGP* |
| Ga0182034_118434502 | 3300016371 | Soil | GTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRP |
| Ga0163161_100873463 | 3300017792 | Switchgrass Rhizosphere | TILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISR |
| Ga0184605_100344801 | 3300018027 | Groundwater Sediment | KRFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISGQ |
| Ga0184621_103691762 | 3300018054 | Groundwater Sediment | YLEGTFELTILEANGIYRSFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISSP |
| Ga0184619_100542041 | 3300018061 | Groundwater Sediment | TILEGTGIYKPFVGGHNHMVDKLHFLASGGVDEYCFCFITRQ |
| Ga0184609_101583892 | 3300018076 | Groundwater Sediment | PFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0066669_111057731 | 3300018482 | Grasslands Soil | FELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFITGQ |
| Ga0193704_10587262 | 3300019867 | Soil | ELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0193707_10810772 | 3300019881 | Soil | TILEATGIYQPFEGGHNHMVDKLHFLAPGDGSGGIDEYCFCFVSRA |
| Ga0179594_102273031 | 3300020170 | Vadose Zone Soil | EATGIYRSFVGGHNHMVDKLHFLAPGDGSGGLDEYCFCFISRA |
| Ga0210399_111667832 | 3300020581 | Soil | YRSFVAGHNHMVDKLHFLPPGDGSGGIDEYCFCFISSP |
| Ga0210381_100613261 | 3300021078 | Groundwater Sediment | LEGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0210408_102899921 | 3300021178 | Soil | LEATGKFRPFEGGHNHMVDRLHRLANGTFDEYCFCFISRA |
| Ga0193719_101235312 | 3300021344 | Soil | RFLEGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0210402_108552442 | 3300021478 | Soil | ILEATGIYRSFQGGHNHMVDRLHRLANGSFDEYCFCFISRR |
| Ga0126371_105872762 | 3300021560 | Tropical Forest Soil | EGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGIDEYCFCFIRRP |
| Ga0126371_108815882 | 3300021560 | Tropical Forest Soil | FLEGTFELTILEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGLDEYCFCFIRRR |
| Ga0242660_11879541 | 3300022531 | Soil | VLEATGKFRPFEGGHNHMVDRLHRLANGTFDEYCFCFISRA |
| Ga0222623_100600823 | 3300022694 | Groundwater Sediment | FLEGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0207642_111549062 | 3300025899 | Miscanthus Rhizosphere | TGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRR |
| Ga0207684_110595132 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | ELTIEEGTGIYRSFIGGHNHMVDHLHLLADGSADEYCFCFISRA |
| Ga0207684_111842221 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EATGSFRSFEGGHNHMVDRLHRLANGTFDEYCFCFISRA |
| Ga0207707_112489241 | 3300025912 | Corn Rhizosphere | LTVIDATGIYRPFVGGHNHMVDRLHFLAPGDGSGGVEEYCFCFVSR |
| Ga0207657_114287981 | 3300025919 | Corn Rhizosphere | TILEATGIYQQFVGGHNHMVDRLHLLAPGDGSGGFDEDCFCFVSRP |
| Ga0207652_114201371 | 3300025921 | Corn Rhizosphere | TEELTILEATGIYRSFVGGHNHMVDKLHFLASGDIDEYCFCNISRP |
| Ga0207646_100312408 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | FLIGTFELTILEATGIYQSFVGGHNHMVDKLHQLANGSFDEYCFCFINRA |
| Ga0207646_103729561 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | IEEGTGIYRSFVGGHNHMVDHLHLLADGSADEYCFCFINRA |
| Ga0207687_104816572 | 3300025927 | Miscanthus Rhizosphere | ILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0207687_109727731 | 3300025927 | Miscanthus Rhizosphere | TGIYHSFVGGHNHMVDKLHQLANGSFDEYCFCFISRA |
| Ga0207664_113079241 | 3300025929 | Agricultural Soil | TFELPILEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGLDEYCFCFISRQ |
| Ga0207690_116807451 | 3300025932 | Corn Rhizosphere | MTILDATGVYKPFVGGHNTMVDKLHFLAPGDGSGGLDEYCFCFISGP |
| Ga0207686_105062663 | 3300025934 | Miscanthus Rhizosphere | DGTFELTILEGTGIYKPFAGGHNHMVDHLHFLAPGDGSGGLDEYCFCFISRP |
| Ga0207686_108277681 | 3300025934 | Miscanthus Rhizosphere | TILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRR |
| Ga0207665_100380701 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0207668_100685331 | 3300025972 | Switchgrass Rhizosphere | GTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISR |
| Ga0207677_111692641 | 3300026023 | Miscanthus Rhizosphere | ILEGTGIFKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFVSRQ |
| Ga0207683_114679312 | 3300026121 | Miscanthus Rhizosphere | FAGGHNHMVDKLHFLAPGDGSGGADEYCFCFISRH |
| Ga0209438_10715391 | 3300026285 | Grasslands Soil | GTFELTIEEGTGIYRSFVGGHNHMVDHLHLLADGSADEYCFCFISRA |
| Ga0257168_10261441 | 3300026514 | Soil | LGGNFLDGTFELTIEEGTGIYRSFVGGHNHMVDHLHLLADGSADEYCFCFISRA |
| Ga0268265_106784782 | 3300028380 | Switchgrass Rhizosphere | LKLRWEGTGIYKPFVGGHNHMVDKRHFLAPGDGSGGVDEYCFCFISR |
| Ga0307295_101134282 | 3300028708 | Soil | QFLEGTFELTIIQATGIYRPFVGGHNHMVDKLHFQASGDVVEYCFCFISRP |
| Ga0307322_100094561 | 3300028710 | Soil | LEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISGQ |
| Ga0307303_100367352 | 3300028713 | Soil | EPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0307313_1000001723 | 3300028715 | Soil | RFLEGTFELTILEGTGIYEPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0307307_100141003 | 3300028718 | Soil | EGTGIYKRFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISGQ |
| Ga0307317_100224854 | 3300028720 | Soil | EGTFELTILEGTGIYKPFVGGHNHMVDKLHFLASGGVDEYCFCFISRQ |
| Ga0307315_100048454 | 3300028721 | Soil | ELTILEGTGIYEPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0307318_101350652 | 3300028744 | Soil | GRFLEGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0307280_101145031 | 3300028768 | Soil | LEGTGIYKPFVGGHNHMVDKLHFLASGGVDEYCFCFISRQ |
| Ga0307320_101499791 | 3300028771 | Soil | TFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0307288_100148124 | 3300028778 | Soil | FELTILEGTGIYEPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0307282_106093732 | 3300028784 | Soil | LEGTFELTILEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0307323_100791081 | 3300028787 | Soil | RFLEGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0307281_102025891 | 3300028803 | Soil | LTILEATGIYQSFVGGHNHMVDKLHQLANGSFDEYCFCFISRP |
| Ga0307305_100039501 | 3300028807 | Soil | GTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0307294_101368881 | 3300028810 | Soil | FVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISGQ |
| Ga0307292_103672331 | 3300028811 | Soil | IIQATGIYRPFVGGHNHMVDKLHFQASGDVVEYCFCFISRP |
| Ga0307310_100472821 | 3300028824 | Soil | IYKPFVGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0307278_102172621 | 3300028878 | Soil | GGRFLEGTFELTVLEATGIYSPFVGGHNHMVDKLHFLAPGDGSGGVEEYCFCFVSQP |
| Ga0307277_100057581 | 3300028881 | Soil | FLEGTFELTILEATGIYKPFVGGHNHMVDKLHFLASGGVDEYCFCFITRQ |
| Ga0307277_101648062 | 3300028881 | Soil | LEGTGIYEPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0307308_104977772 | 3300028884 | Soil | GLGGNFLEGTFELTILEATGVYRSFVGGHNHMVDRLHLLGSGGADEYCFCFISRP |
| Ga0308198_10962181 | 3300030904 | Soil | IDGTYELNVLEATGRFRYLRGGHNHMVDKLHFLASGGVDEYCFCFISHP |
| (restricted) Ga0255311_10094531 | 3300031150 | Sandy Soil | ILEATGIFKSFEGGQNHMVDRLHFLAPGDGSGGLDEFCFCFISRP |
| Ga0307498_100083333 | 3300031170 | Soil | GIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISS |
| Ga0170824_1035769051 | 3300031231 | Forest Soil | LEGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0170824_1176742681 | 3300031231 | Forest Soil | LEGTFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGLDEYCFCFISRQ |
| Ga0308194_101138321 | 3300031421 | Soil | AILQATGIYRSFVGGHNHMVDKLHFLAPGDGSGGAVEYCFCFISRP |
| Ga0170818_1024737701 | 3300031474 | Forest Soil | LEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGLDEYCFCFISRQ |
| Ga0170818_1152139801 | 3300031474 | Forest Soil | FLEGTFELTILEGTGIYKAFAGGHNHMVDRLHFLAPGDGSGGADEHCFCFISRP |
| Ga0318542_102571922 | 3300031668 | Soil | FLEGTFELTILEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0318561_106859342 | 3300031679 | Soil | PFVGGHNHMVDKLRFLAPVEGSGGTDEYCFCFISHS |
| Ga0307469_122685561 | 3300031720 | Hardwood Forest Soil | IEEGTGIYRSFVGGHNHMVDHLHLLADGSADEYCFCFISRA |
| Ga0307469_124805171 | 3300031720 | Hardwood Forest Soil | LIGTYELTILEATGIYRSFEGGHNHMVDRLHLLTPGDGTGGADEYCFCFINRP |
| Ga0307468_1023869732 | 3300031740 | Hardwood Forest Soil | FLVGTFELNVIEATGIYRPFVGGHNHMVDRLHFLAPGDGSGGFEEYCFCFVSR |
| Ga0318535_100654481 | 3300031764 | Soil | TGIYKPFAGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0318497_104525092 | 3300031805 | Soil | ELTILEATGIYRSFVGGYNHMVDKLHFLPPGDGSGGLDEYCFCNISSP |
| Ga0318568_109793092 | 3300031819 | Soil | TILEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRP |
| Ga0307473_114339541 | 3300031820 | Hardwood Forest Soil | LTILEGTGIYQSFVGGHNHMVDKLHQLANGSFDEYCFCFISRA |
| Ga0318527_101644012 | 3300031859 | Soil | FLEGTFELTILEGTGIYKPFAGGHNHMVDKLHLLAPGDGSGGADEYCFCFISRP |
| Ga0306925_114461522 | 3300031890 | Soil | LEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRQ |
| Ga0318551_105954342 | 3300031896 | Soil | TFELTILEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRP |
| Ga0310912_112662911 | 3300031941 | Soil | EGTGIYKPFAGGHNHMVDKLHLLAPGDGSGGADEYCFCFISRP |
| Ga0310909_100852291 | 3300031947 | Soil | GTFLEGTFELTILEGTGIYKPFAGGHNHMVDKLHLLAPGDGSGGADEYCFCFISRP |
| Ga0318562_105487652 | 3300032008 | Soil | PFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRP |
| Ga0318569_100285242 | 3300032010 | Soil | EGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0318549_101462352 | 3300032041 | Soil | ELTILEGTGIYKPFAGGHNHMVDKLHFLAPGDGSGGIDEYCFCFISRQ |
| Ga0318558_100922713 | 3300032044 | Soil | PSFAGGHNHMVDKLHFLPPGDGSGGLDEYCFCNISSP |
| Ga0318505_101227991 | 3300032060 | Soil | LEGTGIYKPFVGGHNHMVDKLHFLAPGDGSGGVDEYCFCFISRP |
| Ga0318525_102884301 | 3300032089 | Soil | TEELTILEATGIYRCFVGGHNHMVDKLHFLPPGDGSGGIDEYCFCNISRP |
| Ga0316620_115735201 | 3300033480 | Soil | DGTFELTIEEGTGIYQSFVGGHNHMVDHLHLLADGSADEYCFCQISRA |
| Ga0364931_0337254_371_502 | 3300034176 | Sediment | LTILEATGIYRPFVGGHNHMVDRLHFLVSGDVDEYCFCFISRP |
| ⦗Top⦘ |