| Basic Information | |
|---|---|
| Family ID | F026658 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 42 residues |
| Representative Sequence | IYTPEGARLEANTILVEKGRLLIGSDPLGIYEFARPDKKNQ |
| Number of Associated Samples | 173 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 67.51 % |
| % of genes from short scaffolds (< 2000 bps) | 62.94 % |
| Associated GOLD sequencing projects | 164 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (50.761 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.736 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.904 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (63.452 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 26.09% Coil/Unstructured: 69.57% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF11638 | DnaA_N | 59.39 |
| PF03989 | DNA_gyraseA_C | 1.02 |
| PF00712 | DNA_pol3_beta | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG0188 | DNA gyrase/topoisomerase IV, subunit A | Replication, recombination and repair [L] | 1.02 |
| COG0592 | DNA polymerase III sliding clamp (beta) subunit, PCNA homolog | Replication, recombination and repair [L] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 50.76 % |
| All Organisms | root | All Organisms | 49.24 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000816|AF_2010_repII_A10DRAFT_1032141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300001137|JGI12637J13337_1012716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 721 | Open in IMG/M |
| 3300001137|JGI12637J13337_1024385 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300001167|JGI12673J13574_1006286 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 697 | Open in IMG/M |
| 3300001593|JGI12635J15846_10083839 | Not Available | 2325 | Open in IMG/M |
| 3300001661|JGI12053J15887_10595045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300001867|JGI12627J18819_10218391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 768 | Open in IMG/M |
| 3300001867|JGI12627J18819_10324122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300001867|JGI12627J18819_10346795 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100988818 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 726 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101363964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300002347|JGIcombinedJ26865_1008065 | Not Available | 1784 | Open in IMG/M |
| 3300002910|JGI25615J43890_1012912 | Not Available | 1358 | Open in IMG/M |
| 3300002916|JGI25389J43894_1045406 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 748 | Open in IMG/M |
| 3300004080|Ga0062385_11075153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300004152|Ga0062386_101154644 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 643 | Open in IMG/M |
| 3300005447|Ga0066689_10367100 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 899 | Open in IMG/M |
| 3300005554|Ga0066661_10871796 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300005558|Ga0066698_10115031 | Not Available | 1788 | Open in IMG/M |
| 3300005561|Ga0066699_10269143 | Not Available | 1207 | Open in IMG/M |
| 3300005586|Ga0066691_10840609 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300005587|Ga0066654_10316804 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 841 | Open in IMG/M |
| 3300005841|Ga0068863_100991972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 842 | Open in IMG/M |
| 3300005921|Ga0070766_10398786 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 901 | Open in IMG/M |
| 3300006031|Ga0066651_10259361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 922 | Open in IMG/M |
| 3300006059|Ga0075017_100570846 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 863 | Open in IMG/M |
| 3300006755|Ga0079222_10940294 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 732 | Open in IMG/M |
| 3300006797|Ga0066659_10975457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 708 | Open in IMG/M |
| 3300006893|Ga0073928_10863366 | Not Available | 622 | Open in IMG/M |
| 3300007255|Ga0099791_10225957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 885 | Open in IMG/M |
| 3300007265|Ga0099794_10758004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300009038|Ga0099829_10395008 | Not Available | 1142 | Open in IMG/M |
| 3300009090|Ga0099827_10472736 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300009090|Ga0099827_11058345 | Not Available | 704 | Open in IMG/M |
| 3300009137|Ga0066709_103862321 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300009548|Ga0116107_1145623 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 657 | Open in IMG/M |
| 3300009698|Ga0116216_10300711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 978 | Open in IMG/M |
| 3300009792|Ga0126374_10096714 | Not Available | 1663 | Open in IMG/M |
| 3300010322|Ga0134084_10026605 | Not Available | 1594 | Open in IMG/M |
| 3300010326|Ga0134065_10424985 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300010343|Ga0074044_10337466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 989 | Open in IMG/M |
| 3300010360|Ga0126372_12270270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300010360|Ga0126372_12572831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 560 | Open in IMG/M |
| 3300010362|Ga0126377_11781537 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 691 | Open in IMG/M |
| 3300011120|Ga0150983_16087629 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 989 | Open in IMG/M |
| 3300011269|Ga0137392_10819438 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 768 | Open in IMG/M |
| 3300011270|Ga0137391_11459945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300011271|Ga0137393_11274409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300012189|Ga0137388_10324911 | Not Available | 1414 | Open in IMG/M |
| 3300012189|Ga0137388_10817133 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 863 | Open in IMG/M |
| 3300012189|Ga0137388_11344624 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 654 | Open in IMG/M |
| 3300012199|Ga0137383_10973150 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300012200|Ga0137382_10445862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 916 | Open in IMG/M |
| 3300012202|Ga0137363_11266793 | Not Available | 625 | Open in IMG/M |
| 3300012205|Ga0137362_10055919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3232 | Open in IMG/M |
| 3300012206|Ga0137380_10331478 | Not Available | 1359 | Open in IMG/M |
| 3300012206|Ga0137380_11719162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300012208|Ga0137376_11584660 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300012210|Ga0137378_11719355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300012210|Ga0137378_11775573 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300012349|Ga0137387_10727841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 718 | Open in IMG/M |
| 3300012918|Ga0137396_11032923 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300012925|Ga0137419_11192799 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 637 | Open in IMG/M |
| 3300012927|Ga0137416_12242617 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300012930|Ga0137407_12232892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300012931|Ga0153915_11930503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300012972|Ga0134077_10161440 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 898 | Open in IMG/M |
| 3300017928|Ga0187806_1234077 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 632 | Open in IMG/M |
| 3300017934|Ga0187803_10161517 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 882 | Open in IMG/M |
| 3300017938|Ga0187854_10076000 | Not Available | 1614 | Open in IMG/M |
| 3300017943|Ga0187819_10121535 | Not Available | 1559 | Open in IMG/M |
| 3300017943|Ga0187819_10281237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300017947|Ga0187785_10077074 | Not Available | 1297 | Open in IMG/M |
| 3300017975|Ga0187782_11039427 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300018006|Ga0187804_10539380 | Not Available | 527 | Open in IMG/M |
| 3300018037|Ga0187883_10356847 | Not Available | 748 | Open in IMG/M |
| 3300019789|Ga0137408_1265320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2622 | Open in IMG/M |
| 3300020580|Ga0210403_11068358 | Not Available | 628 | Open in IMG/M |
| 3300020581|Ga0210399_11227357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300020583|Ga0210401_10008175 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10402 | Open in IMG/M |
| 3300021171|Ga0210405_10504364 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 948 | Open in IMG/M |
| 3300021401|Ga0210393_10840741 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 746 | Open in IMG/M |
| 3300021403|Ga0210397_10251117 | Not Available | 1284 | Open in IMG/M |
| 3300021403|Ga0210397_11027703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 640 | Open in IMG/M |
| 3300021404|Ga0210389_10652696 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 826 | Open in IMG/M |
| 3300021407|Ga0210383_11125012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 662 | Open in IMG/M |
| 3300021420|Ga0210394_10437834 | Not Available | 1151 | Open in IMG/M |
| 3300021478|Ga0210402_11038876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 746 | Open in IMG/M |
| 3300024251|Ga0247679_1081659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300024290|Ga0247667_1006230 | Not Available | 2515 | Open in IMG/M |
| 3300024323|Ga0247666_1048892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 858 | Open in IMG/M |
| 3300025469|Ga0208687_1105888 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 579 | Open in IMG/M |
| 3300026088|Ga0207641_10960123 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 850 | Open in IMG/M |
| 3300026297|Ga0209237_1058778 | Not Available | 1879 | Open in IMG/M |
| 3300026304|Ga0209240_1115719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 927 | Open in IMG/M |
| 3300026306|Ga0209468_1000047 | All Organisms → cellular organisms → Bacteria | 64857 | Open in IMG/M |
| 3300026315|Ga0209686_1207414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300026317|Ga0209154_1247412 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300026361|Ga0257176_1029760 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 819 | Open in IMG/M |
| 3300026371|Ga0257179_1022988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 732 | Open in IMG/M |
| 3300026371|Ga0257179_1039853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300026475|Ga0257147_1008385 | Not Available | 1334 | Open in IMG/M |
| 3300026532|Ga0209160_1024196 | Not Available | 3980 | Open in IMG/M |
| 3300026536|Ga0209058_1215819 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 750 | Open in IMG/M |
| 3300026551|Ga0209648_10686251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300026557|Ga0179587_10160423 | Not Available | 1406 | Open in IMG/M |
| 3300027562|Ga0209735_1036067 | Not Available | 1044 | Open in IMG/M |
| 3300027591|Ga0209733_1057259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1025 | Open in IMG/M |
| 3300027603|Ga0209331_1154869 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 542 | Open in IMG/M |
| 3300027662|Ga0208565_1109070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 828 | Open in IMG/M |
| 3300027663|Ga0208990_1124661 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 697 | Open in IMG/M |
| 3300027678|Ga0209011_1125570 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 733 | Open in IMG/M |
| 3300027701|Ga0209447_10151065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 638 | Open in IMG/M |
| 3300027853|Ga0209274_10523284 | Not Available | 614 | Open in IMG/M |
| 3300027857|Ga0209166_10114453 | Not Available | 1495 | Open in IMG/M |
| 3300027857|Ga0209166_10550409 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300027898|Ga0209067_10042646 | Not Available | 2310 | Open in IMG/M |
| 3300027911|Ga0209698_11234998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300027915|Ga0209069_10269013 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 893 | Open in IMG/M |
| 3300028536|Ga0137415_11343678 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300028775|Ga0302231_10157826 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 947 | Open in IMG/M |
| 3300030707|Ga0310038_10095919 | Not Available | 1559 | Open in IMG/M |
| 3300031249|Ga0265339_10233797 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 895 | Open in IMG/M |
| 3300031545|Ga0318541_10247451 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis | 990 | Open in IMG/M |
| 3300031715|Ga0307476_10147377 | Not Available | 1688 | Open in IMG/M |
| 3300031718|Ga0307474_10145620 | Not Available | 1786 | Open in IMG/M |
| 3300031753|Ga0307477_10091338 | Not Available | 2114 | Open in IMG/M |
| 3300031945|Ga0310913_10769915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300031962|Ga0307479_11902588 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300032001|Ga0306922_11925380 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300032770|Ga0335085_11765965 | Not Available | 635 | Open in IMG/M |
| 3300032892|Ga0335081_12608947 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300033561|Ga0371490_1150428 | Not Available | 576 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.74% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.72% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 9.14% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.60% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.08% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.57% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.55% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.55% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.05% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.05% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.54% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.02% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.02% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Sediment | 0.51% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.51% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.51% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.51% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.51% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.51% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.51% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000731 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 34 | Environmental | Open in IMG/M |
| 3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
| 3300000909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 | Environmental | Open in IMG/M |
| 3300000935 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 40 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001167 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002347 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (NGEE Surface samples 415 (1, 2, 3 deep-072012) AP id is 1030520, ASSEMBLY_DATE=20131219) | Environmental | Open in IMG/M |
| 3300002910 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm | Environmental | Open in IMG/M |
| 3300002916 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm | Environmental | Open in IMG/M |
| 3300003152 | Freshwater sediment microbial communities from Loktak Lake, India | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009548 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300024290 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK08 | Environmental | Open in IMG/M |
| 3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
| 3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026306 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026361 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-B | Environmental | Open in IMG/M |
| 3300026371 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-01-B | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026824 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 27 (SPAdes) | Environmental | Open in IMG/M |
| 3300026862 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 31 (SPAdes) | Environmental | Open in IMG/M |
| 3300026869 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 53 (SPAdes) | Environmental | Open in IMG/M |
| 3300026890 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 51 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027035 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027042 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 68 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027603 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027635 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027662 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027663 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027701 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028775 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_2 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300033561 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB28FN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPgaii200_03175152 | 2228664022 | Soil | YQIFTPNGSRLDGTTLLVEKEVLLIGSDPLGVYEFERPDKKH |
| JGI12381J11899_10116381 | 3300000731 | Tropical Forest Soil | GIRRSEYQIYTPNGTRLEANVILVEEERLLIGADPLGVYEFPRPDRRH* |
| AF_2010_repII_A10DRAFT_10321411 | 3300000816 | Forest Soil | LEANTILIQKDQLIIGSDPLGLYLFARPDKKNAK* |
| JGI12488J12863_1104181 | 3300000909 | Tropical Forest Soil | GARLEANTILVEEERLLIGADPLGVYEFRRPDRVH* |
| JGI12407J12866_1062081 | 3300000935 | Tropical Forest Soil | QIYTPKGARLEANTILVEEERLLIGADPLGVYEFRRPDRVH* |
| JGI12637J13337_10127161 | 3300001137 | Forest Soil | LEAATILVEQDRLIIGSDPLGIYEFDRPDKKSQQ* |
| JGI12637J13337_10243852 | 3300001137 | Forest Soil | TPEGARLEASIIVVQKDVLLIGSDPLGLYVFERPDKKSAQ* |
| JGI12673J13574_10062861 | 3300001167 | Forest Soil | RATYKIYTPQGARLEANTILVEKDRLIIGNDPLGIYEFARPDKKSPQ* |
| JGI12635J15846_100838392 | 3300001593 | Forest Soil | LDATTILVEQDRLIIGSDPLGIYEFERPDKKSQQ* |
| JGI12053J15887_105950451 | 3300001661 | Forest Soil | YKIYTPQGARLEANTILVENDHLIIGDDPLGIFEFERPDKKIVK* |
| JGI12627J18819_102183912 | 3300001867 | Forest Soil | EANTILIEPDRMIIGGDPIGIYEFARPDKKIPATK* |
| JGI12627J18819_103241221 | 3300001867 | Forest Soil | TPEGARLEANTILVEAERLIIGNDPLGIYEFDRPDKKFPK* |
| JGI12627J18819_103467951 | 3300001867 | Forest Soil | ARLEPNMILVQRDHLMIGSDPLGIYVFDRPDKKTPQ* |
| JGIcombinedJ26739_1009888181 | 3300002245 | Forest Soil | LEVRTILVQKNRILIGSDSLGIFEFERPDTKLSSTQ* |
| JGIcombinedJ26739_1013639641 | 3300002245 | Forest Soil | TPSGARLEANTILIDKDHLLIGSDPLGIYEFDRPDKKTAP* |
| JGIcombinedJ26865_10080652 | 3300002347 | Arctic Peat Soil | DDARLEGTVMLVEQDRLLIGSDPLGIYEFLRPDRKH* |
| JGI25615J43890_10129122 | 3300002910 | Grasslands Soil | PEGARLEANLILVDKDRLMIGSDPLGIYVFERPDKKTPQ* |
| JGI25389J43894_10454061 | 3300002916 | Grasslands Soil | YKIYTPQGARLEGNTILVEQDRLIVGSDPLGIYEFKRPDKKILK* |
| Ga0052254_10045501 | 3300003152 | Sediment | EYQVYAPKGARIIANVILVEEDRLLIGSDPLGVYEFQRPDRKH* |
| Ga0062385_110751532 | 3300004080 | Bog Forest Soil | RRASYQLYTPEGARLEANTVLIEPGRMIIGGDPIGVYEFERPGKK* |
| Ga0062386_1011546441 | 3300004152 | Bog Forest Soil | YQLFTPEGARLEAVTILVEKDHLVIGNDPLGVYEFDRPDKKTAK* |
| Ga0062595_1013872462 | 3300004479 | Soil | RRSEYQIFTPNGSRLDGSTLLVEEEVLLIGSDPLGVYEFERPDKKH* |
| Ga0066815_100359462 | 3300005164 | Soil | EGNRRSEYQIFTPNGSRLDGTTLLVEEEVLLIGSDPLGVYEFERPDKKH* |
| Ga0066689_103671002 | 3300005447 | Soil | TPQGARLEANTILVEKDRLIIGNDPLGIYEFARPDKKNAQ* |
| Ga0066661_108717962 | 3300005554 | Soil | TYKIYTPQGARLEGNTILVEQDRLIVGSDPLGIYEFERPDKKILK* |
| Ga0066698_101150311 | 3300005558 | Soil | IYTPEGARLEANTILVERDHLIIGSDPLGVYEFDRPDKKISH* |
| Ga0066699_102691431 | 3300005561 | Soil | STYKIYTPQGARLEANTILIQKDQLIIGSDPLGLYLFDRPDKKNTK* |
| Ga0066691_108406091 | 3300005586 | Soil | PQGARLEANTILVERDRLIIGSDPLGIYEFERPDKKNTK* |
| Ga0066654_103168042 | 3300005587 | Soil | TYKIYTPQGARLEANTILVEQDRLIIGSDPLGMYEFERHDKKILK* |
| Ga0068863_1009919722 | 3300005841 | Switchgrass Rhizosphere | ARLVAKTILIESQRLVVGSDPLGIYEFDRPDKISH* |
| Ga0070766_103987862 | 3300005921 | Soil | RLEATTILVEQDRLIIGSDPLGIYEFERPDKKSQQ* |
| Ga0066651_102593611 | 3300006031 | Soil | LEAKTILVQKDQLIIGSDPLGLYLFSRPDKKNTK* |
| Ga0075017_1005708461 | 3300006059 | Watersheds | LLHFDKEGNRRSEYQIYTKDGARIEANVLLVEEDRLLIGADPIGVYEFARPDRKP* |
| Ga0075017_1010777392 | 3300006059 | Watersheds | IYTKDGVRLEANVILVEENRLLIGSDPLGVYEFLRPDRNH* |
| Ga0075014_1004074431 | 3300006174 | Watersheds | QIYTPKGTRLEATVILVEEERLLIGADPLGVYEFPRPDRKH* |
| Ga0079222_109402943 | 3300006755 | Agricultural Soil | ATYKIYTPQGARLEANTILVEQDRLVVGSDPLGIYEFERPDKKILK* |
| Ga0066659_109754572 | 3300006797 | Soil | RRATYKIYTPQGARLEAKTILVEKDQLIIGSDPLGLYLFDRPDKRSTK* |
| Ga0079220_104616991 | 3300006806 | Agricultural Soil | EYQIYTKDGARIEANALLVEEDRLLIGADPIGVYEFARPDRKP* |
| Ga0073928_108633661 | 3300006893 | Iron-Sulfur Acid Spring | PGGARLEASVILVEKDRLIVGNDPLGIYVFERPEKKILQ* |
| Ga0075435_1014812592 | 3300007076 | Populus Rhizosphere | QIFTPDGSRLDGTTLLVEEKVLLIGSDPLGVYEFERPDKKH* |
| Ga0099791_102259571 | 3300007255 | Vadose Zone Soil | RLEANTILVEKDRLIIGSDPLGIYEFARPDKNNQK* |
| Ga0099794_107580041 | 3300007265 | Vadose Zone Soil | IYTPQGARLEANTILVEPDRLLIGEDPLGIYEFSRPEKKPNKK* |
| Ga0099829_103950081 | 3300009038 | Vadose Zone Soil | ATYKVYTPQGARLEANTILVEQDRLIIGSDPLGIYEFQRPDKKI* |
| Ga0099827_104727361 | 3300009090 | Vadose Zone Soil | TPQGARLEANTILVEKDRLIIGNDPLGIYEFARPDKKNRQ* |
| Ga0099827_110583451 | 3300009090 | Vadose Zone Soil | IYTPEGARLEAAVILVEPNRLRIGADPVGIYEFLRPDKSPQ* |
| Ga0066709_1038623211 | 3300009137 | Grasslands Soil | KIYTPEGARLEANTILVERDHLIIGSDPLGVYEFDRPDKKISH* |
| Ga0116107_11456231 | 3300009548 | Peatland | IFTPTGGRLEATTILVEPGRLLVGGDPLGVYEFARPDKKTQQ* |
| Ga0116138_11061151 | 3300009552 | Peatland | EYRIFTPTGGRLEATTILVEPGRLLVGGDPLGVYEFARPDKKTQQ* |
| Ga0116216_103007111 | 3300009698 | Peatlands Soil | DKEGNRRSEYQIYTPEGARLEANSILVEENRLLIGADPQGVFDFERPDKKH* |
| Ga0126374_100967141 | 3300009792 | Tropical Forest Soil | RATYKIYTPEGARLEANTILVLNDRLIIGSDPLGLYLFDRPDKKSGK* |
| Ga0134084_100266051 | 3300010322 | Grasslands Soil | KIYTPQGARLEANTILVEKDQLIIGSDPLGLYLFDRPDKRNTK* |
| Ga0134065_104249851 | 3300010326 | Grasslands Soil | RLEANTILVEQDRLIIGSDPLGIYEFERPDKKILK* |
| Ga0074044_103374662 | 3300010343 | Bog Forest Soil | ARLEANTILVESDRLIIGSDPLGVFEFERPDKKNLK* |
| Ga0126370_108065642 | 3300010358 | Tropical Forest Soil | EGNRRSEYQIYTKDGARLEANVLLVEENRLLIGSDPLGVWEFGRPDRKP* |
| Ga0126372_122702701 | 3300010360 | Tropical Forest Soil | RRATYKVYTPEGARLEANTILVLNDHLIIGSDPLGLYLFDRPDKKSGK* |
| Ga0126372_125728311 | 3300010360 | Tropical Forest Soil | YTPGGARLEANTILIEKGQLIIGSDPLGLYLFDRPAKKAAK* |
| Ga0126378_111630551 | 3300010361 | Tropical Forest Soil | IYTKEGARIEANVILIEEDRLLIGADPIGVYEFARPDKNR* |
| Ga0126377_117815372 | 3300010362 | Tropical Forest Soil | ATYKIYTPEGARLEANTILVLNDRLIIGSDPLGLYLFDRPDKKSGK* |
| Ga0126381_1024589681 | 3300010376 | Tropical Forest Soil | IYTPKGSRLEANTILVEEERLLIGADPLGVYEFPRPDRKH* |
| Ga0150983_160876292 | 3300011120 | Forest Soil | PEEARLEATTILVEPDRLIIGSDPLGIYEFERPDKKSEQ* |
| Ga0137392_108194382 | 3300011269 | Vadose Zone Soil | ASYQLYTAEGTRLDANTILVEKDRLLIGSDPLGVYEFERPDKKLSQ* |
| Ga0137391_114599451 | 3300011270 | Vadose Zone Soil | RLEANTILVEEDRLIIGSDPLGIYEFERPDKKNTK* |
| Ga0137393_106717551 | 3300011271 | Vadose Zone Soil | QIYTKDGARIEANVLLVEEDRLLIGADPLGVYEFARPDRKP* |
| Ga0137393_112744091 | 3300011271 | Vadose Zone Soil | IYTPEGARLEANTILVEKGRLLIGSDPLGIYEFARPDKKNQ* |
| Ga0137388_103249111 | 3300012189 | Vadose Zone Soil | TPEGARLEPNMILVEKERLLIGSDPLGIYVFERPDKKTP* |
| Ga0137388_108171331 | 3300012189 | Vadose Zone Soil | PPQGARLEANTLLVEKDQLIIGSDPLGLYLFDRPDKKNTK* |
| Ga0137388_113446242 | 3300012189 | Vadose Zone Soil | PEGSRLEANTTLVDGDPLIIGSDPLGIYEFERPDKKFSH* |
| Ga0137383_109731502 | 3300012199 | Vadose Zone Soil | RAPYNIYTPQGARLEANTILVEKDHLIIGSDPLGLYLFARPDKKNTK* |
| Ga0137382_104458622 | 3300012200 | Vadose Zone Soil | YKIYTPHGARLEANTILVEKDRLIIGNDPLGIYEFARPDKKNAQ* |
| Ga0137363_112667932 | 3300012202 | Vadose Zone Soil | DGARIEASVLLVEEDRLLIGADPLGVYEFARPDRKP* |
| Ga0137362_100559193 | 3300012205 | Vadose Zone Soil | PQGARLEANTILVEKDRLIIGNDPLGIYEFARPDKKSPQ* |
| Ga0137362_103185572 | 3300012205 | Vadose Zone Soil | GNRRSEYQIYTKDGARIEASVLLVEEDRLLIGADPLGVYEFARPDRKP* |
| Ga0137380_103314782 | 3300012206 | Vadose Zone Soil | LATYKIYTPQGARLEANTILVQKDQLLIGSDPLGLYLFDRPNKKNTK* |
| Ga0137380_117191621 | 3300012206 | Vadose Zone Soil | PQGARLEANIILVEKDQLIIGSDPLGLYLFDRPDKKNTK* |
| Ga0137376_115846601 | 3300012208 | Vadose Zone Soil | KIYTPEGARLEATAILVEPDHMMIGSDPLGIYEFDRPDKKNQK* |
| Ga0137378_117193551 | 3300012210 | Vadose Zone Soil | ATYKIYTPNGARLEANTILVEKDRLIIGSDPLGIYEFERPD* |
| Ga0137378_117755731 | 3300012210 | Vadose Zone Soil | ATYKIYTPNGARLEANTILVEKDRLIIGSDPLGIYEFERPDKKNPQ* |
| Ga0137387_107278412 | 3300012349 | Vadose Zone Soil | KIYTPQGARLEANTILVQKDQLLIGSDPLGLYLFDRPNKKNTK* |
| Ga0137396_110329231 | 3300012918 | Vadose Zone Soil | ATYKIYTPQGARLEASTLLVEKDRLIIGSDPLGIYEFDRPDKKNQK* |
| Ga0137419_111927991 | 3300012925 | Vadose Zone Soil | PEGARLEANTILVEQDRLLIGEDPLGIYEFSRPDKKIQ* |
| Ga0137416_122426171 | 3300012927 | Vadose Zone Soil | YTPQGARLEANTILVEPDRLLIGEDPLGIYEFSRPEKKPNKK* |
| Ga0137407_122328921 | 3300012930 | Vadose Zone Soil | KIYTPQGARLEANTILVEPDRLLIGEDPLGIYEFSRPDKRKQ* |
| Ga0153915_119305032 | 3300012931 | Freshwater Wetlands | RSAYRLYTPEGARLEATSILVEAQRLLIGSDPLGVYEFARPDKPR* |
| Ga0137410_106535202 | 3300012944 | Vadose Zone Soil | DKEGNRRSEYQIYTKDGARIEATVLLVEQDRLLIGADPLGVYEFARPDRKR* |
| Ga0134077_101614401 | 3300012972 | Grasslands Soil | SYKIYTPEGARLEANTILVERDHLIIGSDPLGVYEFDRPDKKISH* |
| Ga0181523_105195211 | 3300014165 | Bog | GASLDASVILVEEERLLIGADPLGVYEFPRPDRKH* |
| Ga0182032_108501271 | 3300016357 | Soil | HFDKEANRRSEYQIYTPKGARLEANTILVEEERLLIGADPLGVYEFPRPDRKH |
| Ga0182040_108018712 | 3300016387 | Soil | RSEYQIYTPKGARLEANTILVEEERLLIGADPLGVYEFPRPDRKH |
| Ga0182038_114602511 | 3300016445 | Soil | RSEYQIYTPNGTRLEASVILVEEERLLIGTDPLGVYEFPRPDRRH |
| Ga0187806_12340771 | 3300017928 | Freshwater Sediment | YKIYTPKGARLEANTILIESDRLIIGNDPLGIYELARPEKISPK |
| Ga0187803_101615171 | 3300017934 | Freshwater Sediment | IYTPDGARLEANTILVEQDRLLIGVDPHGIFDFERPDRKH |
| Ga0187821_103338281 | 3300017936 | Freshwater Sediment | SEYQIYTPKGARIEASIIVVEEERLLIGADPVGIYDFPRQDKRH |
| Ga0187854_100760001 | 3300017938 | Peatland | EYRIFTPTGGRLEATTILVEPGRLLVGGDPLGVYEFARPDKKTQQ |
| Ga0187819_101215351 | 3300017943 | Freshwater Sediment | TPQGARLEANTILIEPDRLIIGNDPIGIYEFDRPEKKSAK |
| Ga0187819_102812371 | 3300017943 | Freshwater Sediment | GTRLEATTILVEPTRLLLGQDPLGVYEFARPDKSDESGH |
| Ga0187786_101130221 | 3300017944 | Tropical Peatland | SEYQIYTKEGARIEANVLLVEENRLLIGCDPLGVYEFSRPDKNP |
| Ga0187785_100770741 | 3300017947 | Tropical Peatland | IYTPEGARLEAKTILVERDRLIIGSDPLGIYDFDRPDKITH |
| Ga0187782_110394271 | 3300017975 | Tropical Peatland | TPQEARLEANTILVEKDRLIIGSDPLGIYEFERPDKKAAIR |
| Ga0187816_105364871 | 3300017995 | Freshwater Sediment | KEGNRRSEYQIYTPDGARLEANTILVEEKRLLIGADPQGVFDFERPDRKQ |
| Ga0187804_105393801 | 3300018006 | Freshwater Sediment | RLDSYRTYTQDGARLEASTILVEPNRLVLGQDPLGVYEFDRPEKPDKSEH |
| Ga0187883_103568471 | 3300018037 | Peatland | NGGRLEVTTILVESDRLLLGADPFGLYEFTRPDKVAH |
| Ga0187766_107988091 | 3300018058 | Tropical Peatland | DGARLEANVLLVEENRLLIGSDPLGVWEFARPDRKP |
| Ga0187784_106963202 | 3300018062 | Tropical Peatland | YTRDVARIEANVILVEEYRLLIGSDPLGVYEFARPDRNP |
| Ga0187772_100569721 | 3300018085 | Tropical Peatland | GARLEASVILVQEERLLIGADPLGIYDFQRPDRKH |
| Ga0187769_107339482 | 3300018086 | Tropical Peatland | YQIYAPKGARLEASVILVQEERLLIGADPLGIYDFQRPDRKH |
| Ga0187771_101089221 | 3300018088 | Tropical Peatland | EYQIYTTEGARLEANTILVEENRLLIGADPQGVFDFERPDRKH |
| Ga0187771_103311582 | 3300018088 | Tropical Peatland | SEYQIYTHEGARLEANTILVEENRLLIGADPQGVFDFERPDRKH |
| Ga0137408_12653203 | 3300019789 | Vadose Zone Soil | IYTPQGARIEANTILVEQDRLIIGSDPLGIYDFERPDKKNTK |
| Ga0210403_110683582 | 3300020580 | Soil | PDGSRLDGTTLLVEEEVLLIGSDPLGVYEFQRPDKKH |
| Ga0210399_112273571 | 3300020581 | Soil | QLYTPAGARLEANTILVEKDHLILGSDPLGLYEFDRPEKKTP |
| Ga0210401_100081751 | 3300020583 | Soil | SYQLYTPEGARLEANTVLIEPGRLIIGGDPIGIYEFERPEKKIKP |
| Ga0210405_105043641 | 3300021171 | Soil | YQLYTPAGARLEANTILVEKDHLILGSDPLGLYEFDRPEKKTP |
| Ga0210393_108407412 | 3300021401 | Soil | EEARLEATTILIEQDRLIIGSDPLGIYEFERPDKKP |
| Ga0210397_102511172 | 3300021403 | Soil | ASYQLYTPEGARLEANSILIEPGRLIIGGDPIGVYEFDRAEKRNQP |
| Ga0210397_107358781 | 3300021403 | Soil | SEYQIYTKDGARIEANVLLVEEKRLLIGADPIGVYEFARPDRAP |
| Ga0210397_110277031 | 3300021403 | Soil | YTPEGARLEANTILIEQDRLIIGSDPLGIYEFERPDKKSQQ |
| Ga0210389_106526962 | 3300021404 | Soil | EGARLEASIVLVQKDVLLIGSDPLGIYVFERPDKKSAQ |
| Ga0210383_111250121 | 3300021407 | Soil | TYKIYTPEQARLEATTILVEAGRLIIGSDPLGIYEFERTDKK |
| Ga0210394_104378342 | 3300021420 | Soil | GARLEPNIILVEKDRLLIGSDPLGIYVFERPDKKIPQ |
| Ga0210391_102998831 | 3300021433 | Soil | RRSEYQIYTKDGARIEASVLLVEEKRLFIGADPIGVYEFARPDRTP |
| Ga0210390_108320221 | 3300021474 | Soil | SEYQIYTKEGVRLEANVILVEENRLLIGSDPVGVYEFLRPDRNH |
| Ga0210402_100661264 | 3300021478 | Soil | IYTKDGARIEANVLLVEEDRLLIGADPIGVYEFARPDRKP |
| Ga0210402_104973162 | 3300021478 | Soil | KEGNRRSEYQIFTPDGSRLDGTTLLVEEEVLLIGSDPLGVYEFQRPDKKH |
| Ga0210402_110388761 | 3300021478 | Soil | SYQLYTAEGARLEVNTIVVEKDHLIMGNDPLGIYEFERPDRKGQK |
| Ga0210402_114706972 | 3300021478 | Soil | RRSEYQIFTPDGSRLDGTTLLVEEEVLLIGSDPLGVYEFQRPDKKH |
| Ga0242657_11941091 | 3300022722 | Soil | TKDGARVEANVLLVEEDRLLIGADPLGVYEFARPDPKP |
| Ga0247679_10816591 | 3300024251 | Soil | YTPAGARLEATTILVDNDHLILGSDPLGIYEFDRPGKKSEQ |
| Ga0247667_10062301 | 3300024290 | Soil | RLEATTILVDNDHLILGSDPLGIYEFDRPGKKSEQ |
| Ga0247666_10488922 | 3300024323 | Soil | ARLEPNIVLVEKDRLLIGNDPLGIYVFERPKKTLE |
| Ga0208687_11058882 | 3300025469 | Peatland | PTGGRLEATTILVEPGRLLVGGDPLGVYEFARPDKKTQQ |
| Ga0207641_109601231 | 3300026088 | Switchgrass Rhizosphere | PEGARLVAKTILIESQRLVVGSDPLGIYEFDRPDKISH |
| Ga0209237_10587781 | 3300026297 | Grasslands Soil | DSPQGARLEANVILVEKDRLIIGSDPLGLYEFDRPDKKISK |
| Ga0209240_11157191 | 3300026304 | Grasslands Soil | YTPQGARLEANTILVEQEHLIIGSDPLGIYEFERPDKKNTK |
| Ga0209468_10000471 | 3300026306 | Soil | YKIYTSQGARLEANTILVEQDRLIIGSDPLGIYEFERPDKKILK |
| Ga0209686_12074141 | 3300026315 | Soil | TYKIYTPQGARLEANTILIQKDQLIIGSDPLGLYLFDRPDKKNTK |
| Ga0209154_12474121 | 3300026317 | Soil | RLEANTILVEQDLLIIGSDPLGIYEFERPDKKILK |
| Ga0257176_10297601 | 3300026361 | Soil | ATYKIYTPQGARLEANTILVEKDRLIIGNDPLGIYEFARPDKKNPR |
| Ga0257179_10229881 | 3300026371 | Soil | QLYTPEGARLEADTILADKERLIIGSDPLGIYEFERPQKKISE |
| Ga0257179_10398531 | 3300026371 | Soil | YTPQGARLEANTILVEKDRLIIGSDPLGIYEFARPDKINQK |
| Ga0257147_10083851 | 3300026475 | Soil | TLLHFDKEGNRRSEYQIYTKDGARIEANVLLVEEDRLLIGADPIGVYEFARPDRKP |
| Ga0209160_10241964 | 3300026532 | Soil | ARLEAKTILVQKDQLIIGSDPLGLYLFSRPDKKNTK |
| Ga0209058_12158192 | 3300026536 | Soil | IYTPEGARLEANTILVERDHLIIGSDPLGVYEFDRPDKKISH |
| Ga0209648_106862511 | 3300026551 | Grasslands Soil | TYKIYTPEGARLEANTILVEPDRLIIGSDPLGVYTFERPDKKNLK |
| Ga0179587_101604232 | 3300026557 | Vadose Zone Soil | PQGARLEANTLLVDENSLIVGSDPLGIYEFERPDKKNPK |
| Ga0207723_1073891 | 3300026824 | Tropical Forest Soil | QIYTPKGARLEANTILVEEERLLIGADPLGVYEFRRPDRVH |
| Ga0207724_10163311 | 3300026862 | Tropical Forest Soil | EYQIYTPKGARLEANTILVEEERLLIGADPLGVYEFRRPDRVH |
| Ga0207821_10222591 | 3300026869 | Tropical Forest Soil | TPNGTRLEANVILVEEERLLIGADPLGVYEFPRPDRRH |
| Ga0207781_10213052 | 3300026890 | Tropical Forest Soil | NGTRLEANVILVEEERLLIGADPLGVYEFPRPDRRH |
| Ga0207819_10228132 | 3300027024 | Tropical Forest Soil | TPKGARLEANTILVEEERLLIGADPLGVYEFRRPDRVH |
| Ga0207776_10018885 | 3300027035 | Tropical Forest Soil | EYQIYTPNGTRLEANVILVEEERLLIGADPLGVYEFPRPDRRH |
| Ga0207776_10201691 | 3300027035 | Tropical Forest Soil | YQIYTPKGARLEANTILVEEERLLIGADPLGVYEFRRPDRVH |
| Ga0207766_10365531 | 3300027042 | Tropical Forest Soil | PNGTRLEASVILVEEDKLLIGSDPAGVFEFARPDRQH |
| Ga0209735_10360672 | 3300027562 | Forest Soil | YKIYTPEEARLEANTILVEQDRLIIGSDPLGIYEFDRPDKKSQQ |
| Ga0209527_10326542 | 3300027583 | Forest Soil | NRRSEYQIYTKDGARIEANVLLVEEDRLLIGADPLGVYEFARPDRKP |
| Ga0209733_10572591 | 3300027591 | Forest Soil | PQGARLEANTILVEKDRLIIGSDPLGIYEFARPDKINQK |
| Ga0209331_11548691 | 3300027603 | Forest Soil | NRLSEYQIYTKEGARLEAVTILVEPDRLLIGSDPLGVYDFERPDRKR |
| Ga0209625_10122611 | 3300027635 | Forest Soil | KEGNRRSEYQIYTKDGARIEANVLLVEEDRLLIGADPLGVYEFARPDRKP |
| Ga0208565_11090702 | 3300027662 | Peatlands Soil | TREGARLEANTILVEENRLLIGADPQGVFDFERPDRKH |
| Ga0208990_11246611 | 3300027663 | Forest Soil | ARLEANTILVEYDLLMIGSDPLGIYEFDRPDKKNLK |
| Ga0209011_11255701 | 3300027678 | Forest Soil | PSGARLEANTILIDKDHLLIGSDPLGIYEFDRPDKKTAP |
| Ga0209446_10351891 | 3300027698 | Bog Forest Soil | PKGAALDATVILVEEDRLLIGSDPLGVYEFHRPDRKR |
| Ga0209447_101510651 | 3300027701 | Bog Forest Soil | QEARLEANTILVEKDHLIIGSDPLGIYEFERPDKKSQE |
| Ga0209039_103235641 | 3300027825 | Bog Forest Soil | RIYTPDGARLEAGTILVEEDRLLIGADPQGVFDFERPDRKH |
| Ga0209274_105232841 | 3300027853 | Soil | LEANTILIEPDRMIIGGDPIGIYEFQRPDKKNLGAK |
| Ga0209166_101144532 | 3300027857 | Surface Soil | GGARLEASVILVEKDRLIVGNDPLGIYVFERPEKKILQ |
| Ga0209166_105504091 | 3300027857 | Surface Soil | PEGARLEATTILVNKDHLLIGSDPLGIYEFDRPGKKSP |
| Ga0209067_100426462 | 3300027898 | Watersheds | ARLEANAILVEKDRLIIGSDPLGIFEFERPDKKILK |
| Ga0209698_112349981 | 3300027911 | Watersheds | RLEANTILVEEDRLIIGSDPLGIYEFARPDKKSQE |
| Ga0209069_102690131 | 3300027915 | Watersheds | AEGARLDANTILVEKDRLLIGSDPLGVYEFERPDKKLSP |
| Ga0255358_10150251 | 3300028069 | Soil | EGNRRSEYQIYTREGARLEANTILVEENRLLIGADPQGVFDFERPDRKH |
| Ga0137415_113436782 | 3300028536 | Vadose Zone Soil | YTPQGARLEANTLLVEKDRLIIGNDPLGVYEFARSDKKNPQ |
| Ga0302231_101578261 | 3300028775 | Palsa | PGGVRLEANTILIEPEALIIGGDPLGVYQFKRPEKFPQ |
| Ga0316363_101973942 | 3300030659 | Peatlands Soil | SEYRIYTPDGGRLAANTILVEEDRLLIGEDPQGVFEFERPDRKR |
| Ga0310038_100959191 | 3300030707 | Peatlands Soil | DSYRTYTSAGGRLEPRTILVEPNRLLLGQDPLGIYEFARPDKKANAGQ |
| Ga0170822_111294502 | 3300031122 | Forest Soil | EYQIYTKDGARIEANALLVEENSLLIGADPIGVYEFARPDRKP |
| Ga0307498_102467712 | 3300031170 | Soil | FTPNGSRLDGTTLLVEEQVLLIGSDPLGVYEFERPDKKH |
| Ga0265339_102337971 | 3300031249 | Rhizosphere | RLEANTILIEPDRMIIGGDPIGIYEFARPDKKLPASK |
| Ga0170820_107481051 | 3300031446 | Forest Soil | EGNRRSEYQIFTPDGSRLDGTTLLVEEQVLLIGSDPLGVYEFERPDKKH |
| Ga0318541_102474512 | 3300031545 | Soil | LEATAILVEKDQLLIGSDPLGLYLFSRPDKKTRSE |
| Ga0318528_103292391 | 3300031561 | Soil | QIYTPKGARLEANTILVEEERLLIGADPLGVYEFPRPDRKH |
| Ga0307476_101473771 | 3300031715 | Hardwood Forest Soil | RLEASTILIEQNRLIIGSDPLGIYEFERPDKKSQQ |
| Ga0307474_101456201 | 3300031718 | Hardwood Forest Soil | RLEANTILVEAERLIIGNDPLGIYEFDRPDKKFPK |
| Ga0306917_109914822 | 3300031719 | Soil | PNGTRLEASVILVEEERLLIGTDPLGVYEFPRPDRRH |
| Ga0306918_113948041 | 3300031744 | Soil | YQIYTPMGARLEANTILVEEERLLIGADPLGVYEFPRPDRKH |
| Ga0307477_100913381 | 3300031753 | Hardwood Forest Soil | GARLEPNIILVQKDRLLIGSDPLGIYVFERPDKKIPQ |
| Ga0306919_109087481 | 3300031879 | Soil | EYQIYTPKGSPLDATVILVEEDRLLIGNDPLGIYEFHRPDRKR |
| Ga0310916_104292212 | 3300031942 | Soil | ANRRSEYQIYTPKGARLEANTILVEEERLLIGADPLGVYEFPRPDRTH |
| Ga0310913_107699152 | 3300031945 | Soil | ARLEANTILIEKGQLIIGNDPLGLYLFDRPAKKDAK |
| Ga0306926_104384322 | 3300031954 | Soil | EYQIFTPDGSRLDGTTLLVEEGVLLIGSDPLGVYEFERPDKKH |
| Ga0307479_119025881 | 3300031962 | Hardwood Forest Soil | ARLEANTILVENDRLIIGSDPLGIYEFERPDKKNLK |
| Ga0306922_119253801 | 3300032001 | Soil | GARLEANTILIGKDHLIVGNDPLGIYEFNRPDKKTEP |
| Ga0307472_1003497991 | 3300032205 | Hardwood Forest Soil | FDKDGNRRSEYQIYTKDGARIEANVILVEEDRLLIGADPIGVYEFARPDRKP |
| Ga0306920_1006296671 | 3300032261 | Soil | SEYQIYTPKGVGIDATVILVEEQRLLIGADPIGVYEFHRPDRVR |
| Ga0306920_1017524381 | 3300032261 | Soil | YTPNGTRLEASVILVEEERLLIGADPLGVYEFPRPDRRH |
| Ga0335085_117659651 | 3300032770 | Soil | TPEGARLEANTILIEPDCMIIGGDPIGIYEFARPDKKTSSAN |
| Ga0335081_126089471 | 3300032892 | Soil | YKIYTPQEARLEANTILVEKDRLIIGSDPLGIYEFERPGKTTTR |
| Ga0371490_11504281 | 3300033561 | Peat Soil | LLHFDKEGNRRSEYQIYTPEGARLEANTILVEENRLLIGADPQGVFDFERPDRKH |
| ⦗Top⦘ |