| Basic Information | |
|---|---|
| Family ID | F026657 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 43 residues |
| Representative Sequence | LYVDESRIGAVGAFAVSGGNLTELATSPTSLPAGATPAGIVVN |
| Number of Associated Samples | 163 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.52 % |
| % of genes near scaffold ends (potentially truncated) | 97.46 % |
| % of genes from short scaffolds (< 2000 bps) | 91.37 % |
| Associated GOLD sequencing projects | 158 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (61.421 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (24.873 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.843 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.117 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 11.27% Coil/Unstructured: 88.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF04542 | Sigma70_r2 | 6.09 |
| PF08281 | Sigma70_r4_2 | 4.57 |
| PF07883 | Cupin_2 | 3.55 |
| PF00999 | Na_H_Exchanger | 3.05 |
| PF07690 | MFS_1 | 2.54 |
| PF13490 | zf-HC2 | 2.54 |
| PF13977 | TetR_C_6 | 2.03 |
| PF00196 | GerE | 1.52 |
| PF00982 | Glyco_transf_20 | 1.52 |
| PF00378 | ECH_1 | 1.52 |
| PF00005 | ABC_tran | 1.52 |
| PF00551 | Formyl_trans_N | 1.52 |
| PF03795 | YCII | 1.02 |
| PF02467 | Whib | 1.02 |
| PF08241 | Methyltransf_11 | 1.02 |
| PF04389 | Peptidase_M28 | 1.02 |
| PF02604 | PhdYeFM_antitox | 1.02 |
| PF10011 | DUF2254 | 0.51 |
| PF02515 | CoA_transf_3 | 0.51 |
| PF02911 | Formyl_trans_C | 0.51 |
| PF00871 | Acetate_kinase | 0.51 |
| PF00296 | Bac_luciferase | 0.51 |
| PF13751 | DDE_Tnp_1_6 | 0.51 |
| PF14534 | DUF4440 | 0.51 |
| PF13424 | TPR_12 | 0.51 |
| PF11975 | Glyco_hydro_4C | 0.51 |
| PF13508 | Acetyltransf_7 | 0.51 |
| PF13649 | Methyltransf_25 | 0.51 |
| PF12840 | HTH_20 | 0.51 |
| PF00881 | Nitroreductase | 0.51 |
| PF08240 | ADH_N | 0.51 |
| PF02913 | FAD-oxidase_C | 0.51 |
| PF14224 | DUF4331 | 0.51 |
| PF06772 | LtrA | 0.51 |
| PF12833 | HTH_18 | 0.51 |
| PF07920 | DUF1684 | 0.51 |
| PF12680 | SnoaL_2 | 0.51 |
| PF13408 | Zn_ribbon_recom | 0.51 |
| PF00072 | Response_reg | 0.51 |
| PF16912 | Glu_dehyd_C | 0.51 |
| PF01557 | FAA_hydrolase | 0.51 |
| PF00582 | Usp | 0.51 |
| PF04248 | NTP_transf_9 | 0.51 |
| PF04993 | TfoX_N | 0.51 |
| PF14833 | NAD_binding_11 | 0.51 |
| PF00293 | NUDIX | 0.51 |
| PF12852 | Cupin_6 | 0.51 |
| PF00903 | Glyoxalase | 0.51 |
| PF00578 | AhpC-TSA | 0.51 |
| PF02371 | Transposase_20 | 0.51 |
| PF09985 | Glucodextran_C | 0.51 |
| PF13006 | Nterm_IS4 | 0.51 |
| PF03992 | ABM | 0.51 |
| PF03176 | MMPL | 0.51 |
| PF01850 | PIN | 0.51 |
| PF01408 | GFO_IDH_MocA | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 6.09 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 6.09 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 6.09 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 6.09 |
| COG0475 | Kef-type K+ transport system, membrane component KefB | Inorganic ion transport and metabolism [P] | 3.05 |
| COG4651 | Predicted Kef-type K+ transport protein, K+/H+ antiporter domain | Inorganic ion transport and metabolism [P] | 3.05 |
| COG0025 | NhaP-type Na+/H+ or K+/H+ antiporter | Inorganic ion transport and metabolism [P] | 3.05 |
| COG3004 | Na+/H+ antiporter NhaA | Energy production and conversion [C] | 3.05 |
| COG3263 | NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains | Energy production and conversion [C] | 3.05 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 1.52 |
| COG4118 | Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressor | Defense mechanisms [V] | 1.02 |
| COG2161 | Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM family | Defense mechanisms [V] | 1.02 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 1.02 |
| COG4292 | Low temperature requirement protein LtrA (function unknown) | Function unknown [S] | 0.51 |
| COG2343 | Uncharacterized conserved protein, DUF427 family | Function unknown [S] | 0.51 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.51 |
| COG3426 | Butyrate kinase | Energy production and conversion [C] | 0.51 |
| COG3358 | Uncharacterized conserved protein, DUF1684 family | Function unknown [S] | 0.51 |
| COG3070 | Transcriptional regulator of competence genes, TfoX/Sxy family | Transcription [K] | 0.51 |
| COG2409 | Predicted lipid transporter YdfJ, MMPL/SSD domain, RND superfamily | General function prediction only [R] | 0.51 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.51 |
| COG1804 | Crotonobetainyl-CoA:carnitine CoA-transferase CaiB and related acyl-CoA transferases | Lipid transport and metabolism [I] | 0.51 |
| COG1033 | Predicted exporter protein, RND superfamily | General function prediction only [R] | 0.51 |
| COG0282 | Acetate kinase | Energy production and conversion [C] | 0.51 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.51 |
| COG0223 | Methionyl-tRNA formyltransferase | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 61.42 % |
| Unclassified | root | N/A | 38.58 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000956|JGI10216J12902_105747468 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces griseoflavus | 1020 | Open in IMG/M |
| 3300004092|Ga0062389_101106201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 978 | Open in IMG/M |
| 3300005175|Ga0066673_10840212 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300005435|Ga0070714_101544377 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300005467|Ga0070706_101716243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 572 | Open in IMG/M |
| 3300005529|Ga0070741_10971990 | Not Available | 730 | Open in IMG/M |
| 3300005557|Ga0066704_10058465 | All Organisms → cellular organisms → Bacteria | 2453 | Open in IMG/M |
| 3300005560|Ga0066670_11034586 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Pseudomonadaceae → Pseudomonas | 502 | Open in IMG/M |
| 3300005591|Ga0070761_10807372 | Not Available | 590 | Open in IMG/M |
| 3300005591|Ga0070761_10941561 | Not Available | 547 | Open in IMG/M |
| 3300005617|Ga0068859_102853461 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
| 3300005712|Ga0070764_10106245 | All Organisms → cellular organisms → Bacteria | 1505 | Open in IMG/M |
| 3300005921|Ga0070766_10021371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3445 | Open in IMG/M |
| 3300005921|Ga0070766_11271621 | Not Available | 510 | Open in IMG/M |
| 3300006052|Ga0075029_100697203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 685 | Open in IMG/M |
| 3300006174|Ga0075014_100450918 | Not Available | 711 | Open in IMG/M |
| 3300006797|Ga0066659_10845747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 761 | Open in IMG/M |
| 3300006893|Ga0073928_10847333 | Not Available | 629 | Open in IMG/M |
| 3300009012|Ga0066710_100306163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2330 | Open in IMG/M |
| 3300009038|Ga0099829_10080081 | All Organisms → cellular organisms → Bacteria | 2498 | Open in IMG/M |
| 3300009038|Ga0099829_10983166 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300009090|Ga0099827_10231096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1548 | Open in IMG/M |
| 3300009137|Ga0066709_103540102 | Not Available | 567 | Open in IMG/M |
| 3300009665|Ga0116135_1352014 | Not Available | 590 | Open in IMG/M |
| 3300009683|Ga0116224_10517600 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Marmoricola | 569 | Open in IMG/M |
| 3300009792|Ga0126374_10951084 | Not Available | 670 | Open in IMG/M |
| 3300010048|Ga0126373_13012989 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 525 | Open in IMG/M |
| 3300010048|Ga0126373_13294574 | Not Available | 502 | Open in IMG/M |
| 3300010049|Ga0123356_13654670 | Not Available | 532 | Open in IMG/M |
| 3300010326|Ga0134065_10170470 | All Organisms → cellular organisms → Bacteria | 772 | Open in IMG/M |
| 3300010337|Ga0134062_10567385 | Not Available | 580 | Open in IMG/M |
| 3300010358|Ga0126370_10240454 | Not Available | 1397 | Open in IMG/M |
| 3300010359|Ga0126376_10788731 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 926 | Open in IMG/M |
| 3300010360|Ga0126372_12232970 | Not Available | 597 | Open in IMG/M |
| 3300010361|Ga0126378_12681907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 569 | Open in IMG/M |
| 3300010362|Ga0126377_10856234 | Not Available | 970 | Open in IMG/M |
| 3300010362|Ga0126377_12564852 | Not Available | 585 | Open in IMG/M |
| 3300010366|Ga0126379_11409882 | Not Available | 803 | Open in IMG/M |
| 3300010376|Ga0126381_100150975 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300010376|Ga0126381_100531064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1664 | Open in IMG/M |
| 3300010379|Ga0136449_101140533 | Not Available | 1235 | Open in IMG/M |
| 3300010379|Ga0136449_103121740 | Not Available | 643 | Open in IMG/M |
| 3300010396|Ga0134126_11905479 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 651 | Open in IMG/M |
| 3300010869|Ga0126359_1543745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 760 | Open in IMG/M |
| 3300012132|Ga0153978_1056578 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300012198|Ga0137364_10540903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 876 | Open in IMG/M |
| 3300012198|Ga0137364_11304198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides rubriscoriae | 541 | Open in IMG/M |
| 3300012199|Ga0137383_11246184 | Not Available | 533 | Open in IMG/M |
| 3300012200|Ga0137382_10739165 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 706 | Open in IMG/M |
| 3300012202|Ga0137363_11286000 | Not Available | 620 | Open in IMG/M |
| 3300012203|Ga0137399_11761038 | Not Available | 508 | Open in IMG/M |
| 3300012209|Ga0137379_10530926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1084 | Open in IMG/M |
| 3300012211|Ga0137377_10194158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1949 | Open in IMG/M |
| 3300012349|Ga0137387_10518346 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300012349|Ga0137387_10592321 | Not Available | 804 | Open in IMG/M |
| 3300012350|Ga0137372_10648348 | Not Available | 770 | Open in IMG/M |
| 3300012357|Ga0137384_10549876 | Not Available | 945 | Open in IMG/M |
| 3300012359|Ga0137385_10475520 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1059 | Open in IMG/M |
| 3300012359|Ga0137385_11204836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 619 | Open in IMG/M |
| 3300012948|Ga0126375_10558782 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 865 | Open in IMG/M |
| 3300012957|Ga0164303_10573130 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300012971|Ga0126369_10811789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1018 | Open in IMG/M |
| 3300012975|Ga0134110_10286214 | Not Available | 709 | Open in IMG/M |
| 3300013297|Ga0157378_12597371 | Not Available | 559 | Open in IMG/M |
| 3300014161|Ga0181529_10118789 | Not Available | 1655 | Open in IMG/M |
| 3300014501|Ga0182024_11035971 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300014501|Ga0182024_11816771 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Isosphaerales → Isosphaeraceae → Singulisphaera → unclassified Singulisphaera → Singulisphaera sp. GP187 | 681 | Open in IMG/M |
| 3300014501|Ga0182024_12229120 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae → Rhodococcus → Rhodococcus opacus | 599 | Open in IMG/M |
| 3300014657|Ga0181522_10300914 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 952 | Open in IMG/M |
| 3300014839|Ga0182027_10107612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3348 | Open in IMG/M |
| 3300015242|Ga0137412_10885045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 648 | Open in IMG/M |
| 3300016387|Ga0182040_10424871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1048 | Open in IMG/M |
| 3300016422|Ga0182039_12019527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
| 3300017924|Ga0187820_1273815 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 548 | Open in IMG/M |
| 3300017928|Ga0187806_1169122 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 729 | Open in IMG/M |
| 3300017932|Ga0187814_10216295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 722 | Open in IMG/M |
| 3300017942|Ga0187808_10094705 | Not Available | 1295 | Open in IMG/M |
| 3300017943|Ga0187819_10178923 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces luteoverticillatus | 1257 | Open in IMG/M |
| 3300017948|Ga0187847_10095542 | Not Available | 1643 | Open in IMG/M |
| 3300017955|Ga0187817_10263173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
| 3300017955|Ga0187817_10295061 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1034 | Open in IMG/M |
| 3300017959|Ga0187779_10686750 | Not Available | 691 | Open in IMG/M |
| 3300017973|Ga0187780_11171295 | Not Available | 563 | Open in IMG/M |
| 3300017988|Ga0181520_10997572 | Not Available | 554 | Open in IMG/M |
| 3300017993|Ga0187823_10338969 | Not Available | 532 | Open in IMG/M |
| 3300017995|Ga0187816_10309814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 694 | Open in IMG/M |
| 3300018001|Ga0187815_10410715 | Not Available | 577 | Open in IMG/M |
| 3300018001|Ga0187815_10427869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300018037|Ga0187883_10310251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 806 | Open in IMG/M |
| 3300018038|Ga0187855_10531950 | Not Available | 685 | Open in IMG/M |
| 3300018038|Ga0187855_10947266 | Not Available | 501 | Open in IMG/M |
| 3300018047|Ga0187859_10222699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1009 | Open in IMG/M |
| 3300018057|Ga0187858_10132912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1670 | Open in IMG/M |
| 3300020580|Ga0210403_10258122 | Not Available | 1430 | Open in IMG/M |
| 3300020581|Ga0210399_11306902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 571 | Open in IMG/M |
| 3300020582|Ga0210395_10871847 | Not Available | 670 | Open in IMG/M |
| 3300020582|Ga0210395_11256438 | Not Available | 543 | Open in IMG/M |
| 3300021401|Ga0210393_11222878 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 604 | Open in IMG/M |
| 3300021403|Ga0210397_10745090 | Not Available | 755 | Open in IMG/M |
| 3300021404|Ga0210389_10097474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → Nonomuraea aurantiaca | 2262 | Open in IMG/M |
| 3300021405|Ga0210387_10948039 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
| 3300021405|Ga0210387_11238111 | Not Available | 647 | Open in IMG/M |
| 3300021407|Ga0210383_10110254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 2320 | Open in IMG/M |
| 3300021407|Ga0210383_10406493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1174 | Open in IMG/M |
| 3300021407|Ga0210383_11744494 | Not Available | 509 | Open in IMG/M |
| 3300021420|Ga0210394_11764912 | Not Available | 517 | Open in IMG/M |
| 3300021474|Ga0210390_11246707 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
| 3300021475|Ga0210392_10683492 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 764 | Open in IMG/M |
| 3300021478|Ga0210402_11292908 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 657 | Open in IMG/M |
| 3300022557|Ga0212123_10946937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300023088|Ga0224555_1110085 | Not Available | 848 | Open in IMG/M |
| 3300024288|Ga0179589_10134378 | All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium | 1043 | Open in IMG/M |
| 3300025905|Ga0207685_10303019 | Not Available | 791 | Open in IMG/M |
| 3300025906|Ga0207699_11065265 | Not Available | 598 | Open in IMG/M |
| 3300025929|Ga0207664_10023140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4651 | Open in IMG/M |
| 3300025939|Ga0207665_11337872 | Not Available | 571 | Open in IMG/M |
| 3300026327|Ga0209266_1059964 | Not Available | 1821 | Open in IMG/M |
| 3300026498|Ga0257156_1094228 | Not Available | 623 | Open in IMG/M |
| 3300027619|Ga0209330_1154162 | Not Available | 517 | Open in IMG/M |
| 3300027768|Ga0209772_10281367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 527 | Open in IMG/M |
| 3300027812|Ga0209656_10442814 | Not Available | 576 | Open in IMG/M |
| 3300027817|Ga0209112_10037144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1459 | Open in IMG/M |
| 3300027846|Ga0209180_10329694 | Not Available | 872 | Open in IMG/M |
| 3300027846|Ga0209180_10548410 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300027853|Ga0209274_10386567 | Not Available | 722 | Open in IMG/M |
| 3300027889|Ga0209380_10046803 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2453 | Open in IMG/M |
| 3300027889|Ga0209380_10708085 | Not Available | 577 | Open in IMG/M |
| 3300028879|Ga0302229_10248799 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 805 | Open in IMG/M |
| 3300028906|Ga0308309_10127057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2018 | Open in IMG/M |
| 3300028906|Ga0308309_11567909 | Not Available | 561 | Open in IMG/M |
| 3300029943|Ga0311340_10816327 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 784 | Open in IMG/M |
| 3300029951|Ga0311371_12188370 | Not Available | 577 | Open in IMG/M |
| 3300030046|Ga0302305_1328630 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 521 | Open in IMG/M |
| 3300030056|Ga0302181_10165435 | All Organisms → cellular organisms → Bacteria | 1046 | Open in IMG/M |
| 3300030490|Ga0302184_10128574 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1118 | Open in IMG/M |
| 3300030503|Ga0311370_10448628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1601 | Open in IMG/M |
| 3300030580|Ga0311355_10124151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2823 | Open in IMG/M |
| 3300030739|Ga0302311_10271233 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1246 | Open in IMG/M |
| 3300030739|Ga0302311_10638863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 711 | Open in IMG/M |
| 3300030815|Ga0265746_1035975 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300031231|Ga0170824_112663772 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1364 | Open in IMG/M |
| 3300031234|Ga0302325_10129963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4588 | Open in IMG/M |
| 3300031236|Ga0302324_100298661 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2471 | Open in IMG/M |
| 3300031236|Ga0302324_101189969 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1016 | Open in IMG/M |
| 3300031544|Ga0318534_10128867 | Not Available | 1456 | Open in IMG/M |
| 3300031544|Ga0318534_10673198 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300031572|Ga0318515_10105237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1482 | Open in IMG/M |
| 3300031640|Ga0318555_10077391 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1728 | Open in IMG/M |
| 3300031681|Ga0318572_10777563 | Not Available | 569 | Open in IMG/M |
| 3300031708|Ga0310686_101766040 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae | 855 | Open in IMG/M |
| 3300031708|Ga0310686_106758117 | Not Available | 974 | Open in IMG/M |
| 3300031715|Ga0307476_10107997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1970 | Open in IMG/M |
| 3300031747|Ga0318502_10274370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 988 | Open in IMG/M |
| 3300031748|Ga0318492_10761063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora → Actinocatenispora rupis | 520 | Open in IMG/M |
| 3300031753|Ga0307477_10192769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1419 | Open in IMG/M |
| 3300031754|Ga0307475_10387421 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300031765|Ga0318554_10657320 | Not Available | 589 | Open in IMG/M |
| 3300031765|Ga0318554_10746737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Actinocatenispora → Actinocatenispora rupis | 548 | Open in IMG/M |
| 3300031768|Ga0318509_10499794 | Not Available | 679 | Open in IMG/M |
| 3300031770|Ga0318521_10695559 | Not Available | 617 | Open in IMG/M |
| 3300031781|Ga0318547_10176424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1268 | Open in IMG/M |
| 3300031798|Ga0318523_10085715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1530 | Open in IMG/M |
| 3300031819|Ga0318568_10227421 | Not Available | 1153 | Open in IMG/M |
| 3300031823|Ga0307478_11029835 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300031833|Ga0310917_10295358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1095 | Open in IMG/M |
| 3300031845|Ga0318511_10345831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 677 | Open in IMG/M |
| 3300031846|Ga0318512_10077385 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1532 | Open in IMG/M |
| 3300031846|Ga0318512_10630087 | Not Available | 548 | Open in IMG/M |
| 3300031912|Ga0306921_11335839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 791 | Open in IMG/M |
| 3300031939|Ga0308174_10309258 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae | 1248 | Open in IMG/M |
| 3300031945|Ga0310913_10839924 | Not Available | 647 | Open in IMG/M |
| 3300031954|Ga0306926_11784230 | Not Available | 699 | Open in IMG/M |
| 3300031954|Ga0306926_12433181 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300031954|Ga0306926_12623656 | Not Available | 549 | Open in IMG/M |
| 3300031996|Ga0308176_12974036 | Not Available | 502 | Open in IMG/M |
| 3300032009|Ga0318563_10714563 | Not Available | 538 | Open in IMG/M |
| 3300032039|Ga0318559_10215355 | Not Available | 885 | Open in IMG/M |
| 3300032044|Ga0318558_10678235 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 515 | Open in IMG/M |
| 3300032052|Ga0318506_10098768 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1245 | Open in IMG/M |
| 3300032052|Ga0318506_10540558 | Not Available | 516 | Open in IMG/M |
| 3300032054|Ga0318570_10260430 | All Organisms → cellular organisms → Bacteria | 787 | Open in IMG/M |
| 3300032055|Ga0318575_10208337 | Not Available | 982 | Open in IMG/M |
| 3300032066|Ga0318514_10690399 | Not Available | 543 | Open in IMG/M |
| 3300032068|Ga0318553_10457797 | Not Available | 668 | Open in IMG/M |
| 3300032090|Ga0318518_10071150 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 1695 | Open in IMG/M |
| 3300032090|Ga0318518_10718734 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides → Nocardioides rubriscoriae | 508 | Open in IMG/M |
| 3300032091|Ga0318577_10113531 | All Organisms → cellular organisms → Bacteria | 1276 | Open in IMG/M |
| 3300032805|Ga0335078_10495853 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300032828|Ga0335080_10320060 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1680 | Open in IMG/M |
| 3300032892|Ga0335081_12422570 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300032895|Ga0335074_10152515 | All Organisms → cellular organisms → Bacteria | 2919 | Open in IMG/M |
| 3300032898|Ga0335072_10216336 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2248 | Open in IMG/M |
| 3300032898|Ga0335072_10311420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Microbacteriaceae → Microbacterium → Microbacterium azadirachtae | 1755 | Open in IMG/M |
| 3300032898|Ga0335072_10671449 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1022 | Open in IMG/M |
| 3300033289|Ga0310914_11720769 | Not Available | 531 | Open in IMG/M |
| 3300033412|Ga0310810_10831344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 827 | Open in IMG/M |
| 3300033822|Ga0334828_008316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3752 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 24.87% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.66% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.11% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.60% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 5.58% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.55% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.54% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.03% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.03% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.52% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.52% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.52% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.02% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.02% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.02% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.02% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 1.02% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.02% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.51% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.51% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012132 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA062 MetaG | Host-Associated | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014161 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017928 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_1 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018057 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150 | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300023088 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 30-34 | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
| 3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
| 3300027619 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300028879 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030046 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_3 | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300030815 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSU2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033822 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 5-9 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10216J12902_1057474683 | 3300000956 | Soil | VDESKIGSVGVFAVHGGSLTELPSSPVKLPAGATPAGIIAS* |
| Ga0062389_1011062013 | 3300004092 | Bog Forest Soil | DESRIGKVGAFAVNGGNLTELGTSPFALPAGATPAGIAVS* |
| Ga0066673_108402122 | 3300005175 | Soil | DGRYLYVDESKIGSVGIFAVHGGSLTELPSSPVKLPVGATPAGVIAS* |
| Ga0070714_1015443771 | 3300005435 | Agricultural Soil | GYLYVDESKIAAVGEFAVTGGTLTELPGSPVKLPAGATPAGIIVS* |
| Ga0070706_1017162431 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | ARLSPDGRYLFVDESQIGKVGAFAVNDGNLTELATSPFQLPAGATPAGIVVS* |
| Ga0070741_109719901 | 3300005529 | Surface Soil | SPDGRTLYLDEAKAGAVGEFAVHGGDLTELPGSPAALPAGAAPAGIVVT* |
| Ga0066704_100584653 | 3300005557 | Soil | FLYLDESAVGKVGAFAVNDGNLTELATSPFQLPAGAAPAGIVVT* |
| Ga0066670_110345862 | 3300005560 | Soil | DGRYLYIDESKIGAVGAFAVTGGTLAELPTSPVKLPAGATPAGIVVS* |
| Ga0070761_108073722 | 3300005591 | Soil | SRIGKVGAFAVNGGNLTELGTSPFALPASATPAGIVVS* |
| Ga0070761_109415612 | 3300005591 | Soil | KVGAFAVNGGNLTELATSPFALPAGATPAGIAVN* |
| Ga0068859_1028534611 | 3300005617 | Switchgrass Rhizosphere | ARLSPDGRYLYVDESRIGSVGTFAVKGGQLTELTNSPTALPAGATPAGISVN* |
| Ga0070764_101062451 | 3300005712 | Soil | SPDGRFLYVDESKTGTVAAFAVHGGNLTELAGSPTSLPTGATPAGIVVTG* |
| Ga0070766_100213711 | 3300005921 | Soil | DGRFLYVDESRIGVVGAFAVNGGNLTELATSPTSLPAGARPAGIVVN* |
| Ga0070766_112716211 | 3300005921 | Soil | VAAVGGFAVTGGNLTELSTSPTPLPAGATPAGIVVS* |
| Ga0075029_1006972031 | 3300006052 | Watersheds | VDESRIGKVGGFAVTGGNLTELSTSPTPLPAGATPAGIVVS* |
| Ga0075014_1004509183 | 3300006174 | Watersheds | IGAVGAFAVNGGGLTELASSPVSLPTGATPAGVVVT* |
| Ga0066659_108457471 | 3300006797 | Soil | IGAVGAFAVTGGSLTERATSPTSLPAGAAPAGVVVT* |
| Ga0073928_108473331 | 3300006893 | Iron-Sulfur Acid Spring | RTLYVDEAAAGAVAAFAVHDGSLTELASSPTPLPAGATPAGIVVT* |
| Ga0066710_1003061631 | 3300009012 | Grasslands Soil | SAVGKVGAFAVNHGNLTELATSPFQLPAGAAPAGIVVT |
| Ga0099829_100800814 | 3300009038 | Vadose Zone Soil | SPNGAYLFVDESRIGAVGAFAVHGGDLTELATSPTSLPAGAAPAGIVVT* |
| Ga0099829_109831661 | 3300009038 | Vadose Zone Soil | SPDGRFLFVDESRIGKVGAFAVNDGNLTELATSPFQLPAGATPAGIVVS* |
| Ga0099827_102310961 | 3300009090 | Vadose Zone Soil | GAVGAFAVNGGNLTELASSPTSLPAGAVPAGIVVT* |
| Ga0066709_1035401022 | 3300009137 | Grasslands Soil | AYVNITESHIGAVGSFAATGGTLADLPTCPVKLPAGATPAGIVVS* |
| Ga0116135_13520141 | 3300009665 | Peatland | RLSPDGRYLYVDESKIDAVGAFAVNGGNLTELAGSPTSLPAGATPAGIVVTG* |
| Ga0116224_105176002 | 3300009683 | Peatlands Soil | QSKAHAVAASAVNGGSLTQLGTSPFPLPAGAAPAGIVVS* |
| Ga0126374_109510841 | 3300009792 | Tropical Forest Soil | PDGRYLYVDESKIGAVGAFAVTGSTLTELPTSPTPLPTGATPAGIVAT* |
| Ga0126373_130129891 | 3300010048 | Tropical Forest Soil | PDGRFLFIVESGTGAVGVFAVHGGDLTELASSPASLPAGAGPSGIVAS* |
| Ga0126373_132945741 | 3300010048 | Tropical Forest Soil | KTGAVAAFAVQGGNLTELASSPASLPAGATPAGIVVT* |
| Ga0123356_136546702 | 3300010049 | Termite Gut | AVASFAVDGGSLTLLPGSPTQLPAGAAPAGIVVM* |
| Ga0134065_101704702 | 3300010326 | Grasslands Soil | VGKVGAFAVTGGNLTGLASSPFQLPAGAAPAGIVVT* |
| Ga0134062_105673852 | 3300010337 | Grasslands Soil | LSPDGRYLYIDESKIGAVGAFAVTGGTLAELPTSPVKLPAGATPAGIVVS* |
| Ga0126370_102404541 | 3300010358 | Tropical Forest Soil | SPDGRYLYVDESKIGAVGAFAVTGSTLTELPTSPTPLPTGATPAGIVAT* |
| Ga0126376_107887312 | 3300010359 | Tropical Forest Soil | YLFVVESNTGTVGVFAVHRGDLTELASSPASLPAGAAPAGIVVT* |
| Ga0126372_122329701 | 3300010360 | Tropical Forest Soil | GRTLFVDESKIGAVGAFAVTGGNLTELASSPTSLPTGATPAGIAVN* |
| Ga0126378_126819072 | 3300010361 | Tropical Forest Soil | AVTDERLSPDGRFLFVVESGTGAVGVFAVHGGDLTELASSPASLPAGAGPSGIVAS* |
| Ga0126377_108562342 | 3300010362 | Tropical Forest Soil | MSTKAVGAFAVRGGSLTELASSPTSLPAGDTPAGIVVN* |
| Ga0126377_125648521 | 3300010362 | Tropical Forest Soil | HDDSALYVNESRIASIGAFSVDGGSLTEIADSPVALPAGATPAGIAVG* |
| Ga0126379_114098822 | 3300010366 | Tropical Forest Soil | VDARLSPDGQFLYVDESKTGAVAEFAVNGGNLTELASSPASLPAGATPAGIVVT* |
| Ga0126381_1001509751 | 3300010376 | Tropical Forest Soil | ESKIGAVGEFAVYGGNLTELAGSPVSLPPGATPAGIIAN* |
| Ga0126381_1005310644 | 3300010376 | Tropical Forest Soil | LYVNESRADALGAFAVNGGSLTELPSSPAALPAGASPAGIAVR* |
| Ga0136449_1011405332 | 3300010379 | Peatlands Soil | KAHAVAAFAVNGGNLTELGTSPFPLPGGAAPAGIVVR* |
| Ga0136449_1031217401 | 3300010379 | Peatlands Soil | DGRTLYVDESRIGSVGAFSVNEGNLSELASSPTSLPAGSRPAGIVVN* |
| Ga0134126_119054792 | 3300010396 | Terrestrial Soil | DGRYLYVDESATGAVASLAVHGGNLTELASSPTALPAGAAPAGLVVT* |
| Ga0126359_15437452 | 3300010869 | Boreal Forest Soil | SVGAFAVSGGGNLTELPGSPTPLPAGATPAGIAVS* |
| Ga0153978_10565782 | 3300012132 | Attine Ant Fungus Gardens | RLDAVGAFEINHGNLTELPSSPTPLPAGATPAGIAVN* |
| Ga0137364_105409032 | 3300012198 | Vadose Zone Soil | DGRTLFVDESRIGAVGAFAVTGGNLTELATSPVSLPAGAAPAGIVAT* |
| Ga0137364_113041981 | 3300012198 | Vadose Zone Soil | VDESKIGAVGAFAVTGGNLTELATSPTLLPAGAAPAGVVVT* |
| Ga0137383_112461841 | 3300012199 | Vadose Zone Soil | LSPNGRTLYVDESKIGAVGAFAVNGGNLTELASSPASLPAGATPAGIVVN* |
| Ga0137382_107391651 | 3300012200 | Vadose Zone Soil | DESRIATIGVFAVNGGSLTELPSSLLPAGATPAGIVVN* |
| Ga0137363_112860001 | 3300012202 | Vadose Zone Soil | SPDGGFLYVDESRIGKVGAFAVHGGNLTELSSSPTSLPAGATPAGIVVS* |
| Ga0137399_117610382 | 3300012203 | Vadose Zone Soil | YVDESRIGKVGGFAVNGGNLTELGTSPFALPAGATPAGIAVN* |
| Ga0137379_105309262 | 3300012209 | Vadose Zone Soil | DESAVGKVGAFAVTGGNLTELATSPFQLPAGAAPAGIVVT* |
| Ga0137377_101941581 | 3300012211 | Vadose Zone Soil | SPDGRTLFVDESRIGAVGAFAVHGGNLTELASSPASLPAGATPAGVVVT* |
| Ga0137387_105183462 | 3300012349 | Vadose Zone Soil | LSPDGRYLFVDESAVGKVGAFAVNDGNLTELTTSPFQLPAGATPAGIVVS* |
| Ga0137387_105923212 | 3300012349 | Vadose Zone Soil | IGKVGAFAVNGGNLTELSSSPTALPAGATPAGIVVN* |
| Ga0137372_106483481 | 3300012350 | Vadose Zone Soil | ESNIGAVGACAVTGGNLTELATSPFPLPAGAAPAGIVVT* |
| Ga0137384_105498761 | 3300012357 | Vadose Zone Soil | RAGAVGAFAVNGGALTELPSSPALLPAGATPAGIVAT* |
| Ga0137385_104755201 | 3300012359 | Vadose Zone Soil | FVDESKIGAVGAFAVTGGNLTELATSPFSLPAGAAPAGIVVT* |
| Ga0137385_112048361 | 3300012359 | Vadose Zone Soil | IGAAGEFAVHGGNLTELAASPVSLPAGATPAGIIAN* |
| Ga0126375_105587821 | 3300012948 | Tropical Forest Soil | SPDGRTLFVDESRIGAVGAFAVSGGNLTELASSPTSLPAGATPAGIVVT* |
| Ga0164303_105731301 | 3300012957 | Soil | DGRYLYVDESKIGSVGVFAVHGGSLTELPSSPVKLPAGAAPAGVIAS* |
| Ga0126369_108117893 | 3300012971 | Tropical Forest Soil | YVDESKIGAVGAFAVHGGHLTELASSPVSLPAGATPAGIVVS* |
| Ga0134110_102862141 | 3300012975 | Grasslands Soil | SPDGRYLYIDESKIGAVGAFAVTGGTQAELPTSPVRLPAGATPAGIVVS* |
| Ga0157378_125973712 | 3300013297 | Miscanthus Rhizosphere | YLYVDESRIGAVGAFAVNGGNLTELGTSPFALPAGATPAGIVAS* |
| Ga0181529_101187893 | 3300014161 | Bog | TLYVDESRIGAVGAFAVEGGNLTELPGSPTSLPTGATPAGLVVN* |
| Ga0182024_110359713 | 3300014501 | Permafrost | YVDESRIGKVGEFAVNGGSLTELAGSPVSLPAGATPAGVATN* |
| Ga0182024_118167711 | 3300014501 | Permafrost | VDESKTGAVATFAVRGGTLTELAGSPTSLPTGAAPAGVVVS* |
| Ga0182024_122291202 | 3300014501 | Permafrost | YVNENRVGSVGAFAISSGGNLTELPGSPAPLPAGATPAGIAVS* |
| Ga0181522_103009143 | 3300014657 | Bog | ESRIGAVGAFAVQGGNLTELPSSPTSLPAGATPAGIVVN* |
| Ga0182027_101076121 | 3300014839 | Fen | KIGAVGAFAVNGGNLTELPSSPTSLPTGATPAGLVVN* |
| Ga0137412_108850451 | 3300015242 | Vadose Zone Soil | VDESRIGKVGGFAVNGGNLTELGTSPFALPAGATPAGIAVN* |
| Ga0182040_104248711 | 3300016387 | Soil | ESAIGKVAAFTVSGGSLTELGTSPFPLPAGAAPAGIVVS |
| Ga0182039_120195273 | 3300016422 | Soil | YIDESRVGAIGAFAVDGGKLTALQGSPASLPVGATPAGIAVS |
| Ga0187820_12738151 | 3300017924 | Freshwater Sediment | VDESRIGAVGAFAVSGGSLTELAISPTSLPAGATPAGIVVS |
| Ga0187806_11691221 | 3300017928 | Freshwater Sediment | GKVAAFTVSGGSLTELSTSPFPLPAGAAPAGIVVS |
| Ga0187814_102162952 | 3300017932 | Freshwater Sediment | DESATGKVAAFTVSGGSLTELSTSPFPLPAGAAPAGIVVN |
| Ga0187808_100947051 | 3300017942 | Freshwater Sediment | GFLYVDESAVGKVAAFTVSGGSLTELGTSPFPLPAGAAPAGIAVS |
| Ga0187819_101789232 | 3300017943 | Freshwater Sediment | LYVVESAVGKVAAFAVSGGGLAELGASPFALPAGAAPAGIVVS |
| Ga0187847_100955422 | 3300017948 | Peatland | RWLYVNESRVDAVGEFAVDGGTLSELASSPVALPAGATPAGIAVN |
| Ga0187817_102631733 | 3300017955 | Freshwater Sediment | PDGGFLYVDESRIGAVGEFAVSGGNLTELTGSPALLPAGATPAGIVVS |
| Ga0187817_102950613 | 3300017955 | Freshwater Sediment | GKVAAFAVSGGSLTELSTSPFPLPVGAAPAGIVVS |
| Ga0187779_106867501 | 3300017959 | Tropical Peatland | LFVDESSAGVVAALAVTGGTLTELPASPVKLPAGATPAGIILT |
| Ga0187780_111712951 | 3300017973 | Tropical Peatland | DGRYLYVDESRIGAVGAFAVNGGNLTELGSSPTSLPAGATPAGIVVN |
| Ga0181520_109975721 | 3300017988 | Bog | LYVDESRIGAVGAFAVNGGSLTELPGSPTSLPAGATPAGIVVN |
| Ga0187823_103389691 | 3300017993 | Freshwater Sediment | GTTLFVDESRAGSVEAFAVSGGSLFELPSSPTPLPAGATAAGLVVL |
| Ga0187816_103098142 | 3300017995 | Freshwater Sediment | LSPDGGFLYVDESRIGAVGEFAVSGGNLTELTGSPVLLPAGATPAGIVVS |
| Ga0187815_104107151 | 3300018001 | Freshwater Sediment | VGKVAAFAVSGGSLTELSTSPFPLPVGAAPAGIVVS |
| Ga0187815_104278691 | 3300018001 | Freshwater Sediment | DGGFLYVDESRIGAVGEFAVSGGNLTELTGSPVLLPAGATPAGIVVS |
| Ga0187883_103102511 | 3300018037 | Peatland | DESKIGAVGAFAVTGGNLTELPGSPTLLPTGATPAGLVVN |
| Ga0187855_105319501 | 3300018038 | Peatland | GRFLYVDESRIDAVGVFAVNGGNLTEVTGSPVSLPAGATPAGVVTTGF |
| Ga0187855_109472661 | 3300018038 | Peatland | GRFLYVDESRIDAVGVFAVNGGNLTEVNGSPVSLPAGATPAGVVTTGF |
| Ga0187859_102226992 | 3300018047 | Peatland | LYVNESQAKSVGAFAVSGGGNLTELPGSPTPLPAGATPAGIAVS |
| Ga0187858_101329121 | 3300018057 | Peatland | NESKISSVGVFAVSGGGSLAELPGSPTPLPAGATPAGIAVS |
| Ga0210403_102581223 | 3300020580 | Soil | ESRIGKVGAFAVNGGNLTELSTSPFALPAGATPAGIAVN |
| Ga0210399_113069021 | 3300020581 | Soil | ARLSPDGHFLYVDESRIGKVGGFAVTGGNPTELSTSPTPLPAVATPAGIVVS |
| Ga0210395_108718471 | 3300020582 | Soil | ILWVDESRIGAVGAFAVNGGNLTELPSSPTSLPAGAAPAGIVVT |
| Ga0210395_112564381 | 3300020582 | Soil | FLYVDESRIGTVGAFAVSGGNLTELPTSPTSLPAGATPAGIVVN |
| Ga0210393_112228781 | 3300021401 | Soil | DAVGAFAVQGGSLTELSGSPTALPAGASPAGIAVN |
| Ga0210397_107450901 | 3300021403 | Soil | FLYVDESRVGAVGTFAVNGGNLTELATSPTSLPAGATPAGIVVN |
| Ga0210389_100974741 | 3300021404 | Soil | TDAVAAFAVYGGRLTQLGASPFSLPAGAAPAGIVVS |
| Ga0210387_109480392 | 3300021405 | Soil | SRIGKVGAFAVNGGNLTELATSPFALPAGATPAGIAVN |
| Ga0210387_112381111 | 3300021405 | Soil | GFLYVDESRIGKVGAFAVNGGNLTELSTSPSALPAGATPAGIAVN |
| Ga0210383_101102541 | 3300021407 | Soil | NGRFLYVDESKTGAVAAFAVHGGNLTDLPGSPTSLPAGATPAGIAVT |
| Ga0210383_104064931 | 3300021407 | Soil | ESRIGKVGAFAVNGGNLTELATSPFALPAGATPAGIAVN |
| Ga0210383_117444942 | 3300021407 | Soil | RIGAVGAFAVNGGNLTELGTSPFALPAGATPAGIAVS |
| Ga0210394_117649121 | 3300021420 | Soil | LYVDESRIGAVGAFAVNGGNLTELATSPISLPAGATPAGIAVN |
| Ga0210390_112467071 | 3300021474 | Soil | AVDARLSPDGRFLYVDESRIGAVGAFAVNGGNLTELATSPISLPAGATPAGIAVN |
| Ga0210392_106834922 | 3300021475 | Soil | IGKVGAFAVNGGNLTELSTSPFALPAGATPAGIAVN |
| Ga0210402_112929081 | 3300021478 | Soil | WVDESRIGAVGAFAVNGGNLTELPSSPTSLPAGAAPAGIVVN |
| Ga0212123_109469372 | 3300022557 | Iron-Sulfur Acid Spring | ESRIGAVGAFAVNGGNLTELPSSPTSLPAGATPAGIVVN |
| Ga0224555_11100852 | 3300023088 | Soil | TLYVDESRIGAVGAFAVNGGNLTELPGSPTSLPTGATPAGVVVN |
| Ga0179589_101343781 | 3300024288 | Vadose Zone Soil | ESAAGKVGAFAVNDGNLTELATSPFQLPAGAAPAGIVVT |
| Ga0207685_103030191 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | YLYVDESRIGAVGAFAVNGGNLTELGTSPFALPAGATPAGIAVS |
| Ga0207699_110652652 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | DESRIGSVGTFAVNGGQLTELTNSPTALPAGATPAGISVN |
| Ga0207664_100231407 | 3300025929 | Agricultural Soil | KAGEIGEFAVHGGDLTELPGSPATLPAGAAPAGVVVT |
| Ga0207665_113378721 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | TLYLDEARAGEIGEFAVHGGDLTELPGSPATLPAGAAPAGVVVT |
| Ga0209266_10599641 | 3300026327 | Soil | GAVGAFAVHGGDLTELSSSPTSLPAGATPAGIVVT |
| Ga0257156_10942281 | 3300026498 | Soil | VDESKAGAVGAFAVSGGNLTELSSSPTSLPTGATPAGIVVT |
| Ga0209330_11541621 | 3300027619 | Forest Soil | LYVDESRIGAVGAFAVSGGNLTELATSPTSLPAGATPAGIVVN |
| Ga0209772_102813672 | 3300027768 | Bog Forest Soil | ESRIGAVGAFAVNGGNLTELPSSPALLPAGATPAGIVVN |
| Ga0209656_104428141 | 3300027812 | Bog Forest Soil | RIGAVGAFAVNGGSLTELASSPTALPAGAAPAGIVVT |
| Ga0209112_100371443 | 3300027817 | Forest Soil | DGRTLYVDESRIGKVGEFAVSGGSLTELAGSPVSLPAGATPAGVATN |
| Ga0209180_103296943 | 3300027846 | Vadose Zone Soil | GAYLFVDESRIGAVGAFAVHGGDLTELATSPTSLPAGAAPAGIVVT |
| Ga0209180_105484101 | 3300027846 | Vadose Zone Soil | SPDGRFLFVDESRIGKVGAFAVNDGNLTELATSPFQLPAGATPAGIVVS |
| Ga0209274_103865671 | 3300027853 | Soil | RRRPAQPDGRYLYVDESAAGAVATFAVSGGSLAQLASSPTSLPAGATPAGMVVT |
| Ga0209380_100468031 | 3300027889 | Soil | RLSSDGRFLYVDESRIGVVGAFAVNGGNLTELATSPTSLPAGARPAGIVVN |
| Ga0209380_107080851 | 3300027889 | Soil | VDESRVGAVGTFAVNGGNLTELATSPISLPAGATPAGIVVN |
| Ga0302229_102487991 | 3300028879 | Palsa | GQANSVGAFAVSGGGNLTELPGSPVRLPAGATPAGIAVS |
| Ga0308309_101270571 | 3300028906 | Soil | VDESRIGAVGAFAVHGGNLTELGTSPFALPAGATPAGIAVS |
| Ga0308309_115679092 | 3300028906 | Soil | ESRIGAVSAFAVNGGNLTELGTSPFALPAGATPAGIVVS |
| Ga0311340_108163273 | 3300029943 | Palsa | LYVDESRIGKIGAFAVNGGNLTELGTSPFALPAGATPAGIAVS |
| Ga0311371_121883702 | 3300029951 | Palsa | NESKISSVGAFAVSGGGNLTELPGSPIPLPAGATPAGIAVS |
| Ga0302305_13286301 | 3300030046 | Palsa | FLNESRIDALGAFAVSGGSLTELPSSPTALPAGATPAGIAVS |
| Ga0302181_101654352 | 3300030056 | Palsa | YLYVNESRIDAVGAFAVSPGGDLTELPGSPIPLPAGATPAGIAVN |
| Ga0302184_101285742 | 3300030490 | Palsa | DGRFLYVNESKISSVGAFAVSGGGNLTELPGSPIPLPAGATPAGIAVS |
| Ga0311370_104486281 | 3300030503 | Palsa | SQAKSVGAFAVSGGGNLTELPGSPTPLPAGATPAGIAVS |
| Ga0311355_101241515 | 3300030580 | Palsa | YVNESRIDAVGAFAVSPGGDLTELPGSPIPLPAGATPAGIAVN |
| Ga0302311_102712333 | 3300030739 | Palsa | SIAPGGAFAVSGSGNLTELPGSPTPLPAGATPAGIAVS |
| Ga0302311_106388631 | 3300030739 | Palsa | ISSVGAFAVSGGGNLTELPGSPIPLPAGATPAGIAVS |
| Ga0265746_10359752 | 3300030815 | Soil | DGRFLYVNESQAKSVGAFAVSGGGNLTELPGSPTPLPAGATPAGIAVS |
| Ga0170824_1126637722 | 3300031231 | Forest Soil | VDESRIASVGIFAVGGGSLTELSGSPVALPSGATPAGIVVS |
| Ga0302325_101299631 | 3300031234 | Palsa | RFLDVDESRIGKVGVFAVNGGNLTELGTSPFALPAGATPAGIVVS |
| Ga0302324_1002986611 | 3300031236 | Palsa | YVNEGQANSVGAFAVSGGGNLTELPGSPVRLPAGATPAGIAVSPRARADGR |
| Ga0302324_1011899692 | 3300031236 | Palsa | YVNESKISSVGAFAVSGGGNLTELPGSPIPLPAGATPAGIAVS |
| Ga0318534_101288673 | 3300031544 | Soil | MDVADGRYLFIDESRIGTVGAFAVNGGNLTELARSPTSLPAGAMPAGIVVN |
| Ga0318534_106731982 | 3300031544 | Soil | PEGGFLYVDESRIGAVGEFAVSGGNLTELTGSPVSLPAGAAPAGIVVT |
| Ga0318515_101052371 | 3300031572 | Soil | DESRIGAVGEFAVSGGHLTELTGSPVSLPAGATPAGIVVN |
| Ga0318555_100773912 | 3300031640 | Soil | GVVGAFAVHGGGLTELASSPVSLPAGAAPAGVVVN |
| Ga0318572_107775631 | 3300031681 | Soil | RYLFVDESRIGMVGAFAVHGGNLTELASSPASLPAGATPAGIVVN |
| Ga0310686_1017660403 | 3300031708 | Soil | LYVDESRIGKVGAFAVNGGNLTELGTSPAALPAGATPAGIVVN |
| Ga0310686_1067581173 | 3300031708 | Soil | GKVGAFAVNGGNLTELGTSPFALPTGATPAGIVVS |
| Ga0307476_101079974 | 3300031715 | Hardwood Forest Soil | ESKSGKVGVFAVGGGNLTELGTSPFALPTGATPAGIVVS |
| Ga0318502_102743703 | 3300031747 | Soil | LYVDESRTGKVGGFAVDGGNLTELASSPTSLPAGATPAGVVVN |
| Ga0318492_107610631 | 3300031748 | Soil | VAAGKVAAFAVAGGNLTELATSPFTLPAGAAPAGIVVT |
| Ga0307477_101927691 | 3300031753 | Hardwood Forest Soil | SRIGKVGAFAVNGGNLTELGTSPFALPAGATPAGIAVN |
| Ga0307475_103874212 | 3300031754 | Hardwood Forest Soil | FLYVDESRIGKVGAFAVNGGNLTELGTSPFALPAGATPAGIVTS |
| Ga0318554_106573201 | 3300031765 | Soil | GMDVADGRYLFIDESRIGTVGAFAVNGGNLTELARSPTSLPAGAMPAGIVVN |
| Ga0318554_107467372 | 3300031765 | Soil | LYLDEVAAGKVAAFAVAGGNLTELATSPFTLPAGAAPAGIVVT |
| Ga0318509_104997941 | 3300031768 | Soil | RLSPDGRYLFVDESRIGKVGAFAVHGGNLTELASSPASLPAGATPAGIVVN |
| Ga0318521_106955591 | 3300031770 | Soil | RLSPDGGFLYVDESRIGKVGAFTVHGGNLAELSSSPTSLPAGAAPAGIVVS |
| Ga0318547_101764241 | 3300031781 | Soil | SRIGAVGEFAVSGGNLTELTGSPVSLPAGAAPAGIVVT |
| Ga0318523_100857152 | 3300031798 | Soil | ESKIGVVGAFAVHGGGLTELASSPVSLPAGAAPAGVVVN |
| Ga0318568_102274211 | 3300031819 | Soil | IGKVAAFTVSCGSLTELGTSPFPLPAGAAPAGIVVS |
| Ga0307478_110298352 | 3300031823 | Hardwood Forest Soil | LYVDESRIGKVGAFAVNGGNLTELGTSPFALPAGATPAGIVAS |
| Ga0310917_102953583 | 3300031833 | Soil | GGFLYVDESRIGAVGEFAVSGGHLTELTGSPVSLPAGATPAGIVVN |
| Ga0318511_103458311 | 3300031845 | Soil | PDGRYLYVDESRTGKVGGFAVDGGNLTELASSPTSLPAGATPAGVVVN |
| Ga0318512_100773851 | 3300031846 | Soil | GRYLFVDESRIGKVGAFAVHGGNLTELASSPASLPAGATPAGVVVN |
| Ga0318512_106300871 | 3300031846 | Soil | GFLYVDESAIGKVAAFTVSCGSLTELGTSPFPLPAGAAPAGIVVS |
| Ga0306921_113358391 | 3300031912 | Soil | ARLSPDGRYLYVDESRTGKVGGFAVDGGNLTELASSPTSLPAGATPAGVVVN |
| Ga0308174_103092583 | 3300031939 | Soil | LSPDGGSLYVDESRIASVGQFAVNGGELTELSSPPVALPAGATPAGIATH |
| Ga0310913_108399242 | 3300031945 | Soil | RIGAVGAFTVSGGNLAELAASPFPLPAGATPAGIVVN |
| Ga0306926_117842302 | 3300031954 | Soil | VDARLSPDGAYLFVDESRIGAVGTFAVTGGNLTELASSPTLLPDGATPAGIVVT |
| Ga0306926_124331811 | 3300031954 | Soil | IGKVGAFAVTGGDLTELPSSPTSLPAGATPAGIVVT |
| Ga0306926_126236561 | 3300031954 | Soil | DARLSPDGRYLFVDESRIGMVGAFAVHGGNLTELASSPASLPAGATPAGIVVN |
| Ga0308176_129740361 | 3300031996 | Soil | AVDARLSPDGHTLFVDESKIGAVGAFAVTGGNLTELASSPTSLPAGATPAGIAVN |
| Ga0318563_107145631 | 3300032009 | Soil | LYVDESRIGKVGAFAVNGGNLTELSSSPTALPAGAAPAGIVVN |
| Ga0318559_102153551 | 3300032039 | Soil | DGRYLFVDESRIGKVGAFAVHGGNLTELASSPASLPAGATPAGIVVN |
| Ga0318558_106782351 | 3300032044 | Soil | GFLYVDESRIGAVGEFAVSGGHLTELTGSPVSLPAGATPAGIVVN |
| Ga0318506_100987682 | 3300032052 | Soil | LSPDGRTLYVDESKTGTVGAFAVHGGGLTELASSPVSLPAGATPAGVVVT |
| Ga0318506_105405581 | 3300032052 | Soil | GAVGTFAVTGGNQTELASSPTLLPDGATPAGIVVT |
| Ga0318570_102604301 | 3300032054 | Soil | GMVGAFAVHGGNLTELASSPASLPAGATPAGIVVN |
| Ga0318575_102083371 | 3300032055 | Soil | SFLYVDESRIGAVGAFTVSGGNLAELAASPFPLPAGATPAGIVVN |
| Ga0318514_106903991 | 3300032066 | Soil | VGAVDAQLSPDGRYLFVDESRIGKVGAFAVHGGNLTELASSPASLPAGATPAGIVVN |
| Ga0318553_104577971 | 3300032068 | Soil | DESAIGKVAAFTVSGGSLTELGTSPFPLPAGAAPAGIVVS |
| Ga0318518_100711501 | 3300032090 | Soil | LSPDGRTLYVDESKTGTVGAFAVHGGGLTELASSPVSLPAGAAPAGVVVN |
| Ga0318518_107187341 | 3300032090 | Soil | GRRRLKPDGGFLYVDESRIGKIAAFAVTGGDLTELASSPTLLPAGVTPAGIVVT |
| Ga0318577_101135311 | 3300032091 | Soil | MDVADGRYLFIDESRIGTVGAFAVNGGNLTELARSPTSLPAGAMPAGIV |
| Ga0335078_104958531 | 3300032805 | Soil | VDARLSPDGRYLYVDESKIGSVGIFAVTGGSLTELPGSPVKLPAGATPAGVIVS |
| Ga0335080_103200601 | 3300032828 | Soil | RTLYIDESSIGAVGAFAVDDGNLTELSGSPTSLPSGATPAGIAVS |
| Ga0335081_124225701 | 3300032892 | Soil | AGAVAAFAVNGGGLTPLGTSLFPLPAGAAPAGIVVS |
| Ga0335074_101525155 | 3300032895 | Soil | VNESRIASVGAFAVSGGSLAELPSSPTALPAGATPAGIAVS |
| Ga0335072_102163364 | 3300032898 | Soil | AVDAGLSPDGRFLYLNESRTDSVGIFAVSGGDLTELSSSPVALPSGATPAGMVVS |
| Ga0335072_103114201 | 3300032898 | Soil | VDESKIGAVGAFAVHGGRLTELGSSPVSLPQGATPAGVVVS |
| Ga0335072_106714491 | 3300032898 | Soil | RFLYVNESRVSSVGIFAVSGNGNLSELPSSPAALPAGATPAGIAVS |
| Ga0310914_117207692 | 3300033289 | Soil | ESKTGAVGAFAVHGGGLTELASSPVSLPAGATPAGVVVT |
| Ga0310810_108313441 | 3300033412 | Soil | KIGSVGIFAVHGGSLTELPSSPVKLPAGATPAGIIVG |
| Ga0334828_008316_3632_3751 | 3300033822 | Soil | ESRIGAVGAFAVNGGNLTELPGSPTSLPTGATPAGVVVN |
| ⦗Top⦘ |