| Basic Information | |
|---|---|
| Family ID | F026641 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 48 residues |
| Representative Sequence | MSETSEHAARLLRAYQAQEKRFVERRFPLSFAPEVPALRELYSQAK |
| Number of Associated Samples | 160 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 83.76 % |
| % of genes near scaffold ends (potentially truncated) | 99.49 % |
| % of genes from short scaffolds (< 2000 bps) | 88.32 % |
| Associated GOLD sequencing projects | 149 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.371 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (11.168 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.843 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.685 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.30% β-sheet: 0.00% Coil/Unstructured: 52.70% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 16.75 |
| PF13419 | HAD_2 | 12.18 |
| PF12399 | BCA_ABC_TP_C | 4.06 |
| PF00296 | Bac_luciferase | 4.06 |
| PF01152 | Bac_globin | 3.05 |
| PF09865 | DUF2092 | 2.03 |
| PF13531 | SBP_bac_11 | 2.03 |
| PF01425 | Amidase | 1.52 |
| PF02653 | BPD_transp_2 | 1.52 |
| PF12973 | Cupin_7 | 1.52 |
| PF00702 | Hydrolase | 1.52 |
| PF14026 | DUF4242 | 1.02 |
| PF04909 | Amidohydro_2 | 1.02 |
| PF00378 | ECH_1 | 1.02 |
| PF02775 | TPP_enzyme_C | 1.02 |
| PF01494 | FAD_binding_3 | 1.02 |
| PF00496 | SBP_bac_5 | 1.02 |
| PF00589 | Phage_integrase | 0.51 |
| PF07929 | PRiA4_ORF3 | 0.51 |
| PF00248 | Aldo_ket_red | 0.51 |
| PF05726 | Pirin_C | 0.51 |
| PF14238 | DUF4340 | 0.51 |
| PF11716 | MDMPI_N | 0.51 |
| PF09851 | SHOCT | 0.51 |
| PF00202 | Aminotran_3 | 0.51 |
| PF12697 | Abhydrolase_6 | 0.51 |
| PF07690 | MFS_1 | 0.51 |
| PF01266 | DAO | 0.51 |
| PF13378 | MR_MLE_C | 0.51 |
| PF12867 | DinB_2 | 0.51 |
| PF13365 | Trypsin_2 | 0.51 |
| PF09118 | GO-like_E_set | 0.51 |
| PF00561 | Abhydrolase_1 | 0.51 |
| PF01546 | Peptidase_M20 | 0.51 |
| PF13191 | AAA_16 | 0.51 |
| PF04199 | Cyclase | 0.51 |
| PF01436 | NHL | 0.51 |
| PF00994 | MoCF_biosynth | 0.51 |
| PF01177 | Asp_Glu_race | 0.51 |
| PF13561 | adh_short_C2 | 0.51 |
| PF13248 | zf-ribbon_3 | 0.51 |
| PF00107 | ADH_zinc_N | 0.51 |
| PF03992 | ABM | 0.51 |
| PF00578 | AhpC-TSA | 0.51 |
| PF13387 | DUF4105 | 0.51 |
| PF02771 | Acyl-CoA_dh_N | 0.51 |
| PF13354 | Beta-lactamase2 | 0.51 |
| PF01435 | Peptidase_M48 | 0.51 |
| PF01717 | Meth_synt_2 | 0.51 |
| PF12848 | ABC_tran_Xtn | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 4.06 |
| COG2346 | Truncated hemoglobin YjbI | Inorganic ion transport and metabolism [P] | 3.05 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 2.03 |
| COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 1.52 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 1.02 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 1.02 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 1.02 |
| COG0620 | Methionine synthase II (cobalamin-independent) | Amino acid transport and metabolism [E] | 0.51 |
| COG1741 | Redox-sensitive bicupin YhaK, pirin superfamily | General function prediction only [R] | 0.51 |
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 0.51 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.37 % |
| Unclassified | root | N/A | 8.63 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_11140773 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300000956|JGI10216J12902_119934283 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300004479|Ga0062595_100878826 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 751 | Open in IMG/M |
| 3300005093|Ga0062594_100304293 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1215 | Open in IMG/M |
| 3300005186|Ga0066676_10062517 | All Organisms → cellular organisms → Bacteria | 2157 | Open in IMG/M |
| 3300005186|Ga0066676_10357126 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
| 3300005187|Ga0066675_10766154 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
| 3300005328|Ga0070676_10878519 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 666 | Open in IMG/M |
| 3300005332|Ga0066388_100458115 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300005332|Ga0066388_100887568 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300005332|Ga0066388_101815545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1085 | Open in IMG/M |
| 3300005332|Ga0066388_108286047 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 518 | Open in IMG/M |
| 3300005345|Ga0070692_10025073 | All Organisms → cellular organisms → Bacteria | 2937 | Open in IMG/M |
| 3300005347|Ga0070668_101321778 | Not Available | 656 | Open in IMG/M |
| 3300005440|Ga0070705_100955581 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 693 | Open in IMG/M |
| 3300005440|Ga0070705_101789411 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 521 | Open in IMG/M |
| 3300005441|Ga0070700_100480524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 951 | Open in IMG/M |
| 3300005445|Ga0070708_100337370 | All Organisms → cellular organisms → Bacteria | 1420 | Open in IMG/M |
| 3300005446|Ga0066686_10106948 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300005446|Ga0066686_11053005 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 525 | Open in IMG/M |
| 3300005446|Ga0066686_11122258 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → Xanthomonadaceae | 504 | Open in IMG/M |
| 3300005454|Ga0066687_10632967 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 636 | Open in IMG/M |
| 3300005518|Ga0070699_101529317 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 612 | Open in IMG/M |
| 3300005526|Ga0073909_10028147 | All Organisms → cellular organisms → Bacteria | 1897 | Open in IMG/M |
| 3300005557|Ga0066704_10751713 | Not Available | 610 | Open in IMG/M |
| 3300005569|Ga0066705_10020500 | All Organisms → cellular organisms → Bacteria | 3396 | Open in IMG/M |
| 3300005569|Ga0066705_10187184 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1290 | Open in IMG/M |
| 3300005575|Ga0066702_10910149 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 525 | Open in IMG/M |
| 3300005713|Ga0066905_101013688 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300005713|Ga0066905_101661690 | All Organisms → cellular organisms → Bacteria | 586 | Open in IMG/M |
| 3300005764|Ga0066903_101027613 | All Organisms → cellular organisms → Bacteria | 1510 | Open in IMG/M |
| 3300005764|Ga0066903_102134247 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
| 3300005764|Ga0066903_108665112 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300005841|Ga0068863_101179231 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300005844|Ga0068862_101861435 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 611 | Open in IMG/M |
| 3300006031|Ga0066651_10161314 | Not Available | 1178 | Open in IMG/M |
| 3300006032|Ga0066696_11063659 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 514 | Open in IMG/M |
| 3300006175|Ga0070712_100694657 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300006606|Ga0074062_10390653 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 527 | Open in IMG/M |
| 3300006791|Ga0066653_10180579 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300006796|Ga0066665_10083496 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2302 | Open in IMG/M |
| 3300006847|Ga0075431_101870859 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300006852|Ga0075433_11632529 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 556 | Open in IMG/M |
| 3300006852|Ga0075433_11860329 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300006854|Ga0075425_102270203 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 604 | Open in IMG/M |
| 3300006871|Ga0075434_101388158 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300006904|Ga0075424_101551703 | All Organisms → cellular organisms → Bacteria | 702 | Open in IMG/M |
| 3300006904|Ga0075424_102514432 | Not Available | 539 | Open in IMG/M |
| 3300006954|Ga0079219_10010554 | All Organisms → cellular organisms → Bacteria | 3080 | Open in IMG/M |
| 3300006954|Ga0079219_11820707 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300007076|Ga0075435_102032868 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 504 | Open in IMG/M |
| 3300007255|Ga0099791_10054672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1791 | Open in IMG/M |
| 3300009012|Ga0066710_101399721 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1084 | Open in IMG/M |
| 3300009012|Ga0066710_101652904 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300009094|Ga0111539_10565169 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1325 | Open in IMG/M |
| 3300009098|Ga0105245_12219997 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009147|Ga0114129_11839646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 735 | Open in IMG/M |
| 3300009147|Ga0114129_13415583 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 510 | Open in IMG/M |
| 3300009147|Ga0114129_13464720 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300009148|Ga0105243_10563233 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300009148|Ga0105243_13028845 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 509 | Open in IMG/M |
| 3300009792|Ga0126374_10987586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 659 | Open in IMG/M |
| 3300010043|Ga0126380_10026318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2879 | Open in IMG/M |
| 3300010047|Ga0126382_10525647 | All Organisms → cellular organisms → Bacteria | 957 | Open in IMG/M |
| 3300010303|Ga0134082_10284709 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300010304|Ga0134088_10259019 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 837 | Open in IMG/M |
| 3300010322|Ga0134084_10243234 | Not Available | 647 | Open in IMG/M |
| 3300010335|Ga0134063_10559387 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 578 | Open in IMG/M |
| 3300010358|Ga0126370_12513897 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300010360|Ga0126372_11673644 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300010361|Ga0126378_10482100 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1355 | Open in IMG/M |
| 3300010361|Ga0126378_12553298 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 584 | Open in IMG/M |
| 3300010361|Ga0126378_12778862 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 559 | Open in IMG/M |
| 3300010362|Ga0126377_12814437 | Not Available | 561 | Open in IMG/M |
| 3300010362|Ga0126377_13160687 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 532 | Open in IMG/M |
| 3300010373|Ga0134128_10373912 | All Organisms → cellular organisms → Bacteria | 1592 | Open in IMG/M |
| 3300010376|Ga0126381_102057548 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 822 | Open in IMG/M |
| 3300010391|Ga0136847_12284481 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300010397|Ga0134124_11724503 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300010397|Ga0134124_13037436 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 513 | Open in IMG/M |
| 3300010398|Ga0126383_10002197 | All Organisms → cellular organisms → Bacteria | 12556 | Open in IMG/M |
| 3300010398|Ga0126383_11891935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 685 | Open in IMG/M |
| 3300010398|Ga0126383_13113674 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300010399|Ga0134127_12795168 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 568 | Open in IMG/M |
| 3300010403|Ga0134123_10753399 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 960 | Open in IMG/M |
| 3300011119|Ga0105246_10626067 | All Organisms → cellular organisms → Bacteria | 933 | Open in IMG/M |
| 3300011271|Ga0137393_10700258 | All Organisms → cellular organisms → Bacteria | 868 | Open in IMG/M |
| 3300011419|Ga0137446_1133140 | Not Available | 598 | Open in IMG/M |
| 3300012189|Ga0137388_10015646 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5544 | Open in IMG/M |
| 3300012203|Ga0137399_10653570 | All Organisms → cellular organisms → Bacteria | 885 | Open in IMG/M |
| 3300012205|Ga0137362_10085605 | All Organisms → cellular organisms → Bacteria | 2636 | Open in IMG/M |
| 3300012207|Ga0137381_11217371 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300012209|Ga0137379_10093924 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2885 | Open in IMG/M |
| 3300012350|Ga0137372_10032644 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4757 | Open in IMG/M |
| 3300012350|Ga0137372_10178006 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300012361|Ga0137360_10005339 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | 7859 | Open in IMG/M |
| 3300012363|Ga0137390_11841496 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 535 | Open in IMG/M |
| 3300012400|Ga0134048_1061311 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 532 | Open in IMG/M |
| 3300012922|Ga0137394_10109638 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2330 | Open in IMG/M |
| 3300012922|Ga0137394_11174914 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 631 | Open in IMG/M |
| 3300012929|Ga0137404_10053455 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3106 | Open in IMG/M |
| 3300012929|Ga0137404_10745959 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012931|Ga0153915_11312729 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
| 3300012948|Ga0126375_10645894 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
| 3300012971|Ga0126369_12113139 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 651 | Open in IMG/M |
| 3300012972|Ga0134077_10479646 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300012984|Ga0164309_10123325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 1679 | Open in IMG/M |
| 3300013100|Ga0157373_10517316 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300013297|Ga0157378_11732952 | Not Available | 672 | Open in IMG/M |
| 3300015241|Ga0137418_10000877 | All Organisms → cellular organisms → Bacteria | 27609 | Open in IMG/M |
| 3300015371|Ga0132258_10158045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5445 | Open in IMG/M |
| 3300015372|Ga0132256_100080401 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 3117 | Open in IMG/M |
| 3300015372|Ga0132256_101363484 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300015373|Ga0132257_100178697 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2503 | Open in IMG/M |
| 3300015373|Ga0132257_103416167 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300015374|Ga0132255_101958418 | Not Available | 891 | Open in IMG/M |
| 3300017656|Ga0134112_10477046 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 525 | Open in IMG/M |
| 3300017659|Ga0134083_10264874 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 722 | Open in IMG/M |
| 3300017974|Ga0187777_10733007 | All Organisms → cellular organisms → Bacteria | 703 | Open in IMG/M |
| 3300018064|Ga0187773_10704808 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 630 | Open in IMG/M |
| 3300018431|Ga0066655_10072937 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1846 | Open in IMG/M |
| 3300018468|Ga0066662_10111011 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1973 | Open in IMG/M |
| 3300018482|Ga0066669_11654482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 586 | Open in IMG/M |
| 3300019362|Ga0173479_10257808 | Not Available | 771 | Open in IMG/M |
| 3300019999|Ga0193718_1090805 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300020012|Ga0193732_1011349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes | 1539 | Open in IMG/M |
| 3300021476|Ga0187846_10219941 | All Organisms → cellular organisms → Bacteria | 793 | Open in IMG/M |
| 3300021559|Ga0210409_10091600 | All Organisms → cellular organisms → Bacteria | 2807 | Open in IMG/M |
| 3300023066|Ga0247793_1038413 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300025315|Ga0207697_10442906 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300025551|Ga0210131_1019090 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300025560|Ga0210108_1056520 | Not Available | 755 | Open in IMG/M |
| 3300025910|Ga0207684_11093105 | Not Available | 664 | Open in IMG/M |
| 3300025912|Ga0207707_10541545 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 990 | Open in IMG/M |
| 3300025915|Ga0207693_10361186 | All Organisms → cellular organisms → Bacteria | 1136 | Open in IMG/M |
| 3300025922|Ga0207646_10846580 | All Organisms → cellular organisms → Bacteria | 813 | Open in IMG/M |
| 3300025923|Ga0207681_10162006 | All Organisms → cellular organisms → Bacteria | 1687 | Open in IMG/M |
| 3300025933|Ga0207706_11276109 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300025940|Ga0207691_10668720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 877 | Open in IMG/M |
| 3300025940|Ga0207691_11453642 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 562 | Open in IMG/M |
| 3300025944|Ga0207661_10487163 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300025957|Ga0210089_1012627 | All Organisms → cellular organisms → Bacteria | 927 | Open in IMG/M |
| 3300025961|Ga0207712_11169485 | Not Available | 686 | Open in IMG/M |
| 3300025981|Ga0207640_10755061 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 839 | Open in IMG/M |
| 3300025986|Ga0207658_11252647 | All Organisms → cellular organisms → Bacteria | 678 | Open in IMG/M |
| 3300026075|Ga0207708_10593883 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 937 | Open in IMG/M |
| 3300026075|Ga0207708_11394448 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 615 | Open in IMG/M |
| 3300026088|Ga0207641_10430152 | All Organisms → cellular organisms → Bacteria | 1272 | Open in IMG/M |
| 3300026118|Ga0207675_102249412 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 560 | Open in IMG/M |
| 3300026296|Ga0209235_1064625 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1694 | Open in IMG/M |
| 3300026307|Ga0209469_1014278 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2892 | Open in IMG/M |
| 3300026469|Ga0257169_1012775 | All Organisms → cellular organisms → Bacteria | 1102 | Open in IMG/M |
| 3300026475|Ga0257147_1028523 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → unclassified Cyanobacteria → Cyanobacteria bacterium 13_1_40CM_2_61_4 | 798 | Open in IMG/M |
| 3300026515|Ga0257158_1030273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 949 | Open in IMG/M |
| 3300026524|Ga0209690_1111860 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1094 | Open in IMG/M |
| 3300026530|Ga0209807_1190007 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 736 | Open in IMG/M |
| 3300026532|Ga0209160_1249402 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 605 | Open in IMG/M |
| 3300026550|Ga0209474_10252830 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1084 | Open in IMG/M |
| 3300026793|Ga0207441_104509 | Not Available | 591 | Open in IMG/M |
| 3300027646|Ga0209466_1074904 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300027775|Ga0209177_10124302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 847 | Open in IMG/M |
| 3300027787|Ga0209074_10534116 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027821|Ga0209811_10167367 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 821 | Open in IMG/M |
| 3300027873|Ga0209814_10353665 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300027907|Ga0207428_10670279 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 743 | Open in IMG/M |
| 3300028380|Ga0268265_10766946 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 937 | Open in IMG/M |
| 3300028596|Ga0247821_10732694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 647 | Open in IMG/M |
| 3300028719|Ga0307301_10029390 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300028791|Ga0307290_10086347 | All Organisms → cellular organisms → Bacteria | 1142 | Open in IMG/M |
| 3300028812|Ga0247825_10548122 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Burkholderia → pseudomallei group → Burkholderia pseudomallei | 826 | Open in IMG/M |
| 3300031170|Ga0307498_10105292 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 875 | Open in IMG/M |
| 3300031538|Ga0310888_10229357 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1033 | Open in IMG/M |
| 3300031546|Ga0318538_10452397 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 695 | Open in IMG/M |
| 3300031547|Ga0310887_10022678 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2515 | Open in IMG/M |
| 3300031720|Ga0307469_10986746 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300031740|Ga0307468_100193276 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300031740|Ga0307468_101364139 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031751|Ga0318494_10906533 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 517 | Open in IMG/M |
| 3300031768|Ga0318509_10543092 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 649 | Open in IMG/M |
| 3300031795|Ga0318557_10427918 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 609 | Open in IMG/M |
| 3300031860|Ga0318495_10026201 | All Organisms → cellular organisms → Bacteria | 2526 | Open in IMG/M |
| 3300031860|Ga0318495_10114537 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1214 | Open in IMG/M |
| 3300031913|Ga0310891_10081849 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 964 | Open in IMG/M |
| 3300032003|Ga0310897_10393939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
| 3300032017|Ga0310899_10200630 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 882 | Open in IMG/M |
| 3300032043|Ga0318556_10335146 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 791 | Open in IMG/M |
| 3300032052|Ga0318506_10385943 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 621 | Open in IMG/M |
| 3300032126|Ga0307415_101663494 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300032174|Ga0307470_10695006 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 774 | Open in IMG/M |
| 3300032174|Ga0307470_11021983 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 659 | Open in IMG/M |
| 3300032180|Ga0307471_100078163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2895 | Open in IMG/M |
| 3300032180|Ga0307471_100585830 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1273 | Open in IMG/M |
| 3300032180|Ga0307471_100914041 | Not Available | 1045 | Open in IMG/M |
| 3300033004|Ga0335084_10631211 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
| 3300033004|Ga0335084_12135743 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 543 | Open in IMG/M |
| 3300033433|Ga0326726_11917040 | Not Available | 577 | Open in IMG/M |
| 3300033550|Ga0247829_11007509 | Not Available | 692 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 11.17% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.12% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 8.12% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.11% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.09% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.09% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 5.08% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.06% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.06% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.55% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.05% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.54% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.54% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.03% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.03% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.52% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.02% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.02% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.02% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.51% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.51% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.51% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012400 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_4_2 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019999 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025957 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026307 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 (SPAdes) | Environmental | Open in IMG/M |
| 3300026469 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-17-B | Environmental | Open in IMG/M |
| 3300026475 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-A | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026532 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026793 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06A3a-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028791 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144 | Environmental | Open in IMG/M |
| 3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300032003 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D1 | Environmental | Open in IMG/M |
| 3300032017 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Host-Associated | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_111407732 | 3300000953 | Soil | MSETSDRLLRGYQAQEKRFRERRFPLRFTTESPVVRELYRQAKGMRWNPET |
| JGI10216J12902_1199342832 | 3300000956 | Soil | LSEVTDSHAARLLRAYQEQEKRFVERRFPLQFAPEVPALRELYSQAKG |
| Ga0062595_1008788261 | 3300004479 | Soil | MSQTSERERADRLLRAYQAQERRFTERRFPLRFLPETPAIRELYSQAKGLSWNPEKD |
| Ga0062594_1003042931 | 3300005093 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFASENPTLRELYRQAKRFRWNPETDI |
| Ga0066676_100625173 | 3300005186 | Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPAIRELYSQAKGLRWNPETD |
| Ga0066676_103571262 | 3300005186 | Soil | MSETSEHAARLLSAYQAQEKRFVERRFPLSFAPEVPALRELYSQAKGLRWNPETD |
| Ga0066675_107661542 | 3300005187 | Soil | MSETSEYAARLLRAYQAQEKRFVERRFPLQFAPEVPALRE |
| Ga0070676_108785192 | 3300005328 | Miscanthus Rhizosphere | MSAESDHTARLLRAYQAQEKRFVERRFPLEFAPEVPALRELYSQAKGFHWNPETDIAWD |
| Ga0066388_1004581154 | 3300005332 | Tropical Forest Soil | MSEPHEHAARLLRAYQAQEKQFVERRFPLQFAPEVPALRELYSQ |
| Ga0066388_1008875683 | 3300005332 | Tropical Forest Soil | MPWHMGSTSEHAERLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKA |
| Ga0066388_1018155451 | 3300005332 | Tropical Forest Soil | VSEVPEHSARLLRAYQAQEKQFVERRFPLEFAPEVPALRELYSQGKGLHWNPE |
| Ga0066388_1082860471 | 3300005332 | Tropical Forest Soil | MGEPHEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGLHWNPETDIAWD |
| Ga0070692_100250731 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETSDELLRGFQAQEKRFVERRFPLRFAPESPALRELYAQAKGLRW |
| Ga0070668_1013217782 | 3300005347 | Switchgrass Rhizosphere | MSETSDELLRGFQAQEKRFVERRFPLRFAPESPALRELYAQAKGLR |
| Ga0070705_1009555813 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MITPSAMDRQTTGRAEQLLRAYQAQEKRFVERRFPLRFEPEVPAIRELYAQAKGMRWNPE |
| Ga0070705_1017894112 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MGEGSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKG |
| Ga0070700_1004805241 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETSDELLRGFQAQEKRFVEQRFPLRFAPENPALRELYAQGKGLRWNPETDIAWGRFD |
| Ga0070708_1003373701 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETGEHATRLLRAYQAQEKRFVERRFPLEFATEVPALRELYSQ |
| Ga0066686_101069484 | 3300005446 | Soil | MSETGEHATRLLRAYQAQVKRFVERRFPLEFATEVPALRELYSQSKG |
| Ga0066686_110530052 | 3300005446 | Soil | MNVRSESSATRLLRAYQAQEKRFVERRFPLEFAPEIPAIRELYSQAKG |
| Ga0066686_111222581 | 3300005446 | Soil | VALTMSETSEYAARLLRAYQAQEKRFVERRFPLQFAPEVPALR |
| Ga0066687_106329673 | 3300005454 | Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGFRWNPETDILWER |
| Ga0070699_1015293173 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETSDRLLRGYQAQEKRFLERRFPLRFTTENPILRELYGQAKGL |
| Ga0073909_100281473 | 3300005526 | Surface Soil | MSETSDELLRGFQAQEKRFVERRFPLRFAPESPALRELYAQAKGLRWNPETDIAW |
| Ga0066704_107517131 | 3300005557 | Soil | MSGTSEHAARLLRAYQAQEKRFVERRFPLEFAPEVPALRELYSQAKGL |
| Ga0066705_100205005 | 3300005569 | Soil | MSETSNHAARLLRAYQAQEKRFVERRFPLEFAPEVPALRE |
| Ga0066705_101871844 | 3300005569 | Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPA |
| Ga0066702_109101491 | 3300005575 | Soil | MSETREHAVRLLRAYQEQEKRFVERRFPLEFAPEVPVL |
| Ga0066905_1010136881 | 3300005713 | Tropical Forest Soil | MSDDREHAARLLRAYQAQEKRFVERRFPLEFAPEV |
| Ga0066905_1016616902 | 3300005713 | Tropical Forest Soil | MTEIHAELLRAYQAQEKRFVERRFPLSFAPENPVIRELYSQSKGLRWNP |
| Ga0066903_1010276131 | 3300005764 | Tropical Forest Soil | MGEPHEHAARLLRAYQAQEKQFVERRFPLQFAPEVPALRELYSQAKGLHWNPET |
| Ga0066903_1021342473 | 3300005764 | Tropical Forest Soil | LSEVTEPHAARLLRAYQAQERRFVERRFPLQFAPEVPALRELYSQAK |
| Ga0066903_1086651121 | 3300005764 | Tropical Forest Soil | MGEPHEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGLH |
| Ga0068863_1011792311 | 3300005841 | Switchgrass Rhizosphere | MSETSEHAARLLRAYQAQEQRFVERRFPLQFAPEVPVLRELYSQAKAFHWNPDTDIA |
| Ga0068862_1018614351 | 3300005844 | Switchgrass Rhizosphere | MSETREHAAQLLRAYQAQEKRFVEQRFPLQFAPEVPVLRELYSQAKGLHWNPETDIAW |
| Ga0066651_101613142 | 3300006031 | Soil | MSETSGSHAARLLRAYQAQEKRFIERRFPLQFAPEVPAIRELYSQAKGFRWNPMT |
| Ga0066696_110636593 | 3300006032 | Soil | MSETSEPHAARLLRAYQAQEKRFVERRFPLQFAPEVPAIRELYSQAKGFRWNPMT |
| Ga0070712_1006946571 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETSDRLLRGYQAQEKRFLERRFPLHFTTESPILRELYGQAKGLRWNPETDIAWSRF |
| Ga0074062_103906532 | 3300006606 | Soil | MSETSEHAARLLRAYQAQEQRFVERRFPLQFAPEVPVLRELYSQAKAFHWNPETDIAWDR |
| Ga0066653_101805792 | 3300006791 | Soil | MSETPDRGSAGRLLRAYQAQEMRFAEQRFPLRFEPEVPALRELYSQAKGFRWNPETDIAWSRLDPS |
| Ga0066665_100834965 | 3300006796 | Soil | MSETSEHAARLLSAYQAQEKRFVERRFPLSFAPEVP |
| Ga0075431_1018708591 | 3300006847 | Populus Rhizosphere | MSTAAESGSAERLLRAYQAQEKRFVERRFPLRFAPEVPAIRELYSQAKGFRWNPETD |
| Ga0075433_116325291 | 3300006852 | Populus Rhizosphere | LSEVTESHAARLLRAYQEQEKRFVERRFPLQFAPEVP |
| Ga0075433_118603291 | 3300006852 | Populus Rhizosphere | VTDARAAGAGADRLLRAYQAQEKRFVERRFPLRFVPEVPAIRELYSQAKGLRWN |
| Ga0075425_1022702031 | 3300006854 | Populus Rhizosphere | MSETRDHAARLLRAYQAQEKRFVERRFPLQFAPEV |
| Ga0075434_1013881581 | 3300006871 | Populus Rhizosphere | MSETSDGLLRGYQAQEKRFQERRFPLRFTTENPILRELYGQAKGLRWNP |
| Ga0075424_1015517032 | 3300006904 | Populus Rhizosphere | MSETSDGLLRGYQAQEKRFQERRFPLRFTTENPILRELYGQAKGLRWNPETD |
| Ga0075424_1025144322 | 3300006904 | Populus Rhizosphere | MGETSDHTTRLLRAYQAQEKRFVERRFPLEFVPEVPAL |
| Ga0079219_100105544 | 3300006954 | Agricultural Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFTTESPVVRELYRQAKGMRWNPETDV |
| Ga0079219_118207072 | 3300006954 | Agricultural Soil | VTSETPEHAVRLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGLRWN |
| Ga0075435_1020328681 | 3300007076 | Populus Rhizosphere | VSETREHAARLLRAYQAQEKRFVERRFPLQFAPEVP |
| Ga0099791_100546721 | 3300007255 | Vadose Zone Soil | MSEARDHAARLLRAYQAQEKRFVERRFPLEFAPEVPALRELYSQSKGLRWNPET |
| Ga0066710_1013997211 | 3300009012 | Grasslands Soil | MSETGEHATRLLRAYQAQEKRFVERRFPLEFATEVPALRELYSQSKGLHWNPETDIAWDR |
| Ga0066710_1016529042 | 3300009012 | Grasslands Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGFRWNPE |
| Ga0111539_105651691 | 3300009094 | Populus Rhizosphere | MGEGSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGLHWNPET |
| Ga0105245_122199971 | 3300009098 | Miscanthus Rhizosphere | MTWANDRDQEFSVPLLRAYQAQEKRFVERRFPLEFAPEVPAIRELYSQAKGFRWN |
| Ga0114129_118396463 | 3300009147 | Populus Rhizosphere | MSETSEHAARLLRGYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGFRWN |
| Ga0114129_134155832 | 3300009147 | Populus Rhizosphere | MSETGEHATRLLRAYQAQEKRFVERRFPLEFATEVPALRELYSQSKGLHW |
| Ga0114129_134647202 | 3300009147 | Populus Rhizosphere | MSEMSDPARLLRAYQAQEKRFVERRFPLQFAPEVPAIRELYSQA |
| Ga0105243_105632333 | 3300009148 | Miscanthus Rhizosphere | MSETSDRLLRGYQAQEKRFRERRFHLPATTESPVVRELYRQAKGMRWNPETDVGWSRFDAAAYSE |
| Ga0105243_130288452 | 3300009148 | Miscanthus Rhizosphere | MDETSEHAGRLLRAYQAQEKRFVERRFPMQFAPEVPALRE |
| Ga0126374_109875862 | 3300009792 | Tropical Forest Soil | MIDTPETGQAAALLRAYQAQERRFVERRFPLVFEPEVPAIR |
| Ga0126380_100263181 | 3300010043 | Tropical Forest Soil | MSEVREHSAQLLRAYQAQEKRFVEHRFPLEFAPEVPALRELYSQSKGLSWNPETDIPWDR |
| Ga0126382_105256472 | 3300010047 | Tropical Forest Soil | MSETSDQLLRGYQVQEKRFLERRFPLRFASENPTLRELYRQAKRLRW |
| Ga0134082_102847091 | 3300010303 | Grasslands Soil | MNETSDHAARLLRAYQAQEKRFVERRFPLQFAPEVPAIRELYSQAKGFHWNPVTDIP |
| Ga0134088_102590192 | 3300010304 | Grasslands Soil | MSETSDHAARLLRAYQAQEKRFVERRFPLQFAPEVPAIRELYSQAKGLRWNP |
| Ga0134084_102432342 | 3300010322 | Grasslands Soil | MSETSGSHAARLLRAYQAQEKRFIERRFPLQFAPEVPAIREL |
| Ga0134063_105593871 | 3300010335 | Grasslands Soil | MSETGEHATRLLRAYQAQEKRFVERRFPLEFATEVPALRE |
| Ga0126370_125138971 | 3300010358 | Tropical Forest Soil | MSETGEYAVRLLRAYQAQEKRFVERRFPLEFTPEVPALRERYCQA |
| Ga0126372_116736441 | 3300010360 | Tropical Forest Soil | MSETREHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGLHWNPETDIAWD |
| Ga0126378_104821002 | 3300010361 | Tropical Forest Soil | MGEPHEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGLHWN |
| Ga0126378_125532982 | 3300010361 | Tropical Forest Soil | VAELSVATGEPHEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGLHWN |
| Ga0126378_127788621 | 3300010361 | Tropical Forest Soil | VAELNSAMGEPHEHAARLLRAYQAQEKQFVERRFPLQFAPEVPALRELYSQAKGLHWNPETDIAW |
| Ga0126377_128144372 | 3300010362 | Tropical Forest Soil | MTESRGPAVDHLLRAYQDQERRFVERRFPLRFEPEVPAIRELYSQAK |
| Ga0126377_131606872 | 3300010362 | Tropical Forest Soil | MGSTSEHAERLLRAYQAQEQRFVERRFPLQFAPEVP |
| Ga0134128_103739121 | 3300010373 | Terrestrial Soil | MSETSDRLLRGYQAQEKRFRERRFPLRFTTESPVVRELYRQAKGMRWNPETDV |
| Ga0126381_1020575482 | 3300010376 | Tropical Forest Soil | VAELNSAMGEPHEHAARLLRAYQAQEKQFVERRFPLQFAPEVPALRELYSQAKGLHW |
| Ga0136847_122844813 | 3300010391 | Freshwater Sediment | MSETSDELLRGFQAQEKRFVEQRFPLRFAPESPALRELYAQAKGLSWNPETDI |
| Ga0134124_117245032 | 3300010397 | Terrestrial Soil | MSETSDELLRGFQAQEKRFVEQRFPLRFAPENPALRELYAQGKGLRWNPETDIAWGRFDPAAYERPVREA |
| Ga0134124_130374361 | 3300010397 | Terrestrial Soil | MSETSEHAARLLRAYQAQEQRFVERRFPLQFAPEVPVLRS |
| Ga0126383_1000219716 | 3300010398 | Tropical Forest Soil | MGEPHEHAARLLRAYQAQEKRFVERRSPLQFAPEVPALRELYSQAKGLHWNPETDIAWDRFDP |
| Ga0126383_118919352 | 3300010398 | Tropical Forest Soil | VAELSEAMGEPHGHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRE |
| Ga0126383_131136741 | 3300010398 | Tropical Forest Soil | MSEVREHSAQLLRAYQAQERRFVERRFPLEFAPEVPALRELYSQSKGLS |
| Ga0134127_127951682 | 3300010399 | Terrestrial Soil | MSTHVEQLLRAFQAQEKQFVEQRFPLEFRPETPAVRELYS |
| Ga0134123_107533992 | 3300010403 | Terrestrial Soil | MSETREHAARLLRAYQAQERRFVEQRFPLQFAPEVPVLREL |
| Ga0105246_106260671 | 3300011119 | Miscanthus Rhizosphere | MSETSDRLLRGYQAQEKRFLERRFPLRFASENPTLRE |
| Ga0137393_107002582 | 3300011271 | Vadose Zone Soil | MSETSDELLRGFQAQEKRFVERRFPLRFAPESPALRELYAQAKGLRWNPETD |
| Ga0137446_11331402 | 3300011419 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFAPENPTLRELYSQAKGLRWNPE |
| Ga0137388_100156466 | 3300012189 | Vadose Zone Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFAPENPTLRELYSQAKGLRWNPETDITWS |
| Ga0137399_106535701 | 3300012203 | Vadose Zone Soil | MSETSEPHAARLLRAYQAQEKRFVERRFPLQFAPEVPAIRELYSQAK |
| Ga0137362_100856051 | 3300012205 | Vadose Zone Soil | MSETSDHGARLLRAYQAQEKRFVERRFPLEFAPEV |
| Ga0137381_112173711 | 3300012207 | Vadose Zone Soil | MSETSDRLLRGYQAQEKRFVERRFPLRFAPENPALRELYSQAKGMRWN |
| Ga0137379_100939245 | 3300012209 | Vadose Zone Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLSFAPEVPALRELYSQAKGLRWNPETDIAW |
| Ga0137372_100326441 | 3300012350 | Vadose Zone Soil | MTETSDRLLRGYQAQEKRFVERRFPLHFEPESPAIRELYSQSKGFRWNPTEDI |
| Ga0137372_101780063 | 3300012350 | Vadose Zone Soil | MSETKEPDFSVPLLRAYQAQEKRFVEQRFPLQFAPEVPAIRELYS |
| Ga0137360_100053391 | 3300012361 | Vadose Zone Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLSFAPEVPALRELYSQAK |
| Ga0137390_118414962 | 3300012363 | Vadose Zone Soil | MSEMSDRLLRGYQAQEKRFVERRFPLHFQPENPVIRELYSQSKGLRWNPVKDIAWNR |
| Ga0134048_10613112 | 3300012400 | Grasslands Soil | MSETSDHAARLLRAYQAQEKRFVERRFPLQFAPEVPAIRELYSQAKGLRWNPETDIP |
| Ga0137394_101096385 | 3300012922 | Vadose Zone Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLSFAPEVPALRELYSQAKGLRWNPETDIAWG |
| Ga0137394_111749142 | 3300012922 | Vadose Zone Soil | LSETREHAARLLRGYQAQEKRFVERRFPLEFAPEVPALRELYSQSKGLHW |
| Ga0137404_100534554 | 3300012929 | Vadose Zone Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLEFAPEVPALRELYSQAKGFHWNPET |
| Ga0137404_107459591 | 3300012929 | Vadose Zone Soil | MSETSESHAARLLRAYQAQEKRFVERRFPLQFAPEVPAIRELYSQAKG |
| Ga0153915_113127293 | 3300012931 | Freshwater Wetlands | MSETSDRLLRGYQAQEKRFLERRFPLRFTTENPILRELYHQ |
| Ga0126375_106458942 | 3300012948 | Tropical Forest Soil | MSETSEYAARLLRAYQAQEKRFVERRFPLEFAPEVP |
| Ga0126369_121131391 | 3300012971 | Tropical Forest Soil | VAELSVAMGEPHEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGLHWNPE |
| Ga0134077_104796462 | 3300012972 | Grasslands Soil | MSETSEHAARLLSAYQAQEKRFVERRFPLSFAPEVPALRELYSQAKGLRWNPE |
| Ga0164309_101233252 | 3300012984 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFTTESPVV |
| Ga0157373_105173162 | 3300013100 | Corn Rhizosphere | MSETSEHAARLLRAYQAQEQRFVERRFPLQFAPEVPVLRELYSQAKAFHWNP |
| Ga0157378_117329521 | 3300013297 | Miscanthus Rhizosphere | MTETSDQLLRGYQAQEKRFVERRFPLHFEPESPAIRELYSQSKGFRWNPTEDIA |
| Ga0137418_1000087731 | 3300015241 | Vadose Zone Soil | MSETSEPHAARLLRAYQAQEKRFVERRFPLQFAPEVPAIRE |
| Ga0132258_101580451 | 3300015371 | Arabidopsis Rhizosphere | VTDSPARAGADRLLRAYQAQERRFTERRFPLRFVPEVPAIRELYSQAKGLRWNPETD |
| Ga0132256_1000804015 | 3300015372 | Arabidopsis Rhizosphere | MSDSREHADRLLRAYQAQEKRFVERRFPLEFAPEVPVLRELYSQGKG |
| Ga0132256_1013634841 | 3300015372 | Arabidopsis Rhizosphere | MSETSEHAARLLRAYQAQEQRFVERRFPLQFAPEVPVLR |
| Ga0132257_1001786971 | 3300015373 | Arabidopsis Rhizosphere | MSETREHAARLLRAYQAQEKRFIERRFPLQFALEVPALRELYSQAKGLH |
| Ga0132257_1034161672 | 3300015373 | Arabidopsis Rhizosphere | VTDAAARASADRLLRAYQAQERRFVERRFPLRFVPEVPAIRELYSQAKGLRWNPETDIAW |
| Ga0132255_1019584182 | 3300015374 | Arabidopsis Rhizosphere | MTETSDRLLRGYQAQEKRFVERRFPLHFEPESPAIRELYSQSK |
| Ga0134112_104770461 | 3300017656 | Grasslands Soil | MSETSDHGARLLRAYQAQEKRFVERRFPLEFAPEVPALRELYSQAKGLRWNP |
| Ga0134083_102648741 | 3300017659 | Grasslands Soil | MSETGEHATRLLRAYQAQEKRFVERRFPLEFATEVPALRELYSQSKG |
| Ga0187777_107330071 | 3300017974 | Tropical Peatland | MSERLLRAYQEQERRFVERRFPLRFEPEVPAIREL |
| Ga0187773_107048081 | 3300018064 | Tropical Peatland | VSQAGGDAARLLRAYQAQEKRFVERRFPLRFAPEVPAIRELYSQAKGFRWN |
| Ga0066655_100729371 | 3300018431 | Grasslands Soil | MSETREHAARLLRAYQEQEKRFVERRFPLEFAPEVPVLRELYSQSKGLHWNP |
| Ga0066662_101110111 | 3300018468 | Grasslands Soil | MSETREHAARLLRAYQEQEKRFVERRFPLEFAPEVPVLRELYSQSK |
| Ga0066669_116544822 | 3300018482 | Grasslands Soil | VTHATEPSGAEPSLRAYQAQERRFVERRFPLRFEPEVPALRELYSQAKALRWN |
| Ga0173479_102578082 | 3300019362 | Soil | MSETSDELLRGFQAQEKRFVEQRFPLRFAPENRTRAPFELG |
| Ga0193718_10908051 | 3300019999 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFTTENPILRE |
| Ga0193732_10113493 | 3300020012 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFTTENPILRELYGQAKGLRWNPEIDIVWSRFDP |
| Ga0187846_102199412 | 3300021476 | Biofilm | MNQTSDSHVARLLGAYQAQEKRFVGRRFPLEFAPEV |
| Ga0210409_100916004 | 3300021559 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFTTENPILRELYAQAKGLRWNP |
| Ga0247793_10384131 | 3300023066 | Soil | MSETSDQLLRGFQAQEKRFLERRFPLRFASENPTLRELYRQAKRLRWNP |
| Ga0207697_104429061 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETSDRLLRGYQAQEKRFRERRFPLRFTTESPVVRELYRQAKGMRWNPETDVGWSRFD |
| Ga0210131_10190903 | 3300025551 | Natural And Restored Wetlands | MSETSDRLLRGYQAQEKRFVERRFPLHFEPESPAIRELYSQAKGFRWNPTED |
| Ga0210108_10565203 | 3300025560 | Natural And Restored Wetlands | MTETSDRLLRGYQAQEKRFVERRFPLHFEPESPAIRELYSQAKGFRWNPTEDIAW |
| Ga0207684_110931051 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETSDELLRGFQAQEKRFVERRFPLRFAPESPALRELYAQ |
| Ga0207707_105415451 | 3300025912 | Corn Rhizosphere | MSETSDRLLRGYQAQEKRFLERRFPLRFASENPTLRELYRQAKRFR |
| Ga0207693_103611861 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETSDRLLRGYQAQEKRFLERRFPLRFTTENPILREL |
| Ga0207646_108465801 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETSDRLLRGYQAQEKRFLERRFPLRFTTENPILRELYGQAKGLRWNP |
| Ga0207681_101620061 | 3300025923 | Switchgrass Rhizosphere | MSETSDELLRGFQAQEKRFVERRFPLRFAPESPALR |
| Ga0207706_112761092 | 3300025933 | Corn Rhizosphere | MSETSDELLRGFQAQEKRFVEQRFPLRFAPENPVLRELYAQGKGLRWNPETDIAWGR |
| Ga0207691_106687202 | 3300025940 | Miscanthus Rhizosphere | MSETSDRLLRGYQAQEKRFRERRFPLRFTTESPVVRELYRQAKGMRWNP |
| Ga0207691_114536422 | 3300025940 | Miscanthus Rhizosphere | MSETSDRLLRGYQAQEKRFLERRFPLRFASENPTLRELYRQAK |
| Ga0207661_104871631 | 3300025944 | Corn Rhizosphere | MSETSDRLLRGYQAQEKRFRERRFPLRSTTESPVVR |
| Ga0210089_10126272 | 3300025957 | Natural And Restored Wetlands | MSETSDRLLRGYQAQEKRFVERRFPLRFASENPTLRELYRQAKGFRWN |
| Ga0207712_111694851 | 3300025961 | Switchgrass Rhizosphere | MTWANDRDQEFSVPLLRAYQAQEKRFVERRFPLEFA |
| Ga0207640_107550612 | 3300025981 | Corn Rhizosphere | MSETSDRLLRGYQAQEKRFLERRFPLRFASENPTVR |
| Ga0207658_112526471 | 3300025986 | Switchgrass Rhizosphere | MSETSEHAARLLRAYQAQEQRFVERRFPLQFAPEVPVLRELY |
| Ga0207708_105938832 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETSDELLRGFQAQEKRFVEQRFPLRFAPENPALRELYAQGKGLRWNPETDIAWGRFDPAAYERPVRE |
| Ga0207708_113944481 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MSETSDRLLRGFQAQEKRFLERRFPLRFASENPTLRELYRQAKRLR |
| Ga0207641_104301521 | 3300026088 | Switchgrass Rhizosphere | MSETSDRLLRGYQAQEKRFRERRFPLRFTTESPVVRELYRQAKGMRWNPETDVGWSRFDA |
| Ga0207675_1022494121 | 3300026118 | Switchgrass Rhizosphere | MSDTREHAARLLRAYQAQEKRFVERRFPLEFAPEVPVLRELYSQGKGLHWNPETDIAWDR |
| Ga0209235_10646251 | 3300026296 | Grasslands Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPAIRELYSQ |
| Ga0209469_10142781 | 3300026307 | Soil | MSETSEHAARLLSAYQAQEKRFVERRFPLSFAPEVPALRELYSQAKGLRWNPETDVAWD |
| Ga0257169_10127753 | 3300026469 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFAPENPTLRELYSQAKGLRWNPETDITWSRFDP |
| Ga0257147_10285232 | 3300026475 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFATENPTLRELYRQAKALRWNPETDVAWS |
| Ga0257158_10302731 | 3300026515 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFTTENPILRELYGQAKGLRWNPEIDIV |
| Ga0209690_11118601 | 3300026524 | Soil | MSETREHAARLLRAYQEQEKRFVERRFPLEFAPEVPVLRELY |
| Ga0209807_11900071 | 3300026530 | Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALR |
| Ga0209160_12494021 | 3300026532 | Soil | MSETGEHATRLLRAYQAQEKRFVERRFPLEFATEV |
| Ga0209474_102528303 | 3300026550 | Soil | MSETSEPHAARLLRAYQAQEKRFVERRFPLQFAPEVPAIRELHS |
| Ga0207441_1045091 | 3300026793 | Soil | MSETSDQLLRGFQAQEKRFLERRFPLRFASENPTLRELYRQAKRLRWN |
| Ga0209466_10749041 | 3300027646 | Tropical Forest Soil | MSETSEHAARLLSAYQAQEKRFVEQRFPLSFAPEVPALRELYSQAKGLRWNPETDIAWG |
| Ga0209177_101243022 | 3300027775 | Agricultural Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFTTESPVVRELYRQA |
| Ga0209074_105341161 | 3300027787 | Agricultural Soil | MSETSDRLLRGYQAQEKRFRERRFPLRFTTESPVVRELYRQAK |
| Ga0209811_101673672 | 3300027821 | Surface Soil | MSESREHAARLLRAYQAQEKRFVEQRFPLQFAPEVPALRELYSQAKGLHWNPETDIAWDR |
| Ga0209814_103536651 | 3300027873 | Populus Rhizosphere | MSQTSDHAARLLRAYQAQERRFVERRFPLQFAPEVPALRELY |
| Ga0207428_106702792 | 3300027907 | Populus Rhizosphere | MGEGSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQA |
| Ga0268265_107669461 | 3300028380 | Switchgrass Rhizosphere | MSETREHAAQLLRAYQAQEKRFVEQRFPLQFAPEVPVLRELYSQAKGLHWNPETDIAWDR |
| Ga0247821_107326941 | 3300028596 | Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPVLRELYS |
| Ga0307301_100293903 | 3300028719 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFAPENPTLRELYSQAKGLRWN |
| Ga0307290_100863473 | 3300028791 | Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFAPENPTL |
| Ga0247825_105481222 | 3300028812 | Soil | MSETSDELLRGFQAQEKRFVEQRFPLRFAPENPALRELYAQSG |
| Ga0307498_101052921 | 3300031170 | Soil | MSEAREHAARLLRAYQAQEKRFVERRFPLEFAPEVPV |
| Ga0310888_102293573 | 3300031538 | Soil | MSDTREHAARLLRAYQAQEKRFVERRFPLEFAPEVPVLRELYSQGKGLHWNPETDIAW |
| Ga0318538_104523972 | 3300031546 | Soil | MSEVPEHPARLLRAYQAQEKRFVERRFPLEFAPEVPALRELYSQGKGLRWNP |
| Ga0310887_100226781 | 3300031547 | Soil | MSAESDHTARLLRAYQAQEKRFVERRFPLEFAPEVPAL |
| Ga0307469_109867462 | 3300031720 | Hardwood Forest Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFTTENPILRELYGQA |
| Ga0307468_1001932763 | 3300031740 | Hardwood Forest Soil | MSETSDQLLRGFQAQEKRFVERRFPLRFASENPTLREL |
| Ga0307468_1013641392 | 3300031740 | Hardwood Forest Soil | MSETSDRLLRGYQAQEKRFLERRFPLRFAPENPTLRELYSQAKGLR |
| Ga0318494_109065332 | 3300031751 | Soil | VATGEPHEHAARLLRAYQAQEKRFVERRFPLQFAPE |
| Ga0318509_105430921 | 3300031768 | Soil | MSDAREHAARLLRAYQAQEKRFVERRFPLEFAPEVPVLRELYS |
| Ga0318557_104279181 | 3300031795 | Soil | MSDAREHAARLLRAYQAQEKRFVERRFPLEFAPEVPVLRELYSQGKGLHWNPETDIAWAR |
| Ga0318495_100262013 | 3300031860 | Soil | MSEVPEHPARLLRAYQAQEKRFVERRFPLEFAPEVPALREL |
| Ga0318495_101145371 | 3300031860 | Soil | MSDAREHAARLLRAYQAQEKRFVERRFPLEFAPEVPVLRELYSQGKGLHWN |
| Ga0310891_100818493 | 3300031913 | Soil | MSDTREHAARLLRAYQAQEKRFVERRFPLEFAPEVPVLRELYSQGK |
| Ga0310897_103939391 | 3300032003 | Soil | MSDTREHAARLLRAYQAQEKRFVERRFPLEFAPEVPVLRELYSQG |
| Ga0310899_102006303 | 3300032017 | Soil | MSDTREHAARLLRAYQAQEKRFVERRFPLEFAPEVPVLRELYSQGKGLHW |
| Ga0318556_103351461 | 3300032043 | Soil | VATGEPHEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQA |
| Ga0318506_103859431 | 3300032052 | Soil | VATGEPHEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELY |
| Ga0307415_1016634942 | 3300032126 | Rhizosphere | MSGMSDRHGSERLLDAYQAQEKRFVERRFPLQFEPEVPAIRELYSQAKGFRWNPE |
| Ga0307470_106950062 | 3300032174 | Hardwood Forest Soil | MSEARDHATRLLRAYQAQEKRFVERRFPLEFAPEVPVLRELYSQSKGLHWNPETDI |
| Ga0307470_110219831 | 3300032174 | Hardwood Forest Soil | MPWHMGSTSEHAERLLRAYQAQEKRFVERRFPLQFAPEVPALRELYS |
| Ga0307471_1000781631 | 3300032180 | Hardwood Forest Soil | VSETGEHAARLLAAYQAQEVKFVERRFPLRFAPEVPAL |
| Ga0307471_1005858303 | 3300032180 | Hardwood Forest Soil | LSEVTDAHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGFRWNPE |
| Ga0307471_1009140411 | 3300032180 | Hardwood Forest Soil | MSETSEHAARLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKGLHWNPETD |
| Ga0335084_106312113 | 3300033004 | Soil | MPWHMASTGEHAERLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKAFHWNP |
| Ga0335084_121357432 | 3300033004 | Soil | MASTGEHAERLLRAYQAQEKRFVERRFPLQFAPEVPALRELYSQAKAF |
| Ga0326726_119170401 | 3300033433 | Peat Soil | MSETSDELLRGFQAQEKRFVERRFPLRFAPESPALRELYAQAKGLRWNP |
| Ga0247829_110075091 | 3300033550 | Soil | MSETSDELLRGFQAQEKRFVEQRFPLRFAPENPVLRELYAQGKG |
| ⦗Top⦘ |