| Basic Information | |
|---|---|
| Family ID | F026623 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 41 residues |
| Representative Sequence | VFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.03 % |
| % of genes near scaffold ends (potentially truncated) | 94.42 % |
| % of genes from short scaffolds (< 2000 bps) | 83.76 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.59 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (78.173 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.228 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.843 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.685 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 41.79% β-sheet: 0.00% Coil/Unstructured: 58.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.59 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF07929 | PRiA4_ORF3 | 12.18 |
| PF02371 | Transposase_20 | 4.06 |
| PF12697 | Abhydrolase_6 | 2.03 |
| PF10056 | DUF2293 | 2.03 |
| PF13620 | CarboxypepD_reg | 1.52 |
| PF12704 | MacB_PCD | 1.52 |
| PF13557 | Phenol_MetA_deg | 1.52 |
| PF14534 | DUF4440 | 1.02 |
| PF02897 | Peptidase_S9_N | 1.02 |
| PF09286 | Pro-kuma_activ | 1.02 |
| PF07676 | PD40 | 1.02 |
| PF07589 | PEP-CTERM | 1.02 |
| PF14312 | FG-GAP_2 | 1.02 |
| PF00589 | Phage_integrase | 1.02 |
| PF01740 | STAS | 1.02 |
| PF08281 | Sigma70_r4_2 | 1.02 |
| PF08031 | BBE | 0.51 |
| PF13282 | DUF4070 | 0.51 |
| PF14300 | DUF4375 | 0.51 |
| PF00144 | Beta-lactamase | 0.51 |
| PF13650 | Asp_protease_2 | 0.51 |
| PF13181 | TPR_8 | 0.51 |
| PF02517 | Rce1-like | 0.51 |
| PF00480 | ROK | 0.51 |
| PF13520 | AA_permease_2 | 0.51 |
| PF00069 | Pkinase | 0.51 |
| PF02687 | FtsX | 0.51 |
| PF08241 | Methyltransf_11 | 0.51 |
| PF00753 | Lactamase_B | 0.51 |
| PF07883 | Cupin_2 | 0.51 |
| PF12893 | Lumazine_bd_2 | 0.51 |
| PF07244 | POTRA | 0.51 |
| PF13669 | Glyoxalase_4 | 0.51 |
| PF13442 | Cytochrome_CBB3 | 0.51 |
| PF12867 | DinB_2 | 0.51 |
| PF13924 | Lipocalin_5 | 0.51 |
| PF03807 | F420_oxidored | 0.51 |
| PF13419 | HAD_2 | 0.51 |
| PF12833 | HTH_18 | 0.51 |
| PF13408 | Zn_ribbon_recom | 0.51 |
| PF00106 | adh_short | 0.51 |
| PF13519 | VWA_2 | 0.51 |
| PF03795 | YCII | 0.51 |
| PF05016 | ParE_toxin | 0.51 |
| PF00583 | Acetyltransf_1 | 0.51 |
| PF12158 | DUF3592 | 0.51 |
| PF07228 | SpoIIE | 0.51 |
| PF13020 | NOV_C | 0.51 |
| PF00903 | Glyoxalase | 0.51 |
| PF03572 | Peptidase_S41 | 0.51 |
| PF13840 | ACT_7 | 0.51 |
| PF03459 | TOBE | 0.51 |
| PF13565 | HTH_32 | 0.51 |
| PF03544 | TonB_C | 0.51 |
| PF01494 | FAD_binding_3 | 0.51 |
| PF04191 | PEMT | 0.51 |
| PF13429 | TPR_15 | 0.51 |
| PF14559 | TPR_19 | 0.51 |
| PF00266 | Aminotran_5 | 0.51 |
| PF04978 | DUF664 | 0.51 |
| PF12706 | Lactamase_B_2 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 4.06 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.03 |
| COG4934 | Serine protease, subtilase family | Posttranslational modification, protein turnover, chaperones [O] | 1.02 |
| COG1940 | Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domain | Transcription [K] | 1.02 |
| COG1770 | Protease II | Amino acid transport and metabolism [E] | 1.02 |
| COG1505 | Prolyl endopeptidase PreP, S9A serine peptidase family | Amino acid transport and metabolism [E] | 1.02 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.02 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.51 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.51 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.51 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.51 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.51 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.51 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.51 |
| COG0277 | FAD/FMN-containing lactate dehydrogenase/glycolate oxidase | Energy production and conversion [C] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 78.17 % |
| Unclassified | root | N/A | 21.83 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2070309004|prs_FIHLEPW02TKICV | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
| 2189573001|GZR05M102JYVB3 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 2228664022|INPgaii200_c0799681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 723 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_100246137 | Not Available | 612 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101005047 | Not Available | 540 | Open in IMG/M |
| 3300000651|AP72_2010_repI_A10DRAFT_1007873 | Not Available | 1417 | Open in IMG/M |
| 3300000789|JGI1027J11758_12143534 | Not Available | 563 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10345051 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 605 | Open in IMG/M |
| 3300004091|Ga0062387_100393592 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
| 3300005174|Ga0066680_10209736 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1232 | Open in IMG/M |
| 3300005336|Ga0070680_100374998 | All Organisms → cellular organisms → Bacteria | 1211 | Open in IMG/M |
| 3300005436|Ga0070713_100079109 | All Organisms → cellular organisms → Bacteria | 2800 | Open in IMG/M |
| 3300005439|Ga0070711_101576162 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300005447|Ga0066689_10636881 | Not Available | 670 | Open in IMG/M |
| 3300005468|Ga0070707_100215599 | All Organisms → cellular organisms → Bacteria | 1870 | Open in IMG/M |
| 3300005518|Ga0070699_100539323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1061 | Open in IMG/M |
| 3300005542|Ga0070732_10463578 | All Organisms → cellular organisms → Bacteria | 766 | Open in IMG/M |
| 3300005557|Ga0066704_10825902 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300005559|Ga0066700_10194749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1397 | Open in IMG/M |
| 3300005560|Ga0066670_10638058 | Not Available | 647 | Open in IMG/M |
| 3300005561|Ga0066699_10253713 | All Organisms → cellular organisms → Bacteria | 1242 | Open in IMG/M |
| 3300005591|Ga0070761_10423399 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
| 3300005591|Ga0070761_10739270 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Sphaerotilus → Sphaerotilus natans | 617 | Open in IMG/M |
| 3300005602|Ga0070762_10101781 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1664 | Open in IMG/M |
| 3300005602|Ga0070762_10183661 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300005610|Ga0070763_10252806 | Not Available | 956 | Open in IMG/M |
| 3300005610|Ga0070763_10731090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
| 3300005764|Ga0066903_103667423 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 826 | Open in IMG/M |
| 3300005921|Ga0070766_10967205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300005921|Ga0070766_11087072 | Not Available | 552 | Open in IMG/M |
| 3300005994|Ga0066789_10012182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 3805 | Open in IMG/M |
| 3300006046|Ga0066652_101329074 | All Organisms → cellular organisms → Bacteria | 677 | Open in IMG/M |
| 3300006052|Ga0075029_100193622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1267 | Open in IMG/M |
| 3300006086|Ga0075019_10063234 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
| 3300006102|Ga0075015_100055540 | Not Available | 1887 | Open in IMG/M |
| 3300006162|Ga0075030_100985367 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
| 3300006176|Ga0070765_100300976 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300006176|Ga0070765_100874370 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300006642|Ga0075521_10680594 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300007258|Ga0099793_10138962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1146 | Open in IMG/M |
| 3300009029|Ga0066793_10177328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1242 | Open in IMG/M |
| 3300009038|Ga0099829_11232489 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 619 | Open in IMG/M |
| 3300009088|Ga0099830_11470482 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300009089|Ga0099828_11057236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 722 | Open in IMG/M |
| 3300009090|Ga0099827_10513881 | All Organisms → cellular organisms → Bacteria | 1030 | Open in IMG/M |
| 3300009518|Ga0116128_1043675 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1436 | Open in IMG/M |
| 3300009521|Ga0116222_1346951 | Not Available | 644 | Open in IMG/M |
| 3300009521|Ga0116222_1419287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300009616|Ga0116111_1143903 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009630|Ga0116114_1054305 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 1123 | Open in IMG/M |
| 3300009631|Ga0116115_1063373 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 969 | Open in IMG/M |
| 3300009646|Ga0116132_1086999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 968 | Open in IMG/M |
| 3300009700|Ga0116217_10625957 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300009764|Ga0116134_1150619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300010323|Ga0134086_10178066 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 786 | Open in IMG/M |
| 3300010329|Ga0134111_10188614 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 829 | Open in IMG/M |
| 3300010341|Ga0074045_10140236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1648 | Open in IMG/M |
| 3300010343|Ga0074044_10007148 | All Organisms → cellular organisms → Bacteria | 8836 | Open in IMG/M |
| 3300010343|Ga0074044_10055550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2705 | Open in IMG/M |
| 3300010343|Ga0074044_10811924 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 611 | Open in IMG/M |
| 3300010358|Ga0126370_10185870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1555 | Open in IMG/M |
| 3300010358|Ga0126370_11348491 | Not Available | 671 | Open in IMG/M |
| 3300010360|Ga0126372_11622872 | Not Available | 686 | Open in IMG/M |
| 3300010361|Ga0126378_10994164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 943 | Open in IMG/M |
| 3300010362|Ga0126377_10196654 | All Organisms → cellular organisms → Bacteria | 1929 | Open in IMG/M |
| 3300010397|Ga0134124_11135501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 799 | Open in IMG/M |
| 3300010398|Ga0126383_10255933 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 1721 | Open in IMG/M |
| 3300011269|Ga0137392_10625126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 893 | Open in IMG/M |
| 3300011269|Ga0137392_11342824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 574 | Open in IMG/M |
| 3300011270|Ga0137391_10206977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1705 | Open in IMG/M |
| 3300011270|Ga0137391_10836505 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300011271|Ga0137393_10065272 | All Organisms → cellular organisms → Bacteria | 2886 | Open in IMG/M |
| 3300011271|Ga0137393_10186788 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
| 3300012189|Ga0137388_10060247 | Not Available | 3119 | Open in IMG/M |
| 3300012200|Ga0137382_11049982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 583 | Open in IMG/M |
| 3300012202|Ga0137363_10609864 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 922 | Open in IMG/M |
| 3300012205|Ga0137362_10222218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1629 | Open in IMG/M |
| 3300012208|Ga0137376_10804658 | All Organisms → cellular organisms → Bacteria | 809 | Open in IMG/M |
| 3300012354|Ga0137366_10648881 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300012359|Ga0137385_11133495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300012363|Ga0137390_10330256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1506 | Open in IMG/M |
| 3300012683|Ga0137398_10321899 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1043 | Open in IMG/M |
| 3300012683|Ga0137398_10491761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 843 | Open in IMG/M |
| 3300012917|Ga0137395_10504221 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300012917|Ga0137395_11255083 | Not Available | 515 | Open in IMG/M |
| 3300012918|Ga0137396_10800335 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300012927|Ga0137416_10511469 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1035 | Open in IMG/M |
| 3300012930|Ga0137407_10285000 | Not Available | 1506 | Open in IMG/M |
| 3300012977|Ga0134087_10214125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 868 | Open in IMG/M |
| 3300012989|Ga0164305_10054895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2353 | Open in IMG/M |
| 3300013297|Ga0157378_11965984 | Not Available | 634 | Open in IMG/M |
| 3300014165|Ga0181523_10142983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1413 | Open in IMG/M |
| 3300015241|Ga0137418_10046732 | All Organisms → cellular organisms → Bacteria | 3983 | Open in IMG/M |
| 3300015264|Ga0137403_10210030 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1874 | Open in IMG/M |
| 3300015371|Ga0132258_12440080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1309 | Open in IMG/M |
| 3300015371|Ga0132258_13974981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1004 | Open in IMG/M |
| 3300016270|Ga0182036_10041055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2839 | Open in IMG/M |
| 3300016270|Ga0182036_10449926 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1012 | Open in IMG/M |
| 3300016270|Ga0182036_11159146 | Not Available | 642 | Open in IMG/M |
| 3300016319|Ga0182033_10930118 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300016341|Ga0182035_10146794 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1805 | Open in IMG/M |
| 3300016357|Ga0182032_10919936 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300016422|Ga0182039_10300890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1329 | Open in IMG/M |
| 3300016730|Ga0181515_1155980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1362 | Open in IMG/M |
| 3300017822|Ga0187802_10226345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 721 | Open in IMG/M |
| 3300017929|Ga0187849_1020405 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3744 | Open in IMG/M |
| 3300017946|Ga0187879_10774350 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 535 | Open in IMG/M |
| 3300017995|Ga0187816_10183009 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 910 | Open in IMG/M |
| 3300017995|Ga0187816_10193163 | Not Available | 884 | Open in IMG/M |
| 3300018003|Ga0187876_1233161 | Not Available | 606 | Open in IMG/M |
| 3300018006|Ga0187804_10193552 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 867 | Open in IMG/M |
| 3300018006|Ga0187804_10476081 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300018006|Ga0187804_10579422 | Not Available | 509 | Open in IMG/M |
| 3300018012|Ga0187810_10039923 | All Organisms → cellular organisms → Bacteria | 1747 | Open in IMG/M |
| 3300018012|Ga0187810_10388461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 585 | Open in IMG/M |
| 3300018015|Ga0187866_1077869 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1420 | Open in IMG/M |
| 3300018017|Ga0187872_10110443 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium | 1362 | Open in IMG/M |
| 3300018022|Ga0187864_10088387 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
| 3300018022|Ga0187864_10157055 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1118 | Open in IMG/M |
| 3300018032|Ga0187788_10166701 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 838 | Open in IMG/M |
| 3300018033|Ga0187867_10327618 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 855 | Open in IMG/M |
| 3300018038|Ga0187855_10817006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 544 | Open in IMG/M |
| 3300018043|Ga0187887_10013654 | All Organisms → cellular organisms → Bacteria | 5381 | Open in IMG/M |
| 3300018043|Ga0187887_10079093 | All Organisms → cellular organisms → Bacteria | 1992 | Open in IMG/M |
| 3300018064|Ga0187773_10117187 | All Organisms → cellular organisms → Bacteria → Elusimicrobia → Elusimicrobia | 1334 | Open in IMG/M |
| 3300019879|Ga0193723_1055334 | Not Available | 1161 | Open in IMG/M |
| 3300019888|Ga0193751_1057240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1648 | Open in IMG/M |
| 3300020579|Ga0210407_10032118 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 3905 | Open in IMG/M |
| 3300020583|Ga0210401_10116093 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2511 | Open in IMG/M |
| 3300021046|Ga0215015_10508130 | Not Available | 526 | Open in IMG/M |
| 3300021088|Ga0210404_10909495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| 3300021180|Ga0210396_11196586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 636 | Open in IMG/M |
| 3300021401|Ga0210393_10090120 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2435 | Open in IMG/M |
| 3300021403|Ga0210397_10137486 | Not Available | 1694 | Open in IMG/M |
| 3300021403|Ga0210397_11220704 | Not Available | 584 | Open in IMG/M |
| 3300021420|Ga0210394_11811018 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300021559|Ga0210409_10426132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1185 | Open in IMG/M |
| 3300021559|Ga0210409_10510495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1066 | Open in IMG/M |
| 3300021560|Ga0126371_10944851 | Not Available | 1005 | Open in IMG/M |
| 3300021560|Ga0126371_11432706 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 821 | Open in IMG/M |
| 3300022712|Ga0242653_1018599 | Not Available | 949 | Open in IMG/M |
| 3300024233|Ga0224521_1121068 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 558 | Open in IMG/M |
| 3300025432|Ga0208821_1039775 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300025444|Ga0208189_1005269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3755 | Open in IMG/M |
| 3300025506|Ga0208937_1005021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3752 | Open in IMG/M |
| 3300025878|Ga0209584_10032987 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1794 | Open in IMG/M |
| 3300025906|Ga0207699_10994272 | Not Available | 620 | Open in IMG/M |
| 3300025906|Ga0207699_11303256 | Not Available | 537 | Open in IMG/M |
| 3300025916|Ga0207663_11242125 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 600 | Open in IMG/M |
| 3300025916|Ga0207663_11748784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300025917|Ga0207660_10322992 | Not Available | 1233 | Open in IMG/M |
| 3300025922|Ga0207646_10250315 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
| 3300025922|Ga0207646_10468012 | Not Available | 1137 | Open in IMG/M |
| 3300025927|Ga0207687_11919634 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300026328|Ga0209802_1158245 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
| 3300026497|Ga0257164_1002684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1755 | Open in IMG/M |
| 3300026551|Ga0209648_10131994 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1998 | Open in IMG/M |
| 3300027497|Ga0208199_1071905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 725 | Open in IMG/M |
| 3300027575|Ga0209525_1151988 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 529 | Open in IMG/M |
| 3300027696|Ga0208696_1014981 | All Organisms → cellular organisms → Bacteria | 3024 | Open in IMG/M |
| 3300027862|Ga0209701_10089395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1934 | Open in IMG/M |
| 3300027895|Ga0209624_10481408 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 827 | Open in IMG/M |
| 3300027898|Ga0209067_10037744 | Not Available | 2460 | Open in IMG/M |
| 3300027898|Ga0209067_10053976 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2052 | Open in IMG/M |
| 3300027908|Ga0209006_11466906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae | 518 | Open in IMG/M |
| 3300027910|Ga0209583_10600214 | Not Available | 560 | Open in IMG/M |
| 3300027911|Ga0209698_10099194 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2440 | Open in IMG/M |
| 3300028047|Ga0209526_10042236 | All Organisms → cellular organisms → Bacteria | 3208 | Open in IMG/M |
| 3300028381|Ga0268264_11638161 | Not Available | 654 | Open in IMG/M |
| 3300028536|Ga0137415_10287448 | All Organisms → cellular organisms → Bacteria | 1449 | Open in IMG/M |
| 3300028906|Ga0308309_10195601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1663 | Open in IMG/M |
| 3300029987|Ga0311334_10726974 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 813 | Open in IMG/M |
| 3300029990|Ga0311336_10055379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 3075 | Open in IMG/M |
| 3300030007|Ga0311338_11719312 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300030646|Ga0302316_10474814 | Not Available | 500 | Open in IMG/M |
| 3300031128|Ga0170823_17325343 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300031247|Ga0265340_10276913 | Not Available | 746 | Open in IMG/M |
| 3300031474|Ga0170818_112529435 | Not Available | 530 | Open in IMG/M |
| 3300031715|Ga0307476_10090336 | All Organisms → cellular organisms → Bacteria | 2149 | Open in IMG/M |
| 3300031719|Ga0306917_10096423 | Not Available | 2112 | Open in IMG/M |
| 3300031754|Ga0307475_10071494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2653 | Open in IMG/M |
| 3300031823|Ga0307478_10957166 | Not Available | 716 | Open in IMG/M |
| 3300031910|Ga0306923_10273256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1933 | Open in IMG/M |
| 3300031962|Ga0307479_10032115 | All Organisms → cellular organisms → Bacteria | 5006 | Open in IMG/M |
| 3300031962|Ga0307479_10402533 | Not Available | 1353 | Open in IMG/M |
| 3300032174|Ga0307470_10184719 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1315 | Open in IMG/M |
| 3300032180|Ga0307471_100203848 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300032205|Ga0307472_101926745 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300032205|Ga0307472_102209800 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 555 | Open in IMG/M |
| 3300032770|Ga0335085_10080023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4292 | Open in IMG/M |
| 3300032783|Ga0335079_10209035 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2162 | Open in IMG/M |
| 3300032828|Ga0335080_11822526 | Not Available | 593 | Open in IMG/M |
| 3300032897|Ga0335071_10003581 | All Organisms → cellular organisms → Bacteria | 16297 | Open in IMG/M |
| 3300033158|Ga0335077_11086163 | All Organisms → cellular organisms → Bacteria | 792 | Open in IMG/M |
| 3300034820|Ga0373959_0009913 | Not Available | 1654 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.23% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.60% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.09% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 5.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.08% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.57% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.57% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.57% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.06% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 4.06% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.06% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.54% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.03% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.03% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.52% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.02% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.02% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.02% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.02% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 1.02% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.02% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.51% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.51% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.51% |
| Green-Waste Compost | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.51% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2070309004 | Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto Rico | Environmental | Open in IMG/M |
| 2189573001 | Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
| 2228664022 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000651 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10 | Environmental | Open in IMG/M |
| 3300000789 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006642 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009616 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009631 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 | Environmental | Open in IMG/M |
| 3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016730 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018038 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022712 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024233 | Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0 | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026497 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-B | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027575 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029987 | I_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| prs_02891970 | 2070309004 | Green-Waste Compost | VFGKLLYEGRISEEDLSGLRDDKLKSIRSLAKFLAEDTAA |
| FD2_05185830 | 2189573001 | Grass Soil | LFGRLLHERRLSEQELRELREDKLKSIRSFAKFLAGMDAIA |
| INPgaii200_07996813 | 2228664022 | Soil | FGRLLYETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA |
| INPhiseqgaiiFebDRAFT_1002461371 | 3300000364 | Soil | TAPRLNDVLGRLLYENRLGEEDLCGLREDKLKSIRSCAQFLAKYAA* |
| INPhiseqgaiiFebDRAFT_1010050472 | 3300000364 | Soil | VFGRLLSEGRVSEKELRGLGEDKPNVVRSCAKILSEDPA* |
| AP72_2010_repI_A10DRAFT_10078731 | 3300000651 | Forest Soil | HLTQVFGRLLYETRVSEEELRGFSEDKLMTIHSFARFLAEDVA* |
| JGI1027J11758_121435342 | 3300000789 | Soil | LLYEKRLSDEDLRDVGHDKLRLIRSFAQFLTEDAA* |
| JGIcombinedJ51221_103450512 | 3300003505 | Forest Soil | SQLTHVFGRLLYEGRVSEEELSGLREDKLKPIRSLAEFLAKDVA* |
| Ga0062387_1003935921 | 3300004091 | Bog Forest Soil | SQLTHVFGRLLYEKRLREEELRGLREDKLKSIRSFAKFLAEDAAA* |
| Ga0066680_102097363 | 3300005174 | Soil | SRLTHVFGRLLHERRLSEQELRGLREDELKPIRSSRNFLAETDAIA* |
| Ga0070680_1003749981 | 3300005336 | Corn Rhizosphere | YSQLTNVFGRLLYEKRISVDELSGLGENKLKPIRSLAELLTKDAAGLI* |
| Ga0070713_1000791094 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | VFGRLLHEKRLCEDELRGLREDKLEPIRTLAKFLAEDAA* |
| Ga0070711_1015761621 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LTQVFGRLLDEKRISEQELRGLREDKMKPIRSFAKFLAKTNAVA* |
| Ga0066689_106368811 | 3300005447 | Soil | VFGRLLYEKRLREEELRGLGEDKLKSIRSIAKFAAEMDAA* |
| Ga0070707_1002155991 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | YEYKYSQLTHVFGRLLHEQRLCEEELRGLREDKLTSIRSFAKFLSEDAAA* |
| Ga0070699_1005393231 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | EYKYSQLTHVFGRLLHEQRLCEEELRGLREDKLKSIRSFAKFLSEDAAA* |
| Ga0070732_104635782 | 3300005542 | Surface Soil | SHLTQVFGRLLYETRVSEEELRGFSQDKLKTIRSLAEFLADDAA* |
| Ga0066704_108259021 | 3300005557 | Soil | LTHVFGRLLHENRLREEELRGLGEHKLNSIRSLAKFLAEDAA* |
| Ga0066700_101947491 | 3300005559 | Soil | SQLTQVFGRLLYERRITEEDLRGLGEDKLKPIRSFAELLAKYAA* |
| Ga0066670_106380582 | 3300005560 | Soil | VFGTLLYEGRIREEELRGLREDKMKAIRSCADVLSENAA* |
| Ga0066699_102537133 | 3300005561 | Soil | LLHESRLSEEELRGLREDKLKSIRSFPKFLWETDAA* |
| Ga0070761_104233992 | 3300005591 | Soil | SHLTQVFGRLLYETRVREEELRGFSEDKLRTIRSLAKFLAEDAV* |
| Ga0070761_107392701 | 3300005591 | Soil | HVFGRLLYEGRVREEELRGLSDDKLKSIRSLAEFLAKYAD* |
| Ga0070762_101017812 | 3300005602 | Soil | VFGRLLYEKRLREEELRGLHEDKLNPIRSFAQFLAEDAA* |
| Ga0070762_101836613 | 3300005602 | Soil | VFGRLLYETRVSEEELRGFREDKLTTIRSLAKFLAEDAASWPAF* |
| Ga0070763_102528062 | 3300005610 | Soil | VFGKLLHEGRLREEELRGLREDKLEAIHSCAKFPARMDAA* |
| Ga0070763_107310901 | 3300005610 | Soil | RLLHEGRLKEQGLLGLDEDKLKSIRSIAQILAEDAA* |
| Ga0066903_1036674231 | 3300005764 | Tropical Forest Soil | RLLYETRVSEEALRGFSEDKLKTIHSFARFLAEDAA* |
| Ga0070766_109672051 | 3300005921 | Soil | VFGKLLHERRLGDEELRGLRENKLKSIRSYAKFLAEMDAA* |
| Ga0070766_110870721 | 3300005921 | Soil | YSQLTHVFGRLLYEKRLGEEELRGLREDKLKSIYSLAKFLAEDAA* |
| Ga0066789_100121822 | 3300005994 | Soil | MRFSGCESRLGEEELRGLREDKLKSIRSYAKFLAEMDAA* |
| Ga0066652_1013290741 | 3300006046 | Soil | VFGRLLYERRVSEEDLRGLREDKLKPIRLFAKFLAEDTAA* |
| Ga0075029_1001936222 | 3300006052 | Watersheds | LLYETRVSEEELRDFSKDKLKTIRSFAKFLAQDAA* |
| Ga0075019_100632343 | 3300006086 | Watersheds | GRLLYETRVSEEELRGFSKDKLKTIRSFAKFLAQDAA* |
| Ga0075015_1000555403 | 3300006102 | Watersheds | VLGRLLCEHRVSEEELRGLREDKLKAIHSCAQFLAEDAA* |
| Ga0075030_1009853671 | 3300006162 | Watersheds | RYSQLTNVFGRLLYENRLSEEELGGLREEKLKSIRSTAEFLAKEWT* |
| Ga0070765_1003009763 | 3300006176 | Soil | SQLTQVFGRLLYEGRLQEEELRGLRGDKLKLIRSFAKFLAEEAA* |
| Ga0070765_1008743701 | 3300006176 | Soil | QLTHVFGRLLYESRLSEGELHGLGEDKLKSIHSVAQFLAKYAA* |
| Ga0075521_106805942 | 3300006642 | Arctic Peat Soil | YETRVSEEELRGFSKDKLKTIRSLAKFLAEDTGA* |
| Ga0099793_101389622 | 3300007258 | Vadose Zone Soil | FGRLLYEMRLCEDELRRLGEDKLKPIRSFAKFLAEDAA* |
| Ga0066793_101773281 | 3300009029 | Prmafrost Soil | LLHEKRLREEDLRGLREDKLKSIRSLAKFLAEDAA* |
| Ga0099829_112324891 | 3300009038 | Vadose Zone Soil | LTHVFGRLLHEGRVSEEELRGLREDKLKPIRSFAKFLAEDTAA* |
| Ga0099830_114704822 | 3300009088 | Vadose Zone Soil | SQLTHVFGKLLYERRLREEELRGLGEDKLKSIRSVAQFLAKYAA* |
| Ga0099828_110572361 | 3300009089 | Vadose Zone Soil | LTQVFGRLLYEKRLGEEELGGLREDKLKSIRSFAQFLAEDTAA* |
| Ga0099827_105138811 | 3300009090 | Vadose Zone Soil | DYRYSQLTQVFGRLLYEKRLRQEELRGLREDKLKPIRAFAKFLAEDAA* |
| Ga0066709_1008810231 | 3300009137 | Grasslands Soil | DRRLSDQELRGLREDGLKPIRSSRDFLAETDAIA* |
| Ga0116128_10436753 | 3300009518 | Peatland | YSHLTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA* |
| Ga0116222_13469511 | 3300009521 | Peatlands Soil | LTDVFGRLVREGRLSEDELQGLGEDKLQSIRSYARLLAKLDEEA* |
| Ga0116222_14192871 | 3300009521 | Peatlands Soil | DYRYSRLTHVFGKLLYEGRLREEELRGLREDKLNSIRSVAQFLAKYAA* |
| Ga0116111_11439032 | 3300009616 | Peatland | RYSQLTQVFGRLLYEKRLREEELRGLREDKLKPIRSLAKFLAEDAA* |
| Ga0116114_10543052 | 3300009630 | Peatland | VFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA* |
| Ga0116115_10633733 | 3300009631 | Peatland | HLTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA* |
| Ga0116132_10869991 | 3300009646 | Peatland | VFGKLLHEKRLREEDLRGLREDKLKSIRSVAKFLAEDTAA* |
| Ga0116217_106259572 | 3300009700 | Peatlands Soil | FGRLLHEGRLREEELRGLREDKLKSIRSFAKFLAEDTAA* |
| Ga0116134_11506191 | 3300009764 | Peatland | QLTQVFGRLLYEKRLGEEELAGLGEDKLKSIRSCAKFLAEDTAA* |
| Ga0134086_101780661 | 3300010323 | Grasslands Soil | LTHVFGRLLYEKRLCEEELRCLREDKLKSIRSFAKCLAGMDAIA* |
| Ga0134111_101886141 | 3300010329 | Grasslands Soil | GRLLYEKRLGEEELCGLGEDKLKSIRSFAKFLAEDRAA* |
| Ga0074045_101402363 | 3300010341 | Bog Forest Soil | LYEKRLGEEELGGLREDKLKSIRSFAKFLAEDTAA* |
| Ga0074044_100071486 | 3300010343 | Bog Forest Soil | VFGRLLYEKRLGEEELRGLREDKLKPIRSFAKFLAEDAA* |
| Ga0074044_100555505 | 3300010343 | Bog Forest Soil | VLGRLLYEKRLGEEELGGLREDKLKSIRSFAKFLAEDWAA* |
| Ga0074044_108119241 | 3300010343 | Bog Forest Soil | LTHVFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAAA* |
| Ga0126370_101858703 | 3300010358 | Tropical Forest Soil | TQVFGRLLYETRVSEEALRGFSEDKLKTTHSFARFLAEDAA* |
| Ga0126370_113484912 | 3300010358 | Tropical Forest Soil | VFGRLLYETRVSEEELRGFSEDKLKTIHSFARFLAEDAA* |
| Ga0126372_116228721 | 3300010360 | Tropical Forest Soil | RYSRLTDVFGRLLYESRLKEQELRGLDDDKLKSIRSIAKFLAEEAA* |
| Ga0126378_109941641 | 3300010361 | Tropical Forest Soil | GRLLYETRVSEEELRGFSEDKLKTIHSFARFLAEEAA* |
| Ga0126377_101966541 | 3300010362 | Tropical Forest Soil | QVFGRLLYETRVSEEELRGFSEDKLKTIHSFARFLAEDAA* |
| Ga0134124_111355012 | 3300010397 | Terrestrial Soil | QVFGRLLYEQRLGEEELGGLREDKLKSIRSFAKFLAEDTAA* |
| Ga0126383_102559331 | 3300010398 | Tropical Forest Soil | SQLTQVFGRLLHEGRVSEEELRGLRDDKLKSIRSFAELFAK* |
| Ga0137392_106251262 | 3300011269 | Vadose Zone Soil | GRLLYERRITEEDLRGLGEDKMKPIRSFAELLAKYAA* |
| Ga0137392_113428242 | 3300011269 | Vadose Zone Soil | RYSQLTQVFGRLLYERRITEEDLRGLAEDKLKSIRSFAKFLAEDTAA* |
| Ga0137391_102069774 | 3300011270 | Vadose Zone Soil | SQLTQVFGKLLQERRLGEEELRGLREDKLKSIRSFAKFLAEMDAA* |
| Ga0137391_108365052 | 3300011270 | Vadose Zone Soil | LTQVFGRLLYETRVSEEELRGFSKDKLKTIRSVAKFLAEDAA* |
| Ga0137393_100652721 | 3300011271 | Vadose Zone Soil | HVFGRLLYEGRVSEEELRGLSDDKLKSILSLAELLAKYSASPGL* |
| Ga0137393_101867884 | 3300011271 | Vadose Zone Soil | RLLYEGRVSEEELRGLSDDKLKSILSLAELLAKYAA* |
| Ga0137388_100602473 | 3300012189 | Vadose Zone Soil | GRLLYEMRLCEDELRGLGEDKLKPIRSFAKFLAEDAA* |
| Ga0137382_110499821 | 3300012200 | Vadose Zone Soil | YSQLTHVFGRLLYEKRLREEELRGLGEDKLKSIRSIAKFAAEMDAA* |
| Ga0137363_106098641 | 3300012202 | Vadose Zone Soil | LTHVFGRLLHEDRLREEELRGLREDKLKSIRSFAKFLAEDTAA* |
| Ga0137362_102222182 | 3300012205 | Vadose Zone Soil | LQERRLGEEELRGLREDKLKSIRSFAKFLAEMDAA* |
| Ga0137376_108046581 | 3300012208 | Vadose Zone Soil | LLYENRLREEELRGLREDKMKAIRSCAKFLAEQAA* |
| Ga0137366_106488812 | 3300012354 | Vadose Zone Soil | YSRLTHVFGRLLYERRITEEDLRGLGEHKLKPIRSIAKFLAEDTAA* |
| Ga0137385_111334952 | 3300012359 | Vadose Zone Soil | GRLLYEKRLGEEELGGLREDKLKSIRSFAKFLAEGTAA* |
| Ga0137390_103302561 | 3300012363 | Vadose Zone Soil | LQERRLGEEELRGLREDKLKSIRSLAKFLAEMDAA* |
| Ga0137398_103218991 | 3300012683 | Vadose Zone Soil | TQLFGRLLHKRRLSEREFRGLREDKLKSIRSFAKFLAGMEAIA* |
| Ga0137398_104917611 | 3300012683 | Vadose Zone Soil | RYSQLTHVFGRLLHEGRVSEKELRGLREDRLKPVRSFAKFLAEDTAA* |
| Ga0137395_105042211 | 3300012917 | Vadose Zone Soil | QLTHVFGRLLYEGRVSEEELRGLSDDKLKSILSLAELLAKYSASPGL* |
| Ga0137395_112550832 | 3300012917 | Vadose Zone Soil | QLTHVFGRLLYEGRVSEEELRGLSDDKLKSILSLAELLAKYAA* |
| Ga0137396_108003352 | 3300012918 | Vadose Zone Soil | LYERRITEEDLRGLGKDKMKPIRSLAELLAKYAA* |
| Ga0137416_105114691 | 3300012927 | Vadose Zone Soil | QLTQVFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA* |
| Ga0137407_102850004 | 3300012930 | Vadose Zone Soil | LYEKRFRQEELCGLGEDKLKPIRSFAEFLAEHAA* |
| Ga0134087_102141253 | 3300012977 | Grasslands Soil | RLLYEKRLGEEELGGLREDKLKSIRSFAKFLAEDTAA* |
| Ga0164305_100548954 | 3300012989 | Soil | GRLLHEQRLREEDLLGLQEDKLKLIRSFATFLAEDTAA* |
| Ga0157378_119659841 | 3300013297 | Miscanthus Rhizosphere | LYEKRLRVEELRGLREDKLKLIHSCAEFLAKDAA* |
| Ga0181523_101429833 | 3300014165 | Bog | GRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA* |
| Ga0137418_100467321 | 3300015241 | Vadose Zone Soil | TQVFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA* |
| Ga0137403_102100301 | 3300015264 | Vadose Zone Soil | LYESRLREEELRGLREDKLNPIRSFAKFLAEDAA* |
| Ga0132258_124400802 | 3300015371 | Arabidopsis Rhizosphere | FGRLLHEQRLCEEELRGLREDKLKPIRSFAKFLAEDAA* |
| Ga0132258_139749812 | 3300015371 | Arabidopsis Rhizosphere | YSQLTQVFGRLLYESRLREEELHGLREDKLKPIRSFAKFLAQDAA* |
| Ga0182036_100410554 | 3300016270 | Soil | RYSRLTQVLGRLLYETRLEEEDLIGLSEDKLQSIRSFAKFLAEDTAA |
| Ga0182036_104499261 | 3300016270 | Soil | LLHESRLREEELCGLGEDKLKSIRSFAKFLAEMDAA |
| Ga0182036_111591461 | 3300016270 | Soil | LTRVFGRLLYEGRVSDEELRGLSDDKLKSIRSLAEFLAKYAA |
| Ga0182033_109301181 | 3300016319 | Soil | SHLTQVFGRLLYETRVSEEELRGFSEDKLKTIHSFASVVRHK |
| Ga0182035_101467944 | 3300016341 | Soil | RLLYEGRVSKEELRGLRDDKLKSIRSLAEFLAKYAA |
| Ga0182032_109199362 | 3300016357 | Soil | GRLLYEGRVTEQDLAGLHENKLRSIRSLAEFLANDAA |
| Ga0182039_103008902 | 3300016422 | Soil | YSQLALVFGRLLHESRLREEELCGLGEDKLKSIRSFAKFLAEMDAA |
| Ga0181515_11559803 | 3300016730 | Peatland | VFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA |
| Ga0187802_102263451 | 3300017822 | Freshwater Sediment | LLYETRVCEEELRGFSEDKLKTIRSLAKFLAEDAA |
| Ga0187849_10204056 | 3300017929 | Peatland | YSHLTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA |
| Ga0187879_107743502 | 3300017946 | Peatland | QVFGRLLYEKRLGEEELGGLREDKLKSIRSFAKFLAEDTAA |
| Ga0187816_101830091 | 3300017995 | Freshwater Sediment | QLTHVFGRLLHEGRLREEELRGLREDKLTSIRSLAKFLAEDAA |
| Ga0187816_101931631 | 3300017995 | Freshwater Sediment | RYSRLTHVFGKLLYEKRLREEELRGLQEDKLNSIRSVAQFLAKYAA |
| Ga0187876_12331611 | 3300018003 | Peatland | LTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA |
| Ga0187804_101935521 | 3300018006 | Freshwater Sediment | SQLTQVFGRLLHEKRLREEELRGLREDKLKLIRSLAKFLAEDAA |
| Ga0187804_104760811 | 3300018006 | Freshwater Sediment | VFGRLLHEKRLREDELRGLREDKLKSIRSFAKFLAEDAAA |
| Ga0187804_105794221 | 3300018006 | Freshwater Sediment | LTQVFGRLLHEKRLREDELHGLREEKLKSIRSFAKFLAEDAA |
| Ga0187810_100399231 | 3300018012 | Freshwater Sediment | RYSQLTHVFGKLLYEKRLREEELRGLREDKLKSIRSVALFLAKYAA |
| Ga0187810_103884611 | 3300018012 | Freshwater Sediment | HVFGKLLYEKRLREEELRGLQEDKLNSIRSVAQFLAKYAA |
| Ga0187866_10778691 | 3300018015 | Peatland | QVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA |
| Ga0187872_101104433 | 3300018017 | Peatland | VFGKLLYEKRLREDELRGLQEDKLNSIRSVAQFLAKYAA |
| Ga0187864_100883872 | 3300018022 | Peatland | VFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA |
| Ga0187864_101570554 | 3300018022 | Peatland | LLHEGRLREEELRGLREDKLKSIRSFAKFLAEDTAA |
| Ga0187788_101667012 | 3300018032 | Tropical Peatland | DYRYSRLTDVLGRLLYEERLSEEELHGLREDKLKSIRSFAEFLAKNVA |
| Ga0187867_103276182 | 3300018033 | Peatland | VFGKLMHEKRLREEELRGLGEDKLKLIRSFAKFLAEDTAA |
| Ga0187855_108170061 | 3300018038 | Peatland | YDFRGLPLTDVLGRLLYENRLSEEELRGLGEDKRKLIRSFAKFLAEDTAA |
| Ga0187887_100136548 | 3300018043 | Peatland | VKLLHEKRLREEELRGLREDKLKSIRSLAKFFAEDAA |
| Ga0187887_100790931 | 3300018043 | Peatland | RLLYEKRLREEELRGLRADKLKPIRSVAKFLAEDVA |
| Ga0187773_101171871 | 3300018064 | Tropical Peatland | QVFGRLLYEGRIREEELSGLREDKLKLIRSFAEFLTKDAA |
| Ga0193723_10553341 | 3300019879 | Soil | HVFGKLLQEGRLGEEELRGLREDKLKSIRSYAKFLAEMDAA |
| Ga0193751_10572403 | 3300019888 | Soil | KRLRESRLGEEELRGLREDKLKSIRSYAKFLAEMDAA |
| Ga0210407_100321184 | 3300020579 | Soil | FGRLLYEGRVSEEELGGLREDKLKPIRSFAKFLAEDAA |
| Ga0210401_101160933 | 3300020583 | Soil | RLLYEKRLREDELRGLREDKLKSIHSLAKFLAEDAA |
| Ga0215015_105081302 | 3300021046 | Soil | LLYEGRVSEEELRGLQEDKLKSIRSLAKFLAEDAA |
| Ga0210404_109094952 | 3300021088 | Soil | ESQLAGVLGRLLYENRLSEEELRGLREDKMESIRSFAKFLRESAA |
| Ga0210396_111965862 | 3300021180 | Soil | RLLYEGRLNEQELRDLADDKLKSIRSFAKFLAEDAVA |
| Ga0210393_100901201 | 3300021401 | Soil | HLSQVFGKLLCETRVSEEELRGFSEDKLKAIRSFAKFLAEDVA |
| Ga0210397_101374861 | 3300021403 | Soil | TQVFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAADAA |
| Ga0210397_112207041 | 3300021403 | Soil | GRLLHEGRLSEEELRGLREDKLTPIRSFAKFLAEDAA |
| Ga0210394_118110182 | 3300021420 | Soil | HLTQVFGRLLYETRVSEEELRGFSEDKLKTIRSFARFLAEDAA |
| Ga0210409_104261321 | 3300021559 | Soil | RLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA |
| Ga0210409_105104952 | 3300021559 | Soil | SQLTHVFGRLLHEKRLREEDLRGLREDKLTSIRSFAKFLAEDAA |
| Ga0126371_109448512 | 3300021560 | Tropical Forest Soil | LLYETRVSEEELRGFSEDKLKTIHSFARFLAEDAV |
| Ga0126371_114327061 | 3300021560 | Tropical Forest Soil | RLLYETRVSEEALRGFSEDKIKTIHSFARFLAEDAA |
| Ga0242653_10185992 | 3300022712 | Soil | GRLLYENRLSEEDLRGLREDKVNLIRSFAKFLAEEAA |
| Ga0224521_11210682 | 3300024233 | Soil | LYENRLSEEELRGLGEDKLKLIRSFAKFLAEDTAA |
| Ga0208821_10397753 | 3300025432 | Peatland | GRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA |
| Ga0208189_10052691 | 3300025444 | Peatland | RYSHLTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA |
| Ga0208937_10050216 | 3300025506 | Peatland | TQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA |
| Ga0209584_100329872 | 3300025878 | Arctic Peat Soil | LHEGRLTEHDLRGLREDKLEAIRSDADFLRRRGEAI |
| Ga0207699_109942721 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | PDVLGRLLYENRLREEELRGLREDKLKPIRSCAKFLAEEAA |
| Ga0207699_113032562 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SSRLTPVFGRLLFEHRVSENELRGLGEDKRKAIHSCAKFLAEDAA |
| Ga0207663_112421251 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RLPVVLGRLLYENRLREEELRGLREDKLKPIRSCAKFLAEEAA |
| Ga0207663_117487841 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | RLTHVFGRLLYERRITEEDLRGLGEDKLKPIRSIAEFLAEDTAA |
| Ga0207660_103229921 | 3300025917 | Corn Rhizosphere | YSQLTNVFGRLLYEKRISVDELSGLGENKLKPIRSLAELLTKDAAGLI |
| Ga0207646_102503153 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | YEYKYSQLTHVFGRLLHEQRLCEEELRGLREDKLTSIRSFAKFLSEDAAA |
| Ga0207646_104680122 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | RLLYEKRLRQEELCGLREDKLKPIRSFAKFLAGDAA |
| Ga0207687_119196341 | 3300025927 | Miscanthus Rhizosphere | THLFGRLLQEGRLSEEELSGLREDKLKSIRSYAKFLAETEAA |
| Ga0209802_11582453 | 3300026328 | Soil | LTHVFGRLLHERRLSEQELRGLREDELKPIRSSRNFLAETDAIA |
| Ga0257164_10026841 | 3300026497 | Soil | ELLCELRLSEEELRGLRADKLEAIRSRAKVLSEDAA |
| Ga0209161_103000902 | 3300026548 | Soil | LFGRLLHERRLSEQELRGLREDKLKSIRSFAKCLAGMDAIA |
| Ga0209648_101319942 | 3300026551 | Grasslands Soil | VFGRLLYEKRLREDELRGLREDKLKSIHSLAKFLAEDAA |
| Ga0208199_10719052 | 3300027497 | Peatlands Soil | NYRYSHLTQVFGRLLYETRVSEEELRGFSEDKLKTIRSFAKFLAETDAAA |
| Ga0209525_11519882 | 3300027575 | Forest Soil | NYRYSHLTQVFGRLLYETRVSEEELRGFSEDKLTTIRSSAKFLAEDAA |
| Ga0208696_10149811 | 3300027696 | Peatlands Soil | YSQLTHVFGKLLHEKRLREEDLRGLREDKLKSIRSLAKFLAEDAA |
| Ga0209701_100893951 | 3300027862 | Vadose Zone Soil | LVFGKLLRETRLGEEDVRGLREDKLESIRSYARFLAKMDAA |
| Ga0209624_104814082 | 3300027895 | Forest Soil | VFGRLLYETRVSEEELRGFSEDKLTTIRSSAKFLAEDAA |
| Ga0209067_100377441 | 3300027898 | Watersheds | LLYETRVSEEELRGFSKDKLKTIRSFAKFLTEDTA |
| Ga0209067_100539763 | 3300027898 | Watersheds | LLYETRVSEEELRGFSKDKLKTIRSFAKFLAEDAA |
| Ga0209006_114669062 | 3300027908 | Forest Soil | SHLTQVFGRLLYETRVSEEELRGFSEDKLTTIRSSAKFLAEDAA |
| Ga0209583_106002141 | 3300027910 | Watersheds | LLYEKRLREEELRGLGEDKLKPIRSFAKFLAEDAA |
| Ga0209698_100991941 | 3300027911 | Watersheds | LTHVFGKLLYEKRLGEEELRGLQEDKLTSIRSVAQFLAKYAA |
| Ga0209526_100422361 | 3300028047 | Forest Soil | SQLTHVFGRLLYEKRLSEEELRGLREDKLKSIRSLAKFLAEDVA |
| Ga0268264_116381612 | 3300028381 | Switchgrass Rhizosphere | FGILLYEKRLRVEELRGLREDKLKLIHSCAEFLAKDAA |
| Ga0137415_102874481 | 3300028536 | Vadose Zone Soil | THVFGRLLHEQRLCEEELRGLREDKLKSIRSFAKFLSEDAAA |
| Ga0308309_101956011 | 3300028906 | Soil | HVFGRLLYEGRVSEEELRGLQEDKLKSIRSLAKFLAEDAA |
| Ga0311334_107269741 | 3300029987 | Fen | RVFGKLLSENRLREEDLRGLQEDKLKSIRSQAKFFAEMDAA |
| Ga0311336_100553793 | 3300029990 | Fen | YDHRHSHLTRVFGKLLCENRLREKDLRGLQEDKLKSIRSQAKFFAEMDAA |
| Ga0311338_117193122 | 3300030007 | Palsa | GRLSYEKRLGEEELGGLREDKLKPIRSFAKFLAENTTA |
| Ga0302316_104748141 | 3300030646 | Palsa | SHLTQVLGELLHEKRISERELRGLHEDKLNSVRSFAKLLAESVA |
| Ga0170823_173253432 | 3300031128 | Forest Soil | YSRLTQVFGKLLYEKRLREEELRGLQEDKLNSIRSVAQFLAKYAA |
| Ga0265340_102769131 | 3300031247 | Rhizosphere | NYRYSHLTQVFGRLLYETRVSEEELRGFSEDKLKTIRSFAKFSAEDAA |
| Ga0170818_1125294352 | 3300031474 | Forest Soil | RPSRLTQEFGRFLCESRVSEEELRGLHAEKLKAIRSLAKLLAEDAA |
| Ga0307476_100903361 | 3300031715 | Hardwood Forest Soil | LTEAFGRLLYEKRLGEDELGGLREDKLRSIRSFAKFLAEGTAA |
| Ga0306917_100964231 | 3300031719 | Soil | FGRLLYETRVSEEELRGFSEDKLKTIHSFARFLAEDAA |
| Ga0307475_100714941 | 3300031754 | Hardwood Forest Soil | VFGKLLYEKRLREDELCGLREDKLNSIRSVASFLAKYAA |
| Ga0307478_109571661 | 3300031823 | Hardwood Forest Soil | LTQVFGRLLYETRVSEEELRGFSEDKLKTIRSFAKFLADDA |
| Ga0306923_102732563 | 3300031910 | Soil | HLTQVFGRLLYETRVSEEELRGFSEDKLKTIHSFARFLAEDAA |
| Ga0307479_100321151 | 3300031962 | Hardwood Forest Soil | LLYEKRLREDALRGLREDKLKSIHSLAKFLAEDAA |
| Ga0307479_104025331 | 3300031962 | Hardwood Forest Soil | FGRLLYEKRLREDELRGLREDKLKSIHSLAKFLAKDAA |
| Ga0307470_101847191 | 3300032174 | Hardwood Forest Soil | GRLLYEGQVSEEELGGLREDKLKPIRSFAKFLAEDAA |
| Ga0307471_1002038483 | 3300032180 | Hardwood Forest Soil | YRYSKLTQVFGRLLYEKRLREEELHGLREDKLKPIRSFAKFLAEDAA |
| Ga0307472_1019267451 | 3300032205 | Hardwood Forest Soil | QVFGRLLYEKRLREEELRGLREDKLKPIRSLAKFLAEDAA |
| Ga0307472_1022098001 | 3300032205 | Hardwood Forest Soil | YKYSQLTHVFGRLLHEQRLCEEELRGLREDKLKSIRSFAKFLSEDAAA |
| Ga0335085_100800231 | 3300032770 | Soil | GRLLHERRVSEEELRGLREDKLASIRSVAEFLAKYAA |
| Ga0335079_102090351 | 3300032783 | Soil | RYSQLTHVFGRLLYEGRVSEEDLCRLRDDKLKPIRSFAKFLAEDTAA |
| Ga0335080_118225261 | 3300032828 | Soil | AFRLSRLTQVFGKLLSERRITEEELRGFSEDKVKSIRSCAQFLAENAA |
| Ga0335071_1000358115 | 3300032897 | Soil | GRLLHERRVSEEELRGLCEDKLASIRSVAEFLAKYAA |
| Ga0335077_110861633 | 3300033158 | Soil | LTDVFGRLLYEGRLKERELQGLQEDKLKSIRSFAKTKDAVA |
| Ga0373959_0009913_3_113 | 3300034820 | Rhizosphere Soil | RLLYEKRLREEELRSLREDKLKAIRSCAKFLAEDAA |
| ⦗Top⦘ |