NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F026623

Metagenome / Metatranscriptome Family F026623

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026623
Family Type Metagenome / Metatranscriptome
Number of Sequences 197
Average Sequence Length 41 residues
Representative Sequence VFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA
Number of Associated Samples 164
Number of Associated Scaffolds 197

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.03 %
% of genes near scaffold ends (potentially truncated) 94.42 %
% of genes from short scaffolds (< 2000 bps) 83.76 %
Associated GOLD sequencing projects 150
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.173 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(15.228 % of family members)
Environment Ontology (ENVO) Unclassified
(22.843 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.685 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 41.79%    β-sheet: 0.00%    Coil/Unstructured: 58.21%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 197 Family Scaffolds
PF07929PRiA4_ORF3 12.18
PF02371Transposase_20 4.06
PF12697Abhydrolase_6 2.03
PF10056DUF2293 2.03
PF13620CarboxypepD_reg 1.52
PF12704MacB_PCD 1.52
PF13557Phenol_MetA_deg 1.52
PF14534DUF4440 1.02
PF02897Peptidase_S9_N 1.02
PF09286Pro-kuma_activ 1.02
PF07676PD40 1.02
PF07589PEP-CTERM 1.02
PF14312FG-GAP_2 1.02
PF00589Phage_integrase 1.02
PF01740STAS 1.02
PF08281Sigma70_r4_2 1.02
PF08031BBE 0.51
PF13282DUF4070 0.51
PF14300DUF4375 0.51
PF00144Beta-lactamase 0.51
PF13650Asp_protease_2 0.51
PF13181TPR_8 0.51
PF02517Rce1-like 0.51
PF00480ROK 0.51
PF13520AA_permease_2 0.51
PF00069Pkinase 0.51
PF02687FtsX 0.51
PF08241Methyltransf_11 0.51
PF00753Lactamase_B 0.51
PF07883Cupin_2 0.51
PF12893Lumazine_bd_2 0.51
PF07244POTRA 0.51
PF13669Glyoxalase_4 0.51
PF13442Cytochrome_CBB3 0.51
PF12867DinB_2 0.51
PF13924Lipocalin_5 0.51
PF03807F420_oxidored 0.51
PF13419HAD_2 0.51
PF12833HTH_18 0.51
PF13408Zn_ribbon_recom 0.51
PF00106adh_short 0.51
PF13519VWA_2 0.51
PF03795YCII 0.51
PF05016ParE_toxin 0.51
PF00583Acetyltransf_1 0.51
PF12158DUF3592 0.51
PF07228SpoIIE 0.51
PF13020NOV_C 0.51
PF00903Glyoxalase 0.51
PF03572Peptidase_S41 0.51
PF13840ACT_7 0.51
PF03459TOBE 0.51
PF13565HTH_32 0.51
PF03544TonB_C 0.51
PF01494FAD_binding_3 0.51
PF04191PEMT 0.51
PF13429TPR_15 0.51
PF14559TPR_19 0.51
PF00266Aminotran_5 0.51
PF04978DUF664 0.51
PF12706Lactamase_B_2 0.51

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 197 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 4.06
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 2.03
COG4934Serine protease, subtilase familyPosttranslational modification, protein turnover, chaperones [O] 1.02
COG1940Sugar kinase of the NBD/HSP70 family, may contain an N-terminal HTH domainTranscription [K] 1.02
COG1770Protease IIAmino acid transport and metabolism [E] 1.02
COG1505Prolyl endopeptidase PreP, S9A serine peptidase familyAmino acid transport and metabolism [E] 1.02
COG06542-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductasesEnergy production and conversion [C] 1.02
COG0793C-terminal processing protease CtpA/Prc, contains a PDZ domainPosttranslational modification, protein turnover, chaperones [O] 0.51
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.51
COG1266Membrane protease YdiL, CAAX protease familyPosttranslational modification, protein turnover, chaperones [O] 0.51
COG0665Glycine/D-amino acid oxidase (deaminating)Amino acid transport and metabolism [E] 0.51
COG1680CubicO group peptidase, beta-lactamase class C familyDefense mechanisms [V] 0.51
COG1686D-alanyl-D-alanine carboxypeptidaseCell wall/membrane/envelope biogenesis [M] 0.51
COG0644Dehydrogenase (flavoprotein)Energy production and conversion [C] 0.51
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 0.51
COG2367Beta-lactamase class ADefense mechanisms [V] 0.51
COG0578Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.51
COG4449Predicted protease, Abi (CAAX) familyGeneral function prediction only [R] 0.51
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.51


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.17 %
UnclassifiedrootN/A21.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2070309004|prs_FIHLEPW02TKICVAll Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium511Open in IMG/M
2189573001|GZR05M102JYVB3All Organisms → cellular organisms → Bacteria512Open in IMG/M
2228664022|INPgaii200_c0799681All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium723Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_100246137Not Available612Open in IMG/M
3300000364|INPhiseqgaiiFebDRAFT_101005047Not Available540Open in IMG/M
3300000651|AP72_2010_repI_A10DRAFT_1007873Not Available1417Open in IMG/M
3300000789|JGI1027J11758_12143534Not Available563Open in IMG/M
3300003505|JGIcombinedJ51221_10345051All Organisms → cellular organisms → Bacteria → Proteobacteria605Open in IMG/M
3300004091|Ga0062387_100393592All Organisms → cellular organisms → Bacteria → Proteobacteria931Open in IMG/M
3300005174|Ga0066680_10209736All Organisms → cellular organisms → Bacteria → Proteobacteria1232Open in IMG/M
3300005336|Ga0070680_100374998All Organisms → cellular organisms → Bacteria1211Open in IMG/M
3300005436|Ga0070713_100079109All Organisms → cellular organisms → Bacteria2800Open in IMG/M
3300005439|Ga0070711_101576162All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300005447|Ga0066689_10636881Not Available670Open in IMG/M
3300005468|Ga0070707_100215599All Organisms → cellular organisms → Bacteria1870Open in IMG/M
3300005518|Ga0070699_100539323All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1061Open in IMG/M
3300005542|Ga0070732_10463578All Organisms → cellular organisms → Bacteria766Open in IMG/M
3300005557|Ga0066704_10825902All Organisms → cellular organisms → Bacteria575Open in IMG/M
3300005559|Ga0066700_10194749All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1397Open in IMG/M
3300005560|Ga0066670_10638058Not Available647Open in IMG/M
3300005561|Ga0066699_10253713All Organisms → cellular organisms → Bacteria1242Open in IMG/M
3300005591|Ga0070761_10423399All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300005591|Ga0070761_10739270All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Sphaerotilus → Sphaerotilus natans617Open in IMG/M
3300005602|Ga0070762_10101781All Organisms → cellular organisms → Bacteria → Acidobacteria1664Open in IMG/M
3300005602|Ga0070762_10183661All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300005610|Ga0070763_10252806Not Available956Open in IMG/M
3300005610|Ga0070763_10731090All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300005764|Ga0066903_103667423All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium826Open in IMG/M
3300005921|Ga0070766_10967205All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300005921|Ga0070766_11087072Not Available552Open in IMG/M
3300005994|Ga0066789_10012182All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia3805Open in IMG/M
3300006046|Ga0066652_101329074All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300006052|Ga0075029_100193622All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1267Open in IMG/M
3300006086|Ga0075019_10063234All Organisms → cellular organisms → Bacteria2097Open in IMG/M
3300006102|Ga0075015_100055540Not Available1887Open in IMG/M
3300006162|Ga0075030_100985367All Organisms → cellular organisms → Bacteria664Open in IMG/M
3300006176|Ga0070765_100300976All Organisms → cellular organisms → Bacteria1482Open in IMG/M
3300006176|Ga0070765_100874370All Organisms → cellular organisms → Bacteria849Open in IMG/M
3300006642|Ga0075521_10680594All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium507Open in IMG/M
3300007258|Ga0099793_10138962All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1146Open in IMG/M
3300009029|Ga0066793_10177328All Organisms → cellular organisms → Bacteria → Acidobacteria1242Open in IMG/M
3300009038|Ga0099829_11232489All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium619Open in IMG/M
3300009088|Ga0099830_11470482All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300009089|Ga0099828_11057236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium722Open in IMG/M
3300009090|Ga0099827_10513881All Organisms → cellular organisms → Bacteria1030Open in IMG/M
3300009518|Ga0116128_1043675All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1436Open in IMG/M
3300009521|Ga0116222_1346951Not Available644Open in IMG/M
3300009521|Ga0116222_1419287All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300009616|Ga0116111_1143903All Organisms → cellular organisms → Bacteria570Open in IMG/M
3300009630|Ga0116114_1054305All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA71123Open in IMG/M
3300009631|Ga0116115_1063373All Organisms → cellular organisms → Bacteria → Acidobacteria969Open in IMG/M
3300009646|Ga0116132_1086999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium968Open in IMG/M
3300009700|Ga0116217_10625957All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium669Open in IMG/M
3300009764|Ga0116134_1150619All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300010323|Ga0134086_10178066All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium786Open in IMG/M
3300010329|Ga0134111_10188614All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium829Open in IMG/M
3300010341|Ga0074045_10140236All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1648Open in IMG/M
3300010343|Ga0074044_10007148All Organisms → cellular organisms → Bacteria8836Open in IMG/M
3300010343|Ga0074044_10055550All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2705Open in IMG/M
3300010343|Ga0074044_10811924All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium611Open in IMG/M
3300010358|Ga0126370_10185870All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1555Open in IMG/M
3300010358|Ga0126370_11348491Not Available671Open in IMG/M
3300010360|Ga0126372_11622872Not Available686Open in IMG/M
3300010361|Ga0126378_10994164All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium943Open in IMG/M
3300010362|Ga0126377_10196654All Organisms → cellular organisms → Bacteria1929Open in IMG/M
3300010397|Ga0134124_11135501All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium799Open in IMG/M
3300010398|Ga0126383_10255933All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1721Open in IMG/M
3300011269|Ga0137392_10625126All Organisms → cellular organisms → Bacteria → Acidobacteria893Open in IMG/M
3300011269|Ga0137392_11342824All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium574Open in IMG/M
3300011270|Ga0137391_10206977All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1705Open in IMG/M
3300011270|Ga0137391_10836505All Organisms → cellular organisms → Bacteria → Acidobacteria757Open in IMG/M
3300011271|Ga0137393_10065272All Organisms → cellular organisms → Bacteria2886Open in IMG/M
3300011271|Ga0137393_10186788All Organisms → cellular organisms → Bacteria1745Open in IMG/M
3300012189|Ga0137388_10060247Not Available3119Open in IMG/M
3300012200|Ga0137382_11049982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium583Open in IMG/M
3300012202|Ga0137363_10609864All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium922Open in IMG/M
3300012205|Ga0137362_10222218All Organisms → cellular organisms → Bacteria → Acidobacteria1629Open in IMG/M
3300012208|Ga0137376_10804658All Organisms → cellular organisms → Bacteria809Open in IMG/M
3300012354|Ga0137366_10648881All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium755Open in IMG/M
3300012359|Ga0137385_11133495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium643Open in IMG/M
3300012363|Ga0137390_10330256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1506Open in IMG/M
3300012683|Ga0137398_10321899All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1043Open in IMG/M
3300012683|Ga0137398_10491761All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium843Open in IMG/M
3300012917|Ga0137395_10504221All Organisms → cellular organisms → Bacteria872Open in IMG/M
3300012917|Ga0137395_11255083Not Available515Open in IMG/M
3300012918|Ga0137396_10800335All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300012927|Ga0137416_10511469All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1035Open in IMG/M
3300012930|Ga0137407_10285000Not Available1506Open in IMG/M
3300012977|Ga0134087_10214125All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium868Open in IMG/M
3300012989|Ga0164305_10054895All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2353Open in IMG/M
3300013297|Ga0157378_11965984Not Available634Open in IMG/M
3300014165|Ga0181523_10142983All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1413Open in IMG/M
3300015241|Ga0137418_10046732All Organisms → cellular organisms → Bacteria3983Open in IMG/M
3300015264|Ga0137403_10210030All Organisms → cellular organisms → Bacteria → Acidobacteria1874Open in IMG/M
3300015371|Ga0132258_12440080All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1309Open in IMG/M
3300015371|Ga0132258_13974981All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1004Open in IMG/M
3300016270|Ga0182036_10041055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2839Open in IMG/M
3300016270|Ga0182036_10449926All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1012Open in IMG/M
3300016270|Ga0182036_11159146Not Available642Open in IMG/M
3300016319|Ga0182033_10930118All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300016341|Ga0182035_10146794All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1805Open in IMG/M
3300016357|Ga0182032_10919936All Organisms → cellular organisms → Bacteria744Open in IMG/M
3300016422|Ga0182039_10300890All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1329Open in IMG/M
3300016730|Ga0181515_1155980All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1362Open in IMG/M
3300017822|Ga0187802_10226345All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium721Open in IMG/M
3300017929|Ga0187849_1020405All Organisms → cellular organisms → Bacteria → Acidobacteria3744Open in IMG/M
3300017946|Ga0187879_10774350All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium535Open in IMG/M
3300017995|Ga0187816_10183009All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium910Open in IMG/M
3300017995|Ga0187816_10193163Not Available884Open in IMG/M
3300018003|Ga0187876_1233161Not Available606Open in IMG/M
3300018006|Ga0187804_10193552All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium867Open in IMG/M
3300018006|Ga0187804_10476081All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium559Open in IMG/M
3300018006|Ga0187804_10579422Not Available509Open in IMG/M
3300018012|Ga0187810_10039923All Organisms → cellular organisms → Bacteria1747Open in IMG/M
3300018012|Ga0187810_10388461All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium585Open in IMG/M
3300018015|Ga0187866_1077869All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1420Open in IMG/M
3300018017|Ga0187872_10110443All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Eisenbacteria → Candidatus Eisenbacteria bacterium1362Open in IMG/M
3300018022|Ga0187864_10088387All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300018022|Ga0187864_10157055All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1118Open in IMG/M
3300018032|Ga0187788_10166701All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium838Open in IMG/M
3300018033|Ga0187867_10327618All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium855Open in IMG/M
3300018038|Ga0187855_10817006All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium544Open in IMG/M
3300018043|Ga0187887_10013654All Organisms → cellular organisms → Bacteria5381Open in IMG/M
3300018043|Ga0187887_10079093All Organisms → cellular organisms → Bacteria1992Open in IMG/M
3300018064|Ga0187773_10117187All Organisms → cellular organisms → Bacteria → Elusimicrobia → Elusimicrobia1334Open in IMG/M
3300019879|Ga0193723_1055334Not Available1161Open in IMG/M
3300019888|Ga0193751_1057240All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1648Open in IMG/M
3300020579|Ga0210407_10032118All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_83905Open in IMG/M
3300020583|Ga0210401_10116093All Organisms → cellular organisms → Bacteria → Acidobacteria2511Open in IMG/M
3300021046|Ga0215015_10508130Not Available526Open in IMG/M
3300021088|Ga0210404_10909495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium503Open in IMG/M
3300021180|Ga0210396_11196586All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium636Open in IMG/M
3300021401|Ga0210393_10090120All Organisms → cellular organisms → Bacteria → Acidobacteria2435Open in IMG/M
3300021403|Ga0210397_10137486Not Available1694Open in IMG/M
3300021403|Ga0210397_11220704Not Available584Open in IMG/M
3300021420|Ga0210394_11811018All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium509Open in IMG/M
3300021559|Ga0210409_10426132All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1185Open in IMG/M
3300021559|Ga0210409_10510495All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1066Open in IMG/M
3300021560|Ga0126371_10944851Not Available1005Open in IMG/M
3300021560|Ga0126371_11432706All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium821Open in IMG/M
3300022712|Ga0242653_1018599Not Available949Open in IMG/M
3300024233|Ga0224521_1121068All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium558Open in IMG/M
3300025432|Ga0208821_1039775All Organisms → cellular organisms → Bacteria → Acidobacteria901Open in IMG/M
3300025444|Ga0208189_1005269All Organisms → cellular organisms → Bacteria → Acidobacteria3755Open in IMG/M
3300025506|Ga0208937_1005021All Organisms → cellular organisms → Bacteria → Acidobacteria3752Open in IMG/M
3300025878|Ga0209584_10032987All Organisms → cellular organisms → Bacteria → Acidobacteria1794Open in IMG/M
3300025906|Ga0207699_10994272Not Available620Open in IMG/M
3300025906|Ga0207699_11303256Not Available537Open in IMG/M
3300025916|Ga0207663_11242125All Organisms → cellular organisms → Bacteria → Acidobacteria600Open in IMG/M
3300025916|Ga0207663_11748784All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium500Open in IMG/M
3300025917|Ga0207660_10322992Not Available1233Open in IMG/M
3300025922|Ga0207646_10250315All Organisms → cellular organisms → Bacteria1601Open in IMG/M
3300025922|Ga0207646_10468012Not Available1137Open in IMG/M
3300025927|Ga0207687_11919634All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300026328|Ga0209802_1158245All Organisms → cellular organisms → Bacteria945Open in IMG/M
3300026497|Ga0257164_1002684All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis1755Open in IMG/M
3300026551|Ga0209648_10131994All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1998Open in IMG/M
3300027497|Ga0208199_1071905All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium725Open in IMG/M
3300027575|Ga0209525_1151988All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae529Open in IMG/M
3300027696|Ga0208696_1014981All Organisms → cellular organisms → Bacteria3024Open in IMG/M
3300027862|Ga0209701_10089395All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1934Open in IMG/M
3300027895|Ga0209624_10481408All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae827Open in IMG/M
3300027898|Ga0209067_10037744Not Available2460Open in IMG/M
3300027898|Ga0209067_10053976All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2052Open in IMG/M
3300027908|Ga0209006_11466906All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter kueseliae518Open in IMG/M
3300027910|Ga0209583_10600214Not Available560Open in IMG/M
3300027911|Ga0209698_10099194All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2440Open in IMG/M
3300028047|Ga0209526_10042236All Organisms → cellular organisms → Bacteria3208Open in IMG/M
3300028381|Ga0268264_11638161Not Available654Open in IMG/M
3300028536|Ga0137415_10287448All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300028906|Ga0308309_10195601All Organisms → cellular organisms → Bacteria → Acidobacteria1663Open in IMG/M
3300029987|Ga0311334_10726974All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7813Open in IMG/M
3300029990|Ga0311336_10055379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA73075Open in IMG/M
3300030007|Ga0311338_11719312All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium568Open in IMG/M
3300030646|Ga0302316_10474814Not Available500Open in IMG/M
3300031128|Ga0170823_17325343All Organisms → cellular organisms → Bacteria805Open in IMG/M
3300031247|Ga0265340_10276913Not Available746Open in IMG/M
3300031474|Ga0170818_112529435Not Available530Open in IMG/M
3300031715|Ga0307476_10090336All Organisms → cellular organisms → Bacteria2149Open in IMG/M
3300031719|Ga0306917_10096423Not Available2112Open in IMG/M
3300031754|Ga0307475_10071494All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2653Open in IMG/M
3300031823|Ga0307478_10957166Not Available716Open in IMG/M
3300031910|Ga0306923_10273256All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1933Open in IMG/M
3300031962|Ga0307479_10032115All Organisms → cellular organisms → Bacteria5006Open in IMG/M
3300031962|Ga0307479_10402533Not Available1353Open in IMG/M
3300032174|Ga0307470_10184719All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1315Open in IMG/M
3300032180|Ga0307471_100203848All Organisms → cellular organisms → Bacteria1982Open in IMG/M
3300032205|Ga0307472_101926745All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium590Open in IMG/M
3300032205|Ga0307472_102209800All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium555Open in IMG/M
3300032770|Ga0335085_10080023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4292Open in IMG/M
3300032783|Ga0335079_10209035All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2162Open in IMG/M
3300032828|Ga0335080_11822526Not Available593Open in IMG/M
3300032897|Ga0335071_10003581All Organisms → cellular organisms → Bacteria16297Open in IMG/M
3300033158|Ga0335077_11086163All Organisms → cellular organisms → Bacteria792Open in IMG/M
3300034820|Ga0373959_0009913Not Available1654Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil15.23%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil6.60%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland6.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.09%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.58%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.08%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.57%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.57%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil4.57%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment4.06%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds4.06%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil4.06%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil2.54%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.03%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.03%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.52%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil1.52%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.02%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.02%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.02%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.02%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.02%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.02%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.02%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.51%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.51%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.51%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.51%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.51%
Green-Waste CompostEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Green-Waste Compost0.51%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil0.51%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.51%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.51%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil0.51%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.51%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil0.51%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.51%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2070309004Green-waste compost microbial communities at University of California, Davis, USA, from solid state bioreactor - Luquillo Rain Forest, Puerto RicoEnvironmentalOpen in IMG/M
2189573001Grass soil microbial communities from Rothamsted Park, UK - FD2 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
2228664022Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300000651Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A10EnvironmentalOpen in IMG/M
3300000789Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300004091Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005447Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138EnvironmentalOpen in IMG/M
3300005468Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005557Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153EnvironmentalOpen in IMG/M
3300005559Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149EnvironmentalOpen in IMG/M
3300005560Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119EnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300006046Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006086Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006642Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-DEnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009090Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009616Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009700Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300010323Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300012189Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012354Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012359Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012363Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012977Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300015241Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015264Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016357Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016730Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017822Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017995Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018006Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4EnvironmentalOpen in IMG/M
3300018012Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018038Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018064Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MGEnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021046Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depthEnvironmentalOpen in IMG/M
3300021088Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022712Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-32-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024233Peat soil microbial communities from Stordalen Mire, Sweden - C.F.S.T0EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025444Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026328Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes)EnvironmentalOpen in IMG/M
3300026497Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-08-BEnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300026551Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027575Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027696Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027862Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027898Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027908Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300029990I_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030646Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032897Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300034820Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
prs_028919702070309004Green-Waste CompostVFGKLLYEGRISEEDLSGLRDDKLKSIRSLAKFLAEDTAA
FD2_051858302189573001Grass SoilLFGRLLHERRLSEQELRELREDKLKSIRSFAKFLAGMDAIA
INPgaii200_079968132228664022SoilFGRLLYETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA
INPhiseqgaiiFebDRAFT_10024613713300000364SoilTAPRLNDVLGRLLYENRLGEEDLCGLREDKLKSIRSCAQFLAKYAA*
INPhiseqgaiiFebDRAFT_10100504723300000364SoilVFGRLLSEGRVSEKELRGLGEDKPNVVRSCAKILSEDPA*
AP72_2010_repI_A10DRAFT_100787313300000651Forest SoilHLTQVFGRLLYETRVSEEELRGFSEDKLMTIHSFARFLAEDVA*
JGI1027J11758_1214353423300000789SoilLLYEKRLSDEDLRDVGHDKLRLIRSFAQFLTEDAA*
JGIcombinedJ51221_1034505123300003505Forest SoilSQLTHVFGRLLYEGRVSEEELSGLREDKLKPIRSLAEFLAKDVA*
Ga0062387_10039359213300004091Bog Forest SoilSQLTHVFGRLLYEKRLREEELRGLREDKLKSIRSFAKFLAEDAAA*
Ga0066680_1020973633300005174SoilSRLTHVFGRLLHERRLSEQELRGLREDELKPIRSSRNFLAETDAIA*
Ga0070680_10037499813300005336Corn RhizosphereYSQLTNVFGRLLYEKRISVDELSGLGENKLKPIRSLAELLTKDAAGLI*
Ga0070713_10007910943300005436Corn, Switchgrass And Miscanthus RhizosphereVFGRLLHEKRLCEDELRGLREDKLEPIRTLAKFLAEDAA*
Ga0070711_10157616213300005439Corn, Switchgrass And Miscanthus RhizosphereLTQVFGRLLDEKRISEQELRGLREDKMKPIRSFAKFLAKTNAVA*
Ga0066689_1063688113300005447SoilVFGRLLYEKRLREEELRGLGEDKLKSIRSIAKFAAEMDAA*
Ga0070707_10021559913300005468Corn, Switchgrass And Miscanthus RhizosphereYEYKYSQLTHVFGRLLHEQRLCEEELRGLREDKLTSIRSFAKFLSEDAAA*
Ga0070699_10053932313300005518Corn, Switchgrass And Miscanthus RhizosphereEYKYSQLTHVFGRLLHEQRLCEEELRGLREDKLKSIRSFAKFLSEDAAA*
Ga0070732_1046357823300005542Surface SoilSHLTQVFGRLLYETRVSEEELRGFSQDKLKTIRSLAEFLADDAA*
Ga0066704_1082590213300005557SoilLTHVFGRLLHENRLREEELRGLGEHKLNSIRSLAKFLAEDAA*
Ga0066700_1019474913300005559SoilSQLTQVFGRLLYERRITEEDLRGLGEDKLKPIRSFAELLAKYAA*
Ga0066670_1063805823300005560SoilVFGTLLYEGRIREEELRGLREDKMKAIRSCADVLSENAA*
Ga0066699_1025371333300005561SoilLLHESRLSEEELRGLREDKLKSIRSFPKFLWETDAA*
Ga0070761_1042339923300005591SoilSHLTQVFGRLLYETRVREEELRGFSEDKLRTIRSLAKFLAEDAV*
Ga0070761_1073927013300005591SoilHVFGRLLYEGRVREEELRGLSDDKLKSIRSLAEFLAKYAD*
Ga0070762_1010178123300005602SoilVFGRLLYEKRLREEELRGLHEDKLNPIRSFAQFLAEDAA*
Ga0070762_1018366133300005602SoilVFGRLLYETRVSEEELRGFREDKLTTIRSLAKFLAEDAASWPAF*
Ga0070763_1025280623300005610SoilVFGKLLHEGRLREEELRGLREDKLEAIHSCAKFPARMDAA*
Ga0070763_1073109013300005610SoilRLLHEGRLKEQGLLGLDEDKLKSIRSIAQILAEDAA*
Ga0066903_10366742313300005764Tropical Forest SoilRLLYETRVSEEALRGFSEDKLKTIHSFARFLAEDAA*
Ga0070766_1096720513300005921SoilVFGKLLHERRLGDEELRGLRENKLKSIRSYAKFLAEMDAA*
Ga0070766_1108707213300005921SoilYSQLTHVFGRLLYEKRLGEEELRGLREDKLKSIYSLAKFLAEDAA*
Ga0066789_1001218223300005994SoilMRFSGCESRLGEEELRGLREDKLKSIRSYAKFLAEMDAA*
Ga0066652_10132907413300006046SoilVFGRLLYERRVSEEDLRGLREDKLKPIRLFAKFLAEDTAA*
Ga0075029_10019362223300006052WatershedsLLYETRVSEEELRDFSKDKLKTIRSFAKFLAQDAA*
Ga0075019_1006323433300006086WatershedsGRLLYETRVSEEELRGFSKDKLKTIRSFAKFLAQDAA*
Ga0075015_10005554033300006102WatershedsVLGRLLCEHRVSEEELRGLREDKLKAIHSCAQFLAEDAA*
Ga0075030_10098536713300006162WatershedsRYSQLTNVFGRLLYENRLSEEELGGLREEKLKSIRSTAEFLAKEWT*
Ga0070765_10030097633300006176SoilSQLTQVFGRLLYEGRLQEEELRGLRGDKLKLIRSFAKFLAEEAA*
Ga0070765_10087437013300006176SoilQLTHVFGRLLYESRLSEGELHGLGEDKLKSIHSVAQFLAKYAA*
Ga0075521_1068059423300006642Arctic Peat SoilYETRVSEEELRGFSKDKLKTIRSLAKFLAEDTGA*
Ga0099793_1013896223300007258Vadose Zone SoilFGRLLYEMRLCEDELRRLGEDKLKPIRSFAKFLAEDAA*
Ga0066793_1017732813300009029Prmafrost SoilLLHEKRLREEDLRGLREDKLKSIRSLAKFLAEDAA*
Ga0099829_1123248913300009038Vadose Zone SoilLTHVFGRLLHEGRVSEEELRGLREDKLKPIRSFAKFLAEDTAA*
Ga0099830_1147048223300009088Vadose Zone SoilSQLTHVFGKLLYERRLREEELRGLGEDKLKSIRSVAQFLAKYAA*
Ga0099828_1105723613300009089Vadose Zone SoilLTQVFGRLLYEKRLGEEELGGLREDKLKSIRSFAQFLAEDTAA*
Ga0099827_1051388113300009090Vadose Zone SoilDYRYSQLTQVFGRLLYEKRLRQEELRGLREDKLKPIRAFAKFLAEDAA*
Ga0066709_10088102313300009137Grasslands SoilDRRLSDQELRGLREDGLKPIRSSRDFLAETDAIA*
Ga0116128_104367533300009518PeatlandYSHLTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA*
Ga0116222_134695113300009521Peatlands SoilLTDVFGRLVREGRLSEDELQGLGEDKLQSIRSYARLLAKLDEEA*
Ga0116222_141928713300009521Peatlands SoilDYRYSRLTHVFGKLLYEGRLREEELRGLREDKLNSIRSVAQFLAKYAA*
Ga0116111_114390323300009616PeatlandRYSQLTQVFGRLLYEKRLREEELRGLREDKLKPIRSLAKFLAEDAA*
Ga0116114_105430523300009630PeatlandVFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA*
Ga0116115_106337333300009631PeatlandHLTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA*
Ga0116132_108699913300009646PeatlandVFGKLLHEKRLREEDLRGLREDKLKSIRSVAKFLAEDTAA*
Ga0116217_1062595723300009700Peatlands SoilFGRLLHEGRLREEELRGLREDKLKSIRSFAKFLAEDTAA*
Ga0116134_115061913300009764PeatlandQLTQVFGRLLYEKRLGEEELAGLGEDKLKSIRSCAKFLAEDTAA*
Ga0134086_1017806613300010323Grasslands SoilLTHVFGRLLYEKRLCEEELRCLREDKLKSIRSFAKCLAGMDAIA*
Ga0134111_1018861413300010329Grasslands SoilGRLLYEKRLGEEELCGLGEDKLKSIRSFAKFLAEDRAA*
Ga0074045_1014023633300010341Bog Forest SoilLYEKRLGEEELGGLREDKLKSIRSFAKFLAEDTAA*
Ga0074044_1000714863300010343Bog Forest SoilVFGRLLYEKRLGEEELRGLREDKLKPIRSFAKFLAEDAA*
Ga0074044_1005555053300010343Bog Forest SoilVLGRLLYEKRLGEEELGGLREDKLKSIRSFAKFLAEDWAA*
Ga0074044_1081192413300010343Bog Forest SoilLTHVFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAAA*
Ga0126370_1018587033300010358Tropical Forest SoilTQVFGRLLYETRVSEEALRGFSEDKLKTTHSFARFLAEDAA*
Ga0126370_1134849123300010358Tropical Forest SoilVFGRLLYETRVSEEELRGFSEDKLKTIHSFARFLAEDAA*
Ga0126372_1162287213300010360Tropical Forest SoilRYSRLTDVFGRLLYESRLKEQELRGLDDDKLKSIRSIAKFLAEEAA*
Ga0126378_1099416413300010361Tropical Forest SoilGRLLYETRVSEEELRGFSEDKLKTIHSFARFLAEEAA*
Ga0126377_1019665413300010362Tropical Forest SoilQVFGRLLYETRVSEEELRGFSEDKLKTIHSFARFLAEDAA*
Ga0134124_1113550123300010397Terrestrial SoilQVFGRLLYEQRLGEEELGGLREDKLKSIRSFAKFLAEDTAA*
Ga0126383_1025593313300010398Tropical Forest SoilSQLTQVFGRLLHEGRVSEEELRGLRDDKLKSIRSFAELFAK*
Ga0137392_1062512623300011269Vadose Zone SoilGRLLYERRITEEDLRGLGEDKMKPIRSFAELLAKYAA*
Ga0137392_1134282423300011269Vadose Zone SoilRYSQLTQVFGRLLYERRITEEDLRGLAEDKLKSIRSFAKFLAEDTAA*
Ga0137391_1020697743300011270Vadose Zone SoilSQLTQVFGKLLQERRLGEEELRGLREDKLKSIRSFAKFLAEMDAA*
Ga0137391_1083650523300011270Vadose Zone SoilLTQVFGRLLYETRVSEEELRGFSKDKLKTIRSVAKFLAEDAA*
Ga0137393_1006527213300011271Vadose Zone SoilHVFGRLLYEGRVSEEELRGLSDDKLKSILSLAELLAKYSASPGL*
Ga0137393_1018678843300011271Vadose Zone SoilRLLYEGRVSEEELRGLSDDKLKSILSLAELLAKYAA*
Ga0137388_1006024733300012189Vadose Zone SoilGRLLYEMRLCEDELRGLGEDKLKPIRSFAKFLAEDAA*
Ga0137382_1104998213300012200Vadose Zone SoilYSQLTHVFGRLLYEKRLREEELRGLGEDKLKSIRSIAKFAAEMDAA*
Ga0137363_1060986413300012202Vadose Zone SoilLTHVFGRLLHEDRLREEELRGLREDKLKSIRSFAKFLAEDTAA*
Ga0137362_1022221823300012205Vadose Zone SoilLQERRLGEEELRGLREDKLKSIRSFAKFLAEMDAA*
Ga0137376_1080465813300012208Vadose Zone SoilLLYENRLREEELRGLREDKMKAIRSCAKFLAEQAA*
Ga0137366_1064888123300012354Vadose Zone SoilYSRLTHVFGRLLYERRITEEDLRGLGEHKLKPIRSIAKFLAEDTAA*
Ga0137385_1113349523300012359Vadose Zone SoilGRLLYEKRLGEEELGGLREDKLKSIRSFAKFLAEGTAA*
Ga0137390_1033025613300012363Vadose Zone SoilLQERRLGEEELRGLREDKLKSIRSLAKFLAEMDAA*
Ga0137398_1032189913300012683Vadose Zone SoilTQLFGRLLHKRRLSEREFRGLREDKLKSIRSFAKFLAGMEAIA*
Ga0137398_1049176113300012683Vadose Zone SoilRYSQLTHVFGRLLHEGRVSEKELRGLREDRLKPVRSFAKFLAEDTAA*
Ga0137395_1050422113300012917Vadose Zone SoilQLTHVFGRLLYEGRVSEEELRGLSDDKLKSILSLAELLAKYSASPGL*
Ga0137395_1125508323300012917Vadose Zone SoilQLTHVFGRLLYEGRVSEEELRGLSDDKLKSILSLAELLAKYAA*
Ga0137396_1080033523300012918Vadose Zone SoilLYERRITEEDLRGLGKDKMKPIRSLAELLAKYAA*
Ga0137416_1051146913300012927Vadose Zone SoilQLTQVFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA*
Ga0137407_1028500043300012930Vadose Zone SoilLYEKRFRQEELCGLGEDKLKPIRSFAEFLAEHAA*
Ga0134087_1021412533300012977Grasslands SoilRLLYEKRLGEEELGGLREDKLKSIRSFAKFLAEDTAA*
Ga0164305_1005489543300012989SoilGRLLHEQRLREEDLLGLQEDKLKLIRSFATFLAEDTAA*
Ga0157378_1196598413300013297Miscanthus RhizosphereLYEKRLRVEELRGLREDKLKLIHSCAEFLAKDAA*
Ga0181523_1014298333300014165BogGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA*
Ga0137418_1004673213300015241Vadose Zone SoilTQVFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA*
Ga0137403_1021003013300015264Vadose Zone SoilLYESRLREEELRGLREDKLNPIRSFAKFLAEDAA*
Ga0132258_1244008023300015371Arabidopsis RhizosphereFGRLLHEQRLCEEELRGLREDKLKPIRSFAKFLAEDAA*
Ga0132258_1397498123300015371Arabidopsis RhizosphereYSQLTQVFGRLLYESRLREEELHGLREDKLKPIRSFAKFLAQDAA*
Ga0182036_1004105543300016270SoilRYSRLTQVLGRLLYETRLEEEDLIGLSEDKLQSIRSFAKFLAEDTAA
Ga0182036_1044992613300016270SoilLLHESRLREEELCGLGEDKLKSIRSFAKFLAEMDAA
Ga0182036_1115914613300016270SoilLTRVFGRLLYEGRVSDEELRGLSDDKLKSIRSLAEFLAKYAA
Ga0182033_1093011813300016319SoilSHLTQVFGRLLYETRVSEEELRGFSEDKLKTIHSFASVVRHK
Ga0182035_1014679443300016341SoilRLLYEGRVSKEELRGLRDDKLKSIRSLAEFLAKYAA
Ga0182032_1091993623300016357SoilGRLLYEGRVTEQDLAGLHENKLRSIRSLAEFLANDAA
Ga0182039_1030089023300016422SoilYSQLALVFGRLLHESRLREEELCGLGEDKLKSIRSFAKFLAEMDAA
Ga0181515_115598033300016730PeatlandVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA
Ga0187802_1022634513300017822Freshwater SedimentLLYETRVCEEELRGFSEDKLKTIRSLAKFLAEDAA
Ga0187849_102040563300017929PeatlandYSHLTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA
Ga0187879_1077435023300017946PeatlandQVFGRLLYEKRLGEEELGGLREDKLKSIRSFAKFLAEDTAA
Ga0187816_1018300913300017995Freshwater SedimentQLTHVFGRLLHEGRLREEELRGLREDKLTSIRSLAKFLAEDAA
Ga0187816_1019316313300017995Freshwater SedimentRYSRLTHVFGKLLYEKRLREEELRGLQEDKLNSIRSVAQFLAKYAA
Ga0187876_123316113300018003PeatlandLTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA
Ga0187804_1019355213300018006Freshwater SedimentSQLTQVFGRLLHEKRLREEELRGLREDKLKLIRSLAKFLAEDAA
Ga0187804_1047608113300018006Freshwater SedimentVFGRLLHEKRLREDELRGLREDKLKSIRSFAKFLAEDAAA
Ga0187804_1057942213300018006Freshwater SedimentLTQVFGRLLHEKRLREDELHGLREEKLKSIRSFAKFLAEDAA
Ga0187810_1003992313300018012Freshwater SedimentRYSQLTHVFGKLLYEKRLREEELRGLREDKLKSIRSVALFLAKYAA
Ga0187810_1038846113300018012Freshwater SedimentHVFGKLLYEKRLREEELRGLQEDKLNSIRSVAQFLAKYAA
Ga0187866_107786913300018015PeatlandQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA
Ga0187872_1011044333300018017PeatlandVFGKLLYEKRLREDELRGLQEDKLNSIRSVAQFLAKYAA
Ga0187864_1008838723300018022PeatlandVFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA
Ga0187864_1015705543300018022PeatlandLLHEGRLREEELRGLREDKLKSIRSFAKFLAEDTAA
Ga0187788_1016670123300018032Tropical PeatlandDYRYSRLTDVLGRLLYEERLSEEELHGLREDKLKSIRSFAEFLAKNVA
Ga0187867_1032761823300018033PeatlandVFGKLMHEKRLREEELRGLGEDKLKLIRSFAKFLAEDTAA
Ga0187855_1081700613300018038PeatlandYDFRGLPLTDVLGRLLYENRLSEEELRGLGEDKRKLIRSFAKFLAEDTAA
Ga0187887_1001365483300018043PeatlandVKLLHEKRLREEELRGLREDKLKSIRSLAKFFAEDAA
Ga0187887_1007909313300018043PeatlandRLLYEKRLREEELRGLRADKLKPIRSVAKFLAEDVA
Ga0187773_1011718713300018064Tropical PeatlandQVFGRLLYEGRIREEELSGLREDKLKLIRSFAEFLTKDAA
Ga0193723_105533413300019879SoilHVFGKLLQEGRLGEEELRGLREDKLKSIRSYAKFLAEMDAA
Ga0193751_105724033300019888SoilKRLRESRLGEEELRGLREDKLKSIRSYAKFLAEMDAA
Ga0210407_1003211843300020579SoilFGRLLYEGRVSEEELGGLREDKLKPIRSFAKFLAEDAA
Ga0210401_1011609333300020583SoilRLLYEKRLREDELRGLREDKLKSIHSLAKFLAEDAA
Ga0215015_1050813023300021046SoilLLYEGRVSEEELRGLQEDKLKSIRSLAKFLAEDAA
Ga0210404_1090949523300021088SoilESQLAGVLGRLLYENRLSEEELRGLREDKMESIRSFAKFLRESAA
Ga0210396_1119658623300021180SoilRLLYEGRLNEQELRDLADDKLKSIRSFAKFLAEDAVA
Ga0210393_1009012013300021401SoilHLSQVFGKLLCETRVSEEELRGFSEDKLKAIRSFAKFLAEDVA
Ga0210397_1013748613300021403SoilTQVFGRLLYEKRLREEELRGLREDKLKPIRSFAKFLAADAA
Ga0210397_1122070413300021403SoilGRLLHEGRLSEEELRGLREDKLTPIRSFAKFLAEDAA
Ga0210394_1181101823300021420SoilHLTQVFGRLLYETRVSEEELRGFSEDKLKTIRSFARFLAEDAA
Ga0210409_1042613213300021559SoilRLLYEKRLREEELRGLREDKLKPIRSFAKFLAEDAA
Ga0210409_1051049523300021559SoilSQLTHVFGRLLHEKRLREEDLRGLREDKLTSIRSFAKFLAEDAA
Ga0126371_1094485123300021560Tropical Forest SoilLLYETRVSEEELRGFSEDKLKTIHSFARFLAEDAV
Ga0126371_1143270613300021560Tropical Forest SoilRLLYETRVSEEALRGFSEDKIKTIHSFARFLAEDAA
Ga0242653_101859923300022712SoilGRLLYENRLSEEDLRGLREDKVNLIRSFAKFLAEEAA
Ga0224521_112106823300024233SoilLYENRLSEEELRGLGEDKLKLIRSFAKFLAEDTAA
Ga0208821_103977533300025432PeatlandGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA
Ga0208189_100526913300025444PeatlandRYSHLTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA
Ga0208937_100502163300025506PeatlandTQVFGRLLHETRVSEEELRGFSEDKLKTIRSFAKFLAEDAA
Ga0209584_1003298723300025878Arctic Peat SoilLHEGRLTEHDLRGLREDKLEAIRSDADFLRRRGEAI
Ga0207699_1099427213300025906Corn, Switchgrass And Miscanthus RhizospherePDVLGRLLYENRLREEELRGLREDKLKPIRSCAKFLAEEAA
Ga0207699_1130325623300025906Corn, Switchgrass And Miscanthus RhizosphereSSRLTPVFGRLLFEHRVSENELRGLGEDKRKAIHSCAKFLAEDAA
Ga0207663_1124212513300025916Corn, Switchgrass And Miscanthus RhizosphereRLPVVLGRLLYENRLREEELRGLREDKLKPIRSCAKFLAEEAA
Ga0207663_1174878413300025916Corn, Switchgrass And Miscanthus RhizosphereRLTHVFGRLLYERRITEEDLRGLGEDKLKPIRSIAEFLAEDTAA
Ga0207660_1032299213300025917Corn RhizosphereYSQLTNVFGRLLYEKRISVDELSGLGENKLKPIRSLAELLTKDAAGLI
Ga0207646_1025031533300025922Corn, Switchgrass And Miscanthus RhizosphereYEYKYSQLTHVFGRLLHEQRLCEEELRGLREDKLTSIRSFAKFLSEDAAA
Ga0207646_1046801223300025922Corn, Switchgrass And Miscanthus RhizosphereRLLYEKRLRQEELCGLREDKLKPIRSFAKFLAGDAA
Ga0207687_1191963413300025927Miscanthus RhizosphereTHLFGRLLQEGRLSEEELSGLREDKLKSIRSYAKFLAETEAA
Ga0209802_115824533300026328SoilLTHVFGRLLHERRLSEQELRGLREDELKPIRSSRNFLAETDAIA
Ga0257164_100268413300026497SoilELLCELRLSEEELRGLRADKLEAIRSRAKVLSEDAA
Ga0209161_1030009023300026548SoilLFGRLLHERRLSEQELRGLREDKLKSIRSFAKCLAGMDAIA
Ga0209648_1013199423300026551Grasslands SoilVFGRLLYEKRLREDELRGLREDKLKSIHSLAKFLAEDAA
Ga0208199_107190523300027497Peatlands SoilNYRYSHLTQVFGRLLYETRVSEEELRGFSEDKLKTIRSFAKFLAETDAAA
Ga0209525_115198823300027575Forest SoilNYRYSHLTQVFGRLLYETRVSEEELRGFSEDKLTTIRSSAKFLAEDAA
Ga0208696_101498113300027696Peatlands SoilYSQLTHVFGKLLHEKRLREEDLRGLREDKLKSIRSLAKFLAEDAA
Ga0209701_1008939513300027862Vadose Zone SoilLVFGKLLRETRLGEEDVRGLREDKLESIRSYARFLAKMDAA
Ga0209624_1048140823300027895Forest SoilVFGRLLYETRVSEEELRGFSEDKLTTIRSSAKFLAEDAA
Ga0209067_1003774413300027898WatershedsLLYETRVSEEELRGFSKDKLKTIRSFAKFLTEDTA
Ga0209067_1005397633300027898WatershedsLLYETRVSEEELRGFSKDKLKTIRSFAKFLAEDAA
Ga0209006_1146690623300027908Forest SoilSHLTQVFGRLLYETRVSEEELRGFSEDKLTTIRSSAKFLAEDAA
Ga0209583_1060021413300027910WatershedsLLYEKRLREEELRGLGEDKLKPIRSFAKFLAEDAA
Ga0209698_1009919413300027911WatershedsLTHVFGKLLYEKRLGEEELRGLQEDKLTSIRSVAQFLAKYAA
Ga0209526_1004223613300028047Forest SoilSQLTHVFGRLLYEKRLSEEELRGLREDKLKSIRSLAKFLAEDVA
Ga0268264_1163816123300028381Switchgrass RhizosphereFGILLYEKRLRVEELRGLREDKLKLIHSCAEFLAKDAA
Ga0137415_1028744813300028536Vadose Zone SoilTHVFGRLLHEQRLCEEELRGLREDKLKSIRSFAKFLSEDAAA
Ga0308309_1019560113300028906SoilHVFGRLLYEGRVSEEELRGLQEDKLKSIRSLAKFLAEDAA
Ga0311334_1072697413300029987FenRVFGKLLSENRLREEDLRGLQEDKLKSIRSQAKFFAEMDAA
Ga0311336_1005537933300029990FenYDHRHSHLTRVFGKLLCENRLREKDLRGLQEDKLKSIRSQAKFFAEMDAA
Ga0311338_1171931223300030007PalsaGRLSYEKRLGEEELGGLREDKLKPIRSFAKFLAENTTA
Ga0302316_1047481413300030646PalsaSHLTQVLGELLHEKRISERELRGLHEDKLNSVRSFAKLLAESVA
Ga0170823_1732534323300031128Forest SoilYSRLTQVFGKLLYEKRLREEELRGLQEDKLNSIRSVAQFLAKYAA
Ga0265340_1027691313300031247RhizosphereNYRYSHLTQVFGRLLYETRVSEEELRGFSEDKLKTIRSFAKFSAEDAA
Ga0170818_11252943523300031474Forest SoilRPSRLTQEFGRFLCESRVSEEELRGLHAEKLKAIRSLAKLLAEDAA
Ga0307476_1009033613300031715Hardwood Forest SoilLTEAFGRLLYEKRLGEDELGGLREDKLRSIRSFAKFLAEGTAA
Ga0306917_1009642313300031719SoilFGRLLYETRVSEEELRGFSEDKLKTIHSFARFLAEDAA
Ga0307475_1007149413300031754Hardwood Forest SoilVFGKLLYEKRLREDELCGLREDKLNSIRSVASFLAKYAA
Ga0307478_1095716613300031823Hardwood Forest SoilLTQVFGRLLYETRVSEEELRGFSEDKLKTIRSFAKFLADDA
Ga0306923_1027325633300031910SoilHLTQVFGRLLYETRVSEEELRGFSEDKLKTIHSFARFLAEDAA
Ga0307479_1003211513300031962Hardwood Forest SoilLLYEKRLREDALRGLREDKLKSIHSLAKFLAEDAA
Ga0307479_1040253313300031962Hardwood Forest SoilFGRLLYEKRLREDELRGLREDKLKSIHSLAKFLAKDAA
Ga0307470_1018471913300032174Hardwood Forest SoilGRLLYEGQVSEEELGGLREDKLKPIRSFAKFLAEDAA
Ga0307471_10020384833300032180Hardwood Forest SoilYRYSKLTQVFGRLLYEKRLREEELHGLREDKLKPIRSFAKFLAEDAA
Ga0307472_10192674513300032205Hardwood Forest SoilQVFGRLLYEKRLREEELRGLREDKLKPIRSLAKFLAEDAA
Ga0307472_10220980013300032205Hardwood Forest SoilYKYSQLTHVFGRLLHEQRLCEEELRGLREDKLKSIRSFAKFLSEDAAA
Ga0335085_1008002313300032770SoilGRLLHERRVSEEELRGLREDKLASIRSVAEFLAKYAA
Ga0335079_1020903513300032783SoilRYSQLTHVFGRLLYEGRVSEEDLCRLRDDKLKPIRSFAKFLAEDTAA
Ga0335080_1182252613300032828SoilAFRLSRLTQVFGKLLSERRITEEELRGFSEDKVKSIRSCAQFLAENAA
Ga0335071_10003581153300032897SoilGRLLHERRVSEEELRGLCEDKLASIRSVAEFLAKYAA
Ga0335077_1108616333300033158SoilLTDVFGRLLYEGRLKERELQGLQEDKLKSIRSFAKTKDAVA
Ga0373959_0009913_3_1133300034820Rhizosphere SoilRLLYEKRLREEELRSLREDKLKAIRSCAKFLAEDAA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.