Metagenome / Metatranscriptome Family F026593

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F026593
Family Type	Metagenome / Metatranscriptome
Number of Sequences	197
Average Sequence Length	43 residues
Representative Sequence	YNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF
Number of Associated Samples	152
Number of Associated Scaffolds	197

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	99.49 %
% of genes from short scaffolds (< 2000 bps)	94.92 %
Associated GOLD sequencing projects	138
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (79.695 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.706 % of family members)
Environment Ontology (ENVO)	Unclassified (39.086 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant rhizosphere (57.360 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.14
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 197 Family Scaffolds
PF13517	FG-GAP_3	12.18
PF07593	UnbV_ASPIC	9.14
PF13620	CarboxypepD_reg	8.63
PF01212	Beta_elim_lyase	4.57
PF01799	Fer2_2	3.55
PF02371	Transposase_20	2.54
PF12836	HHH_3	2.54
PF00106	adh_short	2.03
PF01436	NHL	1.52
PF12681	Glyoxalase_2	1.52
PF12704	MacB_PCD	1.52
PF03372	Exo_endo_phos	1.02
PF02687	FtsX	1.02
PF00313	CSD	1.02
PF00111	Fer2	1.02
PF03551	PadR	1.02
PF13672	PP2C_2	1.02
PF08331	QueG_DUF1730	0.51
PF13282	DUF4070	0.51
PF05190	MutS_IV	0.51
PF02823	ATP-synt_DE_N	0.51
PF00202	Aminotran_3	0.51
PF03972	MmgE_PrpD	0.51
PF02738	MoCoBD_1	0.51
PF09594	GT87	0.51
PF09994	DUF2235	0.51
PF01872	RibD_C	0.51
PF13181	TPR_8	0.51
PF13673	Acetyltransf_10	0.51
PF14108	ABA4-like	0.51
PF09359	VTC	0.51
PF00144	Beta-lactamase	0.51
PF00355	Rieske	0.51
PF00589	Phage_integrase	0.51
PF02826	2-Hacid_dh_C	0.51
PF14559	TPR_19	0.51
PF00011	HSP20	0.51
PF00486	Trans_reg_C	0.51
PF00903	Glyoxalase	0.51
PF08281	Sigma70_r4_2	0.51

COG ID	Name	Functional Category	% Frequency in 197 Family Scaffolds
COG1167	DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain	Transcription [K]	9.14
COG0075	Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG	Amino acid transport and metabolism [E]	4.57
COG4992	Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase	Amino acid transport and metabolism [E]	4.57
COG3033	Tryptophanase	Amino acid transport and metabolism [E]	4.57
COG2873	O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent	Amino acid transport and metabolism [E]	4.57
COG2008	Threonine aldolase	Amino acid transport and metabolism [E]	4.57
COG1982	Arginine/lysine/ornithine decarboxylase	Amino acid transport and metabolism [E]	4.57
COG1921	Seryl-tRNA(Sec) selenium transferase	Translation, ribosomal structure and biogenesis [J]	4.57
COG1104	Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family	Amino acid transport and metabolism [E]	4.57
COG1003	Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain	Amino acid transport and metabolism [E]	4.57
COG0626	Cystathionine beta-lyase/cystathionine gamma-synthase	Amino acid transport and metabolism [E]	4.57
COG0436	Aspartate/methionine/tyrosine aminotransferase	Amino acid transport and metabolism [E]	4.57
COG0399	dTDP-4-amino-4,6-dideoxygalactose transaminase	Cell wall/membrane/envelope biogenesis [M]	4.57
COG0520	Selenocysteine lyase/Cysteine desulfurase	Amino acid transport and metabolism [E]	4.57
COG0076	Glutamate or tyrosine decarboxylase or a related PLP-dependent protein	Amino acid transport and metabolism [E]	4.57
COG0112	Glycine/serine hydroxymethyltransferase	Amino acid transport and metabolism [E]	4.57
COG0156	7-keto-8-aminopelargonate synthetase or related enzyme	Coenzyme transport and metabolism [H]	4.57
COG3547	Transposase	Mobilome: prophages, transposons [X]	2.54
COG1695	DNA-binding transcriptional regulator, PadR family	Transcription [K]	1.02
COG1733	DNA-binding transcriptional regulator, HxlR family	Transcription [K]	1.02
COG1846	DNA-binding transcriptional regulator, MarR family	Transcription [K]	1.02
COG0071	Small heat shock protein IbpA, HSP20 family	Posttranslational modification, protein turnover, chaperones [O]	0.51
COG2367	Beta-lactamase class A	Defense mechanisms [V]	0.51
COG2079	2-methylcitrate dehydratase PrpD	Carbohydrate transport and metabolism [G]	0.51
COG1985	Pyrimidine reductase, riboflavin biosynthesis	Coenzyme transport and metabolism [H]	0.51
COG0249	DNA mismatch repair ATPase MutS	Replication, recombination and repair [L]	0.51
COG0262	Dihydrofolate reductase	Coenzyme transport and metabolism [H]	0.51
COG1686	D-alanyl-D-alanine carboxypeptidase	Cell wall/membrane/envelope biogenesis [M]	0.51
COG1680	CubicO group peptidase, beta-lactamase class C family	Defense mechanisms [V]	0.51
COG1600	Epoxyqueuosine reductase QueG (queuosine biosynthesis)	Translation, ribosomal structure and biogenesis [J]	0.51
COG0355	FoF1-type ATP synthase, epsilon subunit	Energy production and conversion [C]	0.51

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	79.70 %
Unclassified	root	N/A	20.30 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	79.70 %
Unclassified	root	N/A	20.30 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	79.70 %
Unclassified	root	N/A	20.30 %

Name	Rank	Taxonomy	Distribution
Acidobacteria	phylum	All Organisms → cellular organisms → Bacteria → Acidobacteria	32.99 %
Unclassified	root	N/A	20.30 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	6.09 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.02 %
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	0.51 %
PVC group	clade	All Organisms → cellular organisms → Bacteria → PVC group	0.51 %

Name	Rank	Taxonomy	Distribution
unclassified Acidobacteria	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria	24.87 %
Unclassified	root	N/A	20.30 %
Vicinamibacteria	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria	2.03 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	2.03 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.02 %
Blastocatellia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia	0.51 %
Acidobacteriia	class	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia	0.51 %
Planctomycetes	phylum	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes	0.51 %
Gemmatimonadetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes	0.51 %
Alphaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	0.51 %
delta/epsilon subdivisions	subphylum	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions	0.51 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	24.87 %
Unclassified	root	N/A	20.30 %
Vicinamibacterales	order	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales	2.03 %
Clostridia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia	1.02 %
unclassified Blastocatellia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia	0.51 %
unclassified Terriglobia	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia	0.51 %
Deltaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria	0.51 %
unclassified Gemmatimonadetes	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes	0.51 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.51 %
Planctomycetia	class	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia	0.51 %
Methylococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales	0.51 %
Xanthomonadales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales	0.51 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	24.87 %
Unclassified	root	N/A	20.30 %
Vicinamibacteraceae	family	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae	2.03 %
Eubacteriales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	1.02 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.51 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	0.51 %
Myxococcales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales	0.51 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.51 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.51 %
Planctomycetales	order	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales	0.51 %
unclassified Xanthomonadales	no rank	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales	0.51 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.51 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	24.87 %
Unclassified	root	N/A	20.30 %
Luteitalea	genus	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea	2.03 %
Oscillospiraceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae	1.02 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.51 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.51 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.51 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.51 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	0.51 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.51 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.51 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.51 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	24.87 %
Unclassified	root	N/A	20.30 %
unclassified Luteitalea	no rank	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea	1.52 %
Flavonifractor	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Flavonifractor	1.02 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	0.51 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.51 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.51 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.51 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.51 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	0.51 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.51 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.51 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.51 %

Name	Rank	Taxonomy	Distribution
Acidobacteria bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	24.87 %
Unclassified	root	N/A	20.30 %
Luteitalea sp. TBR-22	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22	1.52 %
Flavonifractor plautii	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Flavonifractor → Flavonifractor plautii	1.02 %
Luteitalea pratensis	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	0.51 %
Planctomycetaceae	family	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	0.51 %
Xanthomonadales bacterium	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	0.51 %
Cystobacterineae	suborder	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	0.51 %
Gemmatimonadetes bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	0.51 %
Methylococcaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	0.51 %
Blastocatellia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	0.51 %
Acidobacteriia bacterium	species	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	0.51 %
Rhodospirillales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	0.51 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
2124908009\|FWIRA_GRAM18401BHLX8	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	546	Open in IMG/M
3300000956\|JGI10216J12902_100453521	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300000956\|JGI10216J12902_103159241	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae	1256	Open in IMG/M
3300000956\|JGI10216J12902_114045518	Not Available	827	Open in IMG/M
3300002076\|JGI24749J21850_1057615	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	587	Open in IMG/M
3300004020\|Ga0055440_10041564	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	983	Open in IMG/M
3300004463\|Ga0063356_101607036	Not Available	968	Open in IMG/M
3300004480\|Ga0062592_102082272	All Organisms → cellular organisms → Bacteria → Acidobacteria	563	Open in IMG/M
3300004643\|Ga0062591_102817703	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	515	Open in IMG/M
3300005290\|Ga0065712_10198669	All Organisms → cellular organisms → Bacteria	1117	Open in IMG/M
3300005295\|Ga0065707_10551524	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	720	Open in IMG/M
3300005330\|Ga0070690_100262263	All Organisms → cellular organisms → Bacteria	1226	Open in IMG/M
3300005332\|Ga0066388_103904218	All Organisms → cellular organisms → Bacteria	761	Open in IMG/M
3300005333\|Ga0070677_10044022	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1775	Open in IMG/M
3300005343\|Ga0070687_100676383	All Organisms → cellular organisms → Bacteria	718	Open in IMG/M
3300005353\|Ga0070669_100152962	All Organisms → cellular organisms → Bacteria → Proteobacteria	1787	Open in IMG/M
3300005364\|Ga0070673_100037021	All Organisms → cellular organisms → Bacteria	3714	Open in IMG/M
3300005365\|Ga0070688_100983969	All Organisms → cellular organisms → Bacteria	669	Open in IMG/M
3300005436\|Ga0070713_101420286	All Organisms → cellular organisms → Bacteria	673	Open in IMG/M
3300005441\|Ga0070700_101224050	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	628	Open in IMG/M
3300005441\|Ga0070700_101967809	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	506	Open in IMG/M
3300005456\|Ga0070678_101923468	All Organisms → cellular organisms → Bacteria → Acidobacteria	559	Open in IMG/M
3300005457\|Ga0070662_101227845	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	645	Open in IMG/M
3300005466\|Ga0070685_10080959	All Organisms → cellular organisms → Bacteria	1946	Open in IMG/M
3300005466\|Ga0070685_10997958	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	628	Open in IMG/M
3300005466\|Ga0070685_11343074	All Organisms → cellular organisms → Bacteria	547	Open in IMG/M
3300005529\|Ga0070741_11068500	All Organisms → cellular organisms → Bacteria	688	Open in IMG/M
3300005536\|Ga0070697_101383850	All Organisms → cellular organisms → Bacteria	628	Open in IMG/M
3300005543\|Ga0070672_101395377	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	626	Open in IMG/M
3300005543\|Ga0070672_101629448	All Organisms → cellular organisms → Bacteria	579	Open in IMG/M
3300005543\|Ga0070672_101780950	Not Available	554	Open in IMG/M
3300005545\|Ga0070695_100129966	All Organisms → cellular organisms → Bacteria	1735	Open in IMG/M
3300005548\|Ga0070665_102096052	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300005548\|Ga0070665_102536520	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	514	Open in IMG/M
3300005549\|Ga0070704_100757143	Not Available	865	Open in IMG/M
3300005615\|Ga0070702_100031127	All Organisms → cellular organisms → Bacteria	2917	Open in IMG/M
3300005617\|Ga0068859_101027481	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	906	Open in IMG/M
3300005617\|Ga0068859_101732294	Not Available	690	Open in IMG/M
3300005617\|Ga0068859_102380648	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	584	Open in IMG/M
3300005713\|Ga0066905_101624518	All Organisms → cellular organisms → Bacteria	592	Open in IMG/M
3300005718\|Ga0068866_10184481	All Organisms → cellular organisms → Bacteria	1235	Open in IMG/M
3300005718\|Ga0068866_10594901	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	746	Open in IMG/M
3300005719\|Ga0068861_102318432	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22	539	Open in IMG/M
3300005764\|Ga0066903_101930275	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1132	Open in IMG/M
3300005764\|Ga0066903_104592436	All Organisms → cellular organisms → Bacteria → Acidobacteria	736	Open in IMG/M
3300005829\|Ga0074479_10021910	All Organisms → cellular organisms → Bacteria	673	Open in IMG/M
3300005836\|Ga0074470_10431342	All Organisms → cellular organisms → Bacteria → Proteobacteria	3082	Open in IMG/M
3300005840\|Ga0068870_10505863	Not Available	806	Open in IMG/M
3300005840\|Ga0068870_10941846	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	612	Open in IMG/M
3300005840\|Ga0068870_11222867	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	545	Open in IMG/M
3300005843\|Ga0068860_101058564	Not Available	830	Open in IMG/M
3300005844\|Ga0068862_100509724	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1143	Open in IMG/M
3300005937\|Ga0081455_10088471	All Organisms → cellular organisms → Bacteria	2516	Open in IMG/M
3300006058\|Ga0075432_10195401	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	798	Open in IMG/M
3300006237\|Ga0097621_100765541	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Flavonifractor → Flavonifractor plautii	893	Open in IMG/M
3300006237\|Ga0097621_101332191	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	679	Open in IMG/M
3300006237\|Ga0097621_102181082	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	530	Open in IMG/M
3300006844\|Ga0075428_101070867	All Organisms → cellular organisms → Bacteria → Acidobacteria	852	Open in IMG/M
3300006844\|Ga0075428_101985529	All Organisms → cellular organisms → Bacteria	603	Open in IMG/M
3300006845\|Ga0075421_100510886	All Organisms → cellular organisms → Bacteria	1426	Open in IMG/M
3300006845\|Ga0075421_102551057	All Organisms → cellular organisms → Bacteria	531	Open in IMG/M
3300006846\|Ga0075430_100261005	All Organisms → cellular organisms → Bacteria	1435	Open in IMG/M
3300006847\|Ga0075431_102047180	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300006876\|Ga0079217_10690907	Not Available	684	Open in IMG/M
3300006881\|Ga0068865_100791600	All Organisms → cellular organisms → Bacteria	817	Open in IMG/M
3300006894\|Ga0079215_10158483	All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium	1092	Open in IMG/M
3300006918\|Ga0079216_10296330	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	954	Open in IMG/M
3300006918\|Ga0079216_10795313	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	693	Open in IMG/M
3300007004\|Ga0079218_11984834	All Organisms → cellular organisms → Bacteria	663	Open in IMG/M
3300009012\|Ga0066710_104798148	Not Available	506	Open in IMG/M
3300009036\|Ga0105244_10412951	All Organisms → cellular organisms → Bacteria	621	Open in IMG/M
3300009053\|Ga0105095_10123694	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1407	Open in IMG/M
3300009078\|Ga0105106_10972073	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales	604	Open in IMG/M
3300009094\|Ga0111539_12562286	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae	591	Open in IMG/M
3300009094\|Ga0111539_13086045	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	538	Open in IMG/M
3300009094\|Ga0111539_13232344	Not Available	525	Open in IMG/M
3300009147\|Ga0114129_13159306	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300009156\|Ga0111538_11502886	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	849	Open in IMG/M
3300009156\|Ga0111538_12329554	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22	672	Open in IMG/M
3300009162\|Ga0075423_12399588	All Organisms → cellular organisms → Bacteria	575	Open in IMG/M
3300009177\|Ga0105248_10741626	Not Available	1108	Open in IMG/M
3300009514\|Ga0129284_10232444	Not Available	824	Open in IMG/M
3300009551\|Ga0105238_12868587	All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium	518	Open in IMG/M
3300009553\|Ga0105249_12277870	All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium	614	Open in IMG/M
3300009840\|Ga0126313_11358080	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	588	Open in IMG/M
3300010159\|Ga0099796_10551121	All Organisms → cellular organisms → Bacteria	518	Open in IMG/M
3300010301\|Ga0134070_10226618	All Organisms → cellular organisms → Bacteria	693	Open in IMG/M
3300010358\|Ga0126370_11441639	All Organisms → cellular organisms → Bacteria	652	Open in IMG/M
3300010358\|Ga0126370_11884139	All Organisms → cellular organisms → Bacteria	581	Open in IMG/M
3300010362\|Ga0126377_13482287	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	509	Open in IMG/M
3300010366\|Ga0126379_12862192	Not Available	577	Open in IMG/M
3300010398\|Ga0126383_13387664	All Organisms → cellular organisms → Bacteria	521	Open in IMG/M
3300010400\|Ga0134122_10948710	All Organisms → cellular organisms → Bacteria	837	Open in IMG/M
3300010403\|Ga0134123_13050092	All Organisms → cellular organisms → Bacteria	537	Open in IMG/M
3300011410\|Ga0137440_1050332	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	796	Open in IMG/M
3300011415\|Ga0137325_1108744	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	631	Open in IMG/M
3300012212\|Ga0150985_109650128	Not Available	573	Open in IMG/M
3300012232\|Ga0137435_1218999	Not Available	581	Open in IMG/M
3300012893\|Ga0157284_10194995	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	606	Open in IMG/M
3300012898\|Ga0157293_10313822	Not Available	523	Open in IMG/M
3300012902\|Ga0157291_10019313	All Organisms → cellular organisms → Bacteria	1338	Open in IMG/M
3300012902\|Ga0157291_10125915	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	732	Open in IMG/M
3300012905\|Ga0157296_10160706	All Organisms → cellular organisms → Bacteria → Proteobacteria	682	Open in IMG/M
3300012909\|Ga0157290_10235977	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	642	Open in IMG/M
3300012925\|Ga0137419_10860063	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	745	Open in IMG/M
3300012948\|Ga0126375_10386773	All Organisms → cellular organisms → Bacteria	1006	Open in IMG/M
3300012948\|Ga0126375_12071105	Not Available	505	Open in IMG/M
3300012971\|Ga0126369_13591936	All Organisms → cellular organisms → Bacteria	508	Open in IMG/M
3300012989\|Ga0164305_11064827	Not Available	692	Open in IMG/M
3300013296\|Ga0157374_12012582	Not Available	604	Open in IMG/M
3300013297\|Ga0157378_10273671	All Organisms → cellular organisms → Bacteria	1625	Open in IMG/M
3300013306\|Ga0163162_11398844	All Organisms → cellular organisms → Bacteria	796	Open in IMG/M
3300013308\|Ga0157375_11696722	Not Available	748	Open in IMG/M
3300014325\|Ga0163163_11932083	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300014326\|Ga0157380_10146691	All Organisms → cellular organisms → Bacteria	2034	Open in IMG/M
3300014326\|Ga0157380_12660479	Not Available	567	Open in IMG/M
3300014969\|Ga0157376_10030056	All Organisms → cellular organisms → Bacteria	4333	Open in IMG/M
3300014969\|Ga0157376_10392282	Not Available	1340	Open in IMG/M
3300014969\|Ga0157376_12767234	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	530	Open in IMG/M
3300015201\|Ga0173478_10473989	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	620	Open in IMG/M
3300015201\|Ga0173478_10808115	All Organisms → cellular organisms → Bacteria	515	Open in IMG/M
3300015258\|Ga0180093_1033782	All Organisms → cellular organisms → Bacteria	1105	Open in IMG/M
3300015371\|Ga0132258_13438270	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1086	Open in IMG/M
3300015372\|Ga0132256_100439723	Not Available	1410	Open in IMG/M
3300015374\|Ga0132255_101002814	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1252	Open in IMG/M
3300016445\|Ga0182038_11123095	All Organisms → cellular organisms → Bacteria	699	Open in IMG/M
3300016445\|Ga0182038_11341495	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300018074\|Ga0184640_10161458	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1003	Open in IMG/M
3300018081\|Ga0184625_10373495	All Organisms → cellular organisms → Bacteria → Proteobacteria	739	Open in IMG/M
3300018083\|Ga0184628_10278427	Not Available	879	Open in IMG/M
3300018432\|Ga0190275_11567139	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium	736	Open in IMG/M
3300018468\|Ga0066662_12694825	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	526	Open in IMG/M
3300018469\|Ga0190270_10911833	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	897	Open in IMG/M
3300018469\|Ga0190270_11406091	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	744	Open in IMG/M
3300018469\|Ga0190270_11750152	All Organisms → cellular organisms → Bacteria → Acidobacteria	676	Open in IMG/M
3300018469\|Ga0190270_12667927	All Organisms → cellular organisms → Bacteria	562	Open in IMG/M
3300018476\|Ga0190274_10587360	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1137	Open in IMG/M
3300018476\|Ga0190274_10982052	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	917	Open in IMG/M
3300018476\|Ga0190274_11353670	All Organisms → cellular organisms → Bacteria	800	Open in IMG/M
3300018476\|Ga0190274_11678162	All Organisms → cellular organisms → Bacteria	729	Open in IMG/M
3300018476\|Ga0190274_12599036	All Organisms → cellular organisms → Bacteria → Acidobacteria	603	Open in IMG/M
3300018476\|Ga0190274_13657298	Not Available	520	Open in IMG/M
3300021082\|Ga0210380_10413817	All Organisms → cellular organisms → Bacteria	617	Open in IMG/M
3300021082\|Ga0210380_10488300	Not Available	564	Open in IMG/M
3300021332\|Ga0210339_1418875	Not Available	612	Open in IMG/M
3300022756\|Ga0222622_10297859	Not Available	1109	Open in IMG/M
3300022911\|Ga0247783_1032611	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis	1358	Open in IMG/M
3300023102\|Ga0247754_1159116	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	563	Open in IMG/M
3300025165\|Ga0209108_10207425	All Organisms → cellular organisms → Bacteria	1010	Open in IMG/M
3300025899\|Ga0207642_10031329	All Organisms → cellular organisms → Bacteria	2226	Open in IMG/M
3300025910\|Ga0207684_11716719	All Organisms → cellular organisms → Bacteria	505	Open in IMG/M
3300025918\|Ga0207662_10836590	Not Available	650	Open in IMG/M
3300025923\|Ga0207681_10132040	All Organisms → cellular organisms → Bacteria	1848	Open in IMG/M
3300025923\|Ga0207681_11398543	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	587	Open in IMG/M
3300025925\|Ga0207650_10594491	All Organisms → cellular organisms → Bacteria	930	Open in IMG/M
3300025928\|Ga0207700_11796321	All Organisms → cellular organisms → Bacteria	539	Open in IMG/M
3300025931\|Ga0207644_10526570	All Organisms → cellular organisms → Bacteria	977	Open in IMG/M
3300025938\|Ga0207704_11177691	All Organisms → cellular organisms → Bacteria	653	Open in IMG/M
3300025941\|Ga0207711_10211488	All Organisms → cellular organisms → Bacteria	1771	Open in IMG/M
3300025960\|Ga0207651_11008596	All Organisms → cellular organisms → Bacteria	744	Open in IMG/M
3300025972\|Ga0207668_10117182	Not Available	2010	Open in IMG/M
3300025986\|Ga0207658_10690761	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Flavonifractor → Flavonifractor plautii	922	Open in IMG/M
3300026088\|Ga0207641_11040045	All Organisms → cellular organisms → Bacteria	816	Open in IMG/M
3300026089\|Ga0207648_10163850	All Organisms → cellular organisms → Bacteria	1964	Open in IMG/M
3300026089\|Ga0207648_10729268	All Organisms → cellular organisms → Bacteria → Proteobacteria	920	Open in IMG/M
3300026095\|Ga0207676_10503718	All Organisms → cellular organisms → Bacteria	1150	Open in IMG/M
3300026118\|Ga0207675_100199548	All Organisms → cellular organisms → Bacteria → Acidobacteria	1921	Open in IMG/M
3300026121\|Ga0207683_11663112	All Organisms → cellular organisms → Bacteria → Acidobacteria	588	Open in IMG/M
3300027880\|Ga0209481_10247323	Not Available	898	Open in IMG/M
3300027886\|Ga0209486_10000943	All Organisms → cellular organisms → Bacteria	12730	Open in IMG/M
3300027993\|Ga0247749_1003132	All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22	1456	Open in IMG/M
3300028047\|Ga0209526_10873817	All Organisms → cellular organisms → Bacteria → Acidobacteria	549	Open in IMG/M
3300028380\|Ga0268265_11841192	All Organisms → cellular organisms → Bacteria	612	Open in IMG/M
3300028380\|Ga0268265_11908278	Not Available	601	Open in IMG/M
3300028380\|Ga0268265_11920365	All Organisms → cellular organisms → Bacteria	599	Open in IMG/M
3300028381\|Ga0268264_10654563	Not Available	1040	Open in IMG/M
3300028381\|Ga0268264_11046346	Not Available	824	Open in IMG/M
3300031152\|Ga0307501_10151160	Not Available	631	Open in IMG/M
3300031170\|Ga0307498_10159102	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	756	Open in IMG/M
3300031226\|Ga0307497_10499336	Not Available	600	Open in IMG/M
3300031847\|Ga0310907_10843481	All Organisms → cellular organisms → Bacteria → Acidobacteria	515	Open in IMG/M
3300031854\|Ga0310904_10302510	All Organisms → cellular organisms → Bacteria	1013	Open in IMG/M
3300031858\|Ga0310892_10708906	All Organisms → cellular organisms → Bacteria	691	Open in IMG/M
3300031942\|Ga0310916_11163661	All Organisms → cellular organisms → Bacteria	639	Open in IMG/M
3300031944\|Ga0310884_10637025	All Organisms → cellular organisms → Bacteria	640	Open in IMG/M
3300031946\|Ga0310910_10747754	Not Available	772	Open in IMG/M
3300032013\|Ga0310906_10128943	All Organisms → cellular organisms → Bacteria	1441	Open in IMG/M
3300032059\|Ga0318533_11345188	All Organisms → cellular organisms → Bacteria	522	Open in IMG/M
3300032075\|Ga0310890_10047864	All Organisms → cellular organisms → Bacteria	2428	Open in IMG/M
3300032122\|Ga0310895_10691835	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	530	Open in IMG/M
3300032157\|Ga0315912_10899678	Not Available	704	Open in IMG/M
3300032157\|Ga0315912_11627436	Not Available	508	Open in IMG/M
3300032211\|Ga0310896_10050637	All Organisms → cellular organisms → Bacteria → Proteobacteria	1676	Open in IMG/M
3300032421\|Ga0310812_10281592	Not Available	736	Open in IMG/M
3300033004\|Ga0335084_10365641	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	1488	Open in IMG/M
3300033412\|Ga0310810_11093311	All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae	665	Open in IMG/M
3300034660\|Ga0314781_108377	All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium	566	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	57.87%
Host-Associated	Host-Associated	42.13%

Habitat	Taxonomy	Distribution
Terrestrial	Environmental → Terrestrial	49.24%
Plants	Host-Associated → Plants	42.13%
Aquatic	Environmental → Aquatic	8.63%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil	48.73%
Rhizosphere	Host-Associated → Plants → Rhizosphere	22.84%
Rhizoplane	Host-Associated → Plants → Rhizoplane	17.26%
Sediment	Environmental → Aquatic → Sediment	5.08%
Freshwater	Environmental → Aquatic → Freshwater	2.03%
Roots	Host-Associated → Plants → Roots	2.03%
Marine	Environmental → Aquatic → Marine	1.02%
Unclassified	Environmental → Aquatic → Unclassified	0.51%
Plant Litter	Environmental → Terrestrial → Plant Litter	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified	37.56%
Epiphytes	Host-Associated → Plants → Rhizoplane → Epiphytes	14.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	14.21%
Loam	Environmental → Terrestrial → Soil → Loam	10.66%
Soil	Host-Associated → Plants → Rhizosphere → Soil	8.63%
Unclassified	Environmental → Aquatic → Sediment → Unclassified	5.08%
Sediment	Environmental → Aquatic → Freshwater → Sediment	2.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified	2.03%
Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere	2.03%
Soil	Host-Associated → Plants → Rhizoplane → Soil	1.02%
Intertidal Zone	Environmental → Aquatic → Marine → Intertidal Zone	0.51%
Wetlands	Environmental → Aquatic → Marine → Wetlands	0.51%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified	0.51%
Wetlands	Environmental → Terrestrial → Soil → Wetlands	0.51%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Terrestrial → Soil → Unclassified → Unclassified	22.84%
Unclassified	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified	14.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	14.21%
Unclassified	Host-Associated → Plants → Rhizosphere → Soil → Unclassified	8.63%
Agricultural Soil	Environmental → Terrestrial → Soil → Loam → Agricultural Soil	8.12%
Unclassified	Environmental → Aquatic → Sediment → Unclassified → Unclassified	5.08%
Agricultural Land	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land	5.08%
Agricultural	Environmental → Terrestrial → Soil → Unclassified → Agricultural	4.57%
Grasslands	Environmental → Terrestrial → Soil → Unclassified → Grasslands	2.54%
Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil	2.54%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil	2.54%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	2.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified	2.03%
Soil	Host-Associated → Plants → Roots → Rhizosphere → Soil	2.03%
Unclassified	Host-Associated → Plants → Rhizoplane → Soil → Unclassified	1.02%
Estuary	Environmental → Aquatic → Marine → Intertidal Zone → Estuary	0.51%
Unclassified	Environmental → Aquatic → Marine → Wetlands → Unclassified	0.51%
Unclassified	Environmental → Aquatic → Unclassified → Unclassified → Unclassified	0.51%
Unclassified	Environmental → Terrestrial → Soil → Wetlands → Unclassified	0.51%
Unclassified	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	13.71%
Populus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere	7.61%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	7.11%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere	5.58%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere	5.08%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil	4.57%
Corn, Switchgrass And Miscanthus Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere	4.57%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil	4.06%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere	3.55%
Agricultural Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil	3.05%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	3.05%
Soil	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil	2.03%
Tropical Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil	2.03%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere	2.03%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	1.52%
Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil	1.52%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.52%
Miscanthus Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere	1.52%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.52%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	1.02%
Groundwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment	1.02%
Sediment (Intertidal)	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal)	1.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil	1.02%
Vadose Zone Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil	1.02%
Terrestrial Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil	1.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil	1.02%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil	1.02%
Soil	Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil	1.02%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere	1.02%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere	1.02%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere	1.02%
Estuarine	Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine	0.51%
Natural And Restored Wetlands	Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands	0.51%
Groundwater Sediment	Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment	0.51%
Beach Aquifer Porewater	Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater	0.51%
Serpentine Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil	0.51%
Grasslands Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil	0.51%
Surface Soil	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil	0.51%
Switchgrass Rhizosphere	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere	0.51%
Soil	Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil	0.51%
Forest Soil	Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil	0.51%
Plant Litter	Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter	0.51%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere	0.51%
Avena Fatua Rhizosphere	Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere	0.51%
Tabebuia Heterophylla Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere	0.51%
Arabidopsis Thaliana Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere	0.51%
Corn, Switchgrass And Miscanthus Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere	0.51%
Switchgrass Rhizosphere	Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere	0.51%
Switchgrass Rhizosphere	Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere	0.51%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.51%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere	0.51%
Corn Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere	0.51%
Arabidopsis Rhizosphere	Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere	0.51%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
2124908009	Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2	Environmental	Open in IMG/M
3300000956	Soil microbial communities from Great Prairies - Kansas, Native Prairie soil	Environmental	Open in IMG/M
3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Host-Associated	Open in IMG/M
3300004020	Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2	Environmental	Open in IMG/M
3300004463	Combined assembly of Arabidopsis thaliana microbial communities	Host-Associated	Open in IMG/M
3300004480	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4	Environmental	Open in IMG/M
3300004643	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3	Environmental	Open in IMG/M
3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1	Host-Associated	Open in IMG/M
3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3	Environmental	Open in IMG/M
3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Environmental	Open in IMG/M
3300005332	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)	Environmental	Open in IMG/M
3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Host-Associated	Open in IMG/M
3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Environmental	Open in IMG/M
3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Host-Associated	Open in IMG/M
3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Host-Associated	Open in IMG/M
3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Environmental	Open in IMG/M
3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Environmental	Open in IMG/M
3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Environmental	Open in IMG/M
3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Host-Associated	Open in IMG/M
3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Host-Associated	Open in IMG/M
3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Environmental	Open in IMG/M
3300005529	Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1	Environmental	Open in IMG/M
3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Environmental	Open in IMG/M
3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Host-Associated	Open in IMG/M
3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Environmental	Open in IMG/M
3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Host-Associated	Open in IMG/M
3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Environmental	Open in IMG/M
3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Environmental	Open in IMG/M
3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Host-Associated	Open in IMG/M
3300005713	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)	Environmental	Open in IMG/M
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Host-Associated	Open in IMG/M
3300005764	Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)	Environmental	Open in IMG/M
3300005829	Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC	Environmental	Open in IMG/M
3300005836	Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB	Environmental	Open in IMG/M
3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Host-Associated	Open in IMG/M
3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Host-Associated	Open in IMG/M
3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Host-Associated	Open in IMG/M
3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Host-Associated	Open in IMG/M
3300006058	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Host-Associated	Open in IMG/M
3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2)	Host-Associated	Open in IMG/M
3300006844	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Host-Associated	Open in IMG/M
3300006845	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5	Host-Associated	Open in IMG/M
3300006846	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Host-Associated	Open in IMG/M
3300006847	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Host-Associated	Open in IMG/M
3300006876	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200	Environmental	Open in IMG/M
3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Host-Associated	Open in IMG/M
3300006894	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control	Environmental	Open in IMG/M
3300006918	Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100	Environmental	Open in IMG/M
3300007004	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost	Environmental	Open in IMG/M
3300009012	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159	Environmental	Open in IMG/M
3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Host-Associated	Open in IMG/M
3300009053	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015	Environmental	Open in IMG/M
3300009078	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015	Environmental	Open in IMG/M
3300009094	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2)	Host-Associated	Open in IMG/M
3300009147	Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)	Host-Associated	Open in IMG/M
3300009156	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)	Host-Associated	Open in IMG/M
3300009162	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2	Host-Associated	Open in IMG/M
3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Host-Associated	Open in IMG/M
3300009514	Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1W	Environmental	Open in IMG/M
3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Host-Associated	Open in IMG/M
3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Host-Associated	Open in IMG/M
3300009840	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A	Environmental	Open in IMG/M
3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Environmental	Open in IMG/M
3300010301	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015	Environmental	Open in IMG/M
3300010358	Tropical forest soil microbial communities from Panama - MetaG Plot_3	Environmental	Open in IMG/M
3300010362	Tropical forest soil microbial communities from Panama - MetaG Plot_22	Environmental	Open in IMG/M
3300010366	Tropical forest soil microbial communities from Panama - MetaG Plot_24	Environmental	Open in IMG/M
3300010398	Tropical forest soil microbial communities from Panama - MetaG Plot_35	Environmental	Open in IMG/M
3300010400	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2	Environmental	Open in IMG/M
3300010403	Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3	Environmental	Open in IMG/M
3300011410	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2	Environmental	Open in IMG/M
3300011415	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2	Environmental	Open in IMG/M
3300012212	Combined assembly of Hopland grassland soil	Host-Associated	Open in IMG/M
3300012232	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2	Environmental	Open in IMG/M
3300012893	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1	Environmental	Open in IMG/M
3300012898	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1	Environmental	Open in IMG/M
3300012902	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1	Environmental	Open in IMG/M
3300012905	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2	Environmental	Open in IMG/M
3300012909	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1	Environmental	Open in IMG/M
3300012925	Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)	Environmental	Open in IMG/M
3300012948	Tropical forest soil microbial communities from Panama - MetaG Plot_14	Environmental	Open in IMG/M
3300012971	Tropical forest soil microbial communities from Panama - MetaG Plot_1	Environmental	Open in IMG/M
3300012989	Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG	Environmental	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Host-Associated	Open in IMG/M
3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Host-Associated	Open in IMG/M
3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Host-Associated	Open in IMG/M
3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Host-Associated	Open in IMG/M
3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Host-Associated	Open in IMG/M
3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Host-Associated	Open in IMG/M
3300015201	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2)	Environmental	Open in IMG/M
3300015258	Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da	Environmental	Open in IMG/M
3300015371	Combined assembly of cpr5 and col0 rhizosphere and soil	Host-Associated	Open in IMG/M
3300015372	Soil combined assembly	Host-Associated	Open in IMG/M
3300015374	Col-0 rhizosphere combined assembly	Host-Associated	Open in IMG/M
3300016445	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108	Environmental	Open in IMG/M
3300018074	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2	Environmental	Open in IMG/M
3300018081	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1	Environmental	Open in IMG/M
3300018083	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1	Environmental	Open in IMG/M
3300018432	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T	Environmental	Open in IMG/M
3300018468	Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111	Environmental	Open in IMG/M
3300018469	Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T	Environmental	Open in IMG/M
3300018476	Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T	Environmental	Open in IMG/M
3300021082	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo	Environmental	Open in IMG/M
3300021332	Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300022756	Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1	Environmental	Open in IMG/M
3300022911	Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5	Environmental	Open in IMG/M
3300023102	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5	Environmental	Open in IMG/M
3300025165	Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1	Environmental	Open in IMG/M
3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)	Environmental	Open in IMG/M
3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)	Environmental	Open in IMG/M
3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)	Environmental	Open in IMG/M
3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)	Host-Associated	Open in IMG/M
3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)	Host-Associated	Open in IMG/M
3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)	Host-Associated	Open in IMG/M
3300027880	Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)	Host-Associated	Open in IMG/M
3300027886	Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)	Environmental	Open in IMG/M
3300027993	Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5	Environmental	Open in IMG/M
3300028047	Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)	Environmental	Open in IMG/M
3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes)	Host-Associated	Open in IMG/M
3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)	Host-Associated	Open in IMG/M
3300031152	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S	Environmental	Open in IMG/M
3300031170	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S	Environmental	Open in IMG/M
3300031226	Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S	Environmental	Open in IMG/M
3300031847	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4	Environmental	Open in IMG/M
3300031854	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1	Environmental	Open in IMG/M
3300031858	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2	Environmental	Open in IMG/M
3300031942	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176	Environmental	Open in IMG/M
3300031944	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1	Environmental	Open in IMG/M
3300031946	Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172	Environmental	Open in IMG/M
3300032013	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3	Environmental	Open in IMG/M
3300032059	Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27	Environmental	Open in IMG/M
3300032075	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3	Environmental	Open in IMG/M
3300032122	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4	Environmental	Open in IMG/M
3300032157	Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil	Environmental	Open in IMG/M
3300032211	Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1	Environmental	Open in IMG/M
3300032421	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3	Environmental	Open in IMG/M
3300033004	Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4	Environmental	Open in IMG/M
3300033412	Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC	Environmental	Open in IMG/M
3300034660	Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
FWIRA_05915560	2124908009	Soil	TGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF
JGI10216J12902_1004535211	3300000956	Soil	DLYNLFNANTGTAFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
JGI10216J12902_1031592413	3300000956	Soil	GFNQVFGNASTPATLGATWLRPNTILNPRYLRFNATVDF*
JGI10216J12902_1140455181	3300000956	Soil	NGNTATGYDNGFGTDGSTWLRPTAVLNPRFVRFNMTFDF*
JGI24749J21850_10576152	3300002076	Corn, Switchgrass And Miscanthus Rhizosphere	YNLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0055440_100415643	3300004020	Natural And Restored Wetlands	NANTGTSFNQNFGSDGSTWLRPNGILNPRYMRFNATVDF*
Ga0063356_1016070361	3300004463	Arabidopsis Thaliana Rhizosphere	DLYNLFNANTGTSFNQNFGADGSTWLRPNGILNPRYVRFNATVDF*
Ga0062592_1020822722	3300004480	Soil	NSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF*
Ga0062591_1028177031	3300004643	Soil	NLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0065712_101986693	3300005290	Miscanthus Rhizosphere	NLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0065707_105515242	3300005295	Switchgrass Rhizosphere	RKWCVSNANPGAAFNQTFSVGSPTYLRPTTILSPRFVRFNVTIDF*
Ga0070690_1002622632	3300005330	Switchgrass Rhizosphere	FNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0066388_1039042181	3300005332	Tropical Forest Soil	GQKRVILGADIYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF*
Ga0070677_100440221	3300005333	Miscanthus Rhizosphere	YNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0070687_1006763832	3300005343	Switchgrass Rhizosphere	FNANTGTAFNQNFGTNGATWLRPNAILNPRYARFNATVDF*
Ga0070669_1001529623	3300005353	Switchgrass Rhizosphere	FNDNTGTTFNQAFGTDGATWLRPTAVMSPRFVRFNVTVDF*
Ga0070673_1000370214	3300005364	Switchgrass Rhizosphere	TGTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF*
Ga0070688_1009839692	3300005365	Switchgrass Rhizosphere	NLFNANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF*
Ga0070713_1014202861	3300005436	Corn, Switchgrass And Miscanthus Rhizosphere	ADIYNLFNSNAGTAYNGQFGVDGSTWNRPTAILNPRFVQFNGRFDF*
Ga0070700_1012240501	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	MDLYNLFNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0070700_1019678092	3300005441	Corn, Switchgrass And Miscanthus Rhizosphere	IDLYNLFNANTGTTFNQAYGTDGAAWLRPTAIMNARFVRFNATIDF*
Ga0070678_1019234681	3300005456	Miscanthus Rhizosphere	LNANVGTAFNQGFGTDGALWMRPTAVLNPRFARFNVTFDF*
Ga0070662_1012278452	3300005457	Corn Rhizosphere	NANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0070685_100809591	3300005466	Switchgrass Rhizosphere	DLYNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0070685_109979582	3300005466	Switchgrass Rhizosphere	NVALDLYNLFNANTGTAFNQVFPVPPAADLTYLRPTAILNPRFVRFNVTFDF*
Ga0070685_113430741	3300005466	Switchgrass Rhizosphere	NANTGTAFNQNFGTNGATWLRPNAILNPRYARFNATVDF*
Ga0070741_110685001	3300005529	Surface Soil	GVDLYNLFNANTGTSFNPNWGADGSTWLRPNAILNPRYVRFNATVDF*
Ga0070697_1013838501	3300005536	Corn, Switchgrass And Miscanthus Rhizosphere	ALDLYNLFNANTGTAFNQAFGTDGSLFLRPTAILNPRFVRFNVTFDF*
Ga0070672_1013953771	3300005543	Miscanthus Rhizosphere	FNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF*
Ga0070672_1016294482	3300005543	Miscanthus Rhizosphere	LYNVFNANTGTAFNQAFGTDGATFLRPTAILNPRFVRFNVTFDF*
Ga0070672_1017809501	3300005543	Miscanthus Rhizosphere	FNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATLDF*
Ga0070695_1001299663	3300005545	Corn, Switchgrass And Miscanthus Rhizosphere	DLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0070665_1020960522	3300005548	Switchgrass Rhizosphere	ANTGTTFNQAYGTDGAAWLRPTAIMNARFVRFNATIDF*
Ga0070665_1025365202	3300005548	Switchgrass Rhizosphere	VGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF*
Ga0070704_1007571431	3300005549	Corn, Switchgrass And Miscanthus Rhizosphere	LYNLFNANTGTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF*
Ga0070702_1000311274	3300005615	Corn, Switchgrass And Miscanthus Rhizosphere	NANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF*
Ga0068859_1010274811	3300005617	Switchgrass Rhizosphere	KTNVALDLYNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0068859_1017322941	3300005617	Switchgrass Rhizosphere	GFDLYNLFNANTGLFTGATTGFNPNWGADGSTYLRPNAILNPRYARFNATVDF*
Ga0068859_1023806481	3300005617	Switchgrass Rhizosphere	TGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF*
Ga0066905_1016245181	3300005713	Tropical Forest Soil	RTRAKVGIDLYNLLNSNTGTGFNQNWTGDGSTYLRPNAILNPRYVRFNATIDF*
Ga0068866_101844813	3300005718	Miscanthus Rhizosphere	NTGTTFNQAYGTDGAAWLRPTAILNARFLRFNATIDF*
Ga0068866_105949012	3300005718	Miscanthus Rhizosphere	ANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF*
Ga0068861_1023184321	3300005719	Switchgrass Rhizosphere	NTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVAF*
Ga0066903_1019302751	3300005764	Tropical Forest Soil	NTGTAFNQNFGLDGSTWLRPNAILNPRYVRFNATVDF*
Ga0066903_1045924361	3300005764	Tropical Forest Soil	LFNSNTGTAFNQNFGTDGSTWLRPVGILNPRYLRFNATVDF*
Ga0074479_100219102	3300005829	Sediment (Intertidal)	VGTAFNQGFGADGATWLRPTAVLNPRFARFNVTFDF*
Ga0074470_104313421	3300005836	Sediment (Intertidal)	NSNTGTGFNQNYGTDGSTYLRPNAILNPRYVRFNATIDF*
Ga0068870_105058632	3300005840	Miscanthus Rhizosphere	DLYNLFNANTGTTFNQNFGTDGATWLRPNAILNPRYVRFNATVDF*
Ga0068870_109418461	3300005840	Miscanthus Rhizosphere	DLYNMFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF*
Ga0068870_112228671	3300005840	Miscanthus Rhizosphere	GIDLYNVFNTNTGTTFNQNFGTDGAIYRQEVTILNPRFARFNVTVDF*
Ga0068860_1010585642	3300005843	Switchgrass Rhizosphere	DLYNLFNANTGTAFNQVFPVPPAADLTYLRPTAILNPRFVRFNVTFDF*
Ga0068862_1005097241	3300005844	Switchgrass Rhizosphere	GIDLYNLFNANTGTTFNQNFGTDGSTWLRPNAILNPRYVRFNVTLDF*
Ga0081455_100884714	3300005937	Tabebuia Heterophylla Rhizosphere	GRTRAKVGIDLYNLLNSNTGTGFNQNWGADGSTYLRPNAILNPRYVRFNATIDF*
Ga0075432_101954012	3300006058	Populus Rhizosphere	DLYNLFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF*
Ga0097621_1007655412	3300006237	Miscanthus Rhizosphere	TSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0097621_1013321912	3300006237	Miscanthus Rhizosphere	RTNIGIDLYNLFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF*
Ga0097621_1021810822	3300006237	Miscanthus Rhizosphere	NVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0075428_1010708672	3300006844	Populus Rhizosphere	LLNANTGTSFNQNFGRDGSTWLRPNAILNPRYVRFNATIDF*
Ga0075428_1019855292	3300006844	Populus Rhizosphere	LNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0075421_1005108861	3300006845	Populus Rhizosphere	LFNANTGTAYNANFGIDGATWNRETAILNPRAVRLNITFNY*
Ga0075421_1025510573	3300006845	Populus Rhizosphere	ANTGTTFNENFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0075430_1002610051	3300006846	Populus Rhizosphere	RTNVGVDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0075431_1020471801	3300006847	Populus Rhizosphere	NTGTTFNENFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0079217_106909071	3300006876	Agricultural Soil	YRANVGFDLYNLFNANTGVFTNATTGFNPNWGTDGSTYLRPNATLNPRYARFSATVDF*
Ga0068865_1007916001	3300006881	Miscanthus Rhizosphere	TAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0079215_101584833	3300006894	Agricultural Soil	GFDLYNLFNANTGTSFNQNFGTDGSTWLRPNGILNPRYARFNATVDF*
Ga0079216_102963301	3300006918	Agricultural Soil	NTGTTFSEGFGTDGSLYLREVTILNPRFVRFNVTVDF*
Ga0079216_107953131	3300006918	Agricultural Soil	LYNLFNGNTATGYDQGFGTDGSTWLRPTAVLNPRFVRFNVTFDF*
Ga0079218_119848342	3300007004	Agricultural Soil	NSNVGTAFNQGFGTNGATWLRPTAVLNPRFARFNVTFDF*
Ga0066710_1047981481	3300009012	Grasslands Soil	NSNAGTAYNGQFGTNGSTWNRPTAILSPRFVQFNGRFDF
Ga0105244_104129511	3300009036	Miscanthus Rhizosphere	LYNLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF*
Ga0105095_101236943	3300009053	Freshwater Sediment	NSGTAFDQGFGADGSTWLRPTTIMNPRFVRFNVTFDF*
Ga0105106_109720731	3300009078	Freshwater Sediment	IDLYNLLNANTGTGFNTGFGADGATYLRPTGILNPRFARFNVTIEY*
Ga0111539_125622861	3300009094	Populus Rhizosphere	MFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF*
Ga0111539_130860451	3300009094	Populus Rhizosphere	NANTGTAFNQAFGLDGSTWLRPTTIMNPRFVRFNVTFDF*
Ga0111539_132323442	3300009094	Populus Rhizosphere	YNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0114129_131593062	3300009147	Populus Rhizosphere	NANTGTTFNENFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0111538_115028862	3300009156	Populus Rhizosphere	GLDLYNLFNANTGTAFNQAFGLDGSTWLRPTTIMNPRFVRFNVTFDF*
Ga0111538_123295541	3300009156	Populus Rhizosphere	IRRIRANVGFDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0075423_123995881	3300009162	Populus Rhizosphere	FRRTRANVGIDLYNVFNTNTGTTFNQNFGVDGATYRQEVTILNPRFVRFNATVDF*
Ga0105248_107416261	3300009177	Switchgrass Rhizosphere	GTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF*
Ga0129284_102324441	3300009514	Beach Aquifer Porewater	IYNLFNANTPTAFNEGFGTDGTGWLTPTGILNPRFVRFNITIDY*
Ga0105238_128685871	3300009551	Corn Rhizosphere	RTNIGIDLYNLFNANTGTAFNQAFGTDGSTWLRPTTVLNPRFLRLNVTFDF*
Ga0105249_122778701	3300009553	Switchgrass Rhizosphere	TAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0126313_113580803	3300009840	Serpentine Soil	YNLFNANTTTGYNTAYGADGSAWLNPTAILNPRFVRFNVRFDF*
Ga0099796_105511212	3300010159	Vadose Zone Soil	LYNIFNSSNGTAFNQSFGFDGSTWLRPTAILNPRAVRFNLTFNY*
Ga0134070_102266182	3300010301	Grasslands Soil	TGTGFNQSFGTDGATWLRPTTILNPRFVRFNVTMDF*
Ga0126370_114416391	3300010358	Tropical Forest Soil	NLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF*
Ga0126370_118841392	3300010358	Tropical Forest Soil	FNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF*
Ga0126377_134822871	3300010362	Tropical Forest Soil	TAYNQAFGTDGSTWLRPTSVLNPRFVRFNVTFDF*
Ga0126379_128621921	3300010366	Tropical Forest Soil	GVDLYNLFNANTGITFNPNYGVDGSTWLRPNAILNPRYLRFNATVDF*
Ga0126383_133876641	3300010398	Tropical Forest Soil	GRKRVILGADVYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF*
Ga0134122_109487101	3300010400	Terrestrial Soil	DLYNLFNANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTLDF*
Ga0134123_130500922	3300010403	Terrestrial Soil	DLYNVFNSNTGTTFNGNFGNDGSTWLRPTAILNARFVRCNVTVNF*
Ga0137440_10503321	3300011410	Soil	AGTAFNQNFGTNGATWLRPNGILNPRYARFNATVDF*
Ga0137325_11087442	3300011415	Soil	TRTNVGLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF*
Ga0150985_1096501281	3300012212	Avena Fatua Rhizosphere	GTGFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0137435_12189992	3300012232	Soil	FDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0157284_101949952	3300012893	Soil	DLYNVFNTNTGTTFNQNFGTDGATYRQEVTLLNPRFLRFNVTVDF*
Ga0157293_103138222	3300012898	Soil	FNTNVGTVFNTNYGADGATWLRPTAIYTPRFLRFNVTFNY*
Ga0157291_100193131	3300012902	Soil	LLNSNVGTAFNQAFGNDGATWLRPTVVLNPRFARFNVTFDF*
Ga0157291_101259151	3300012902	Soil	GTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0157296_101607062	3300012905	Soil	ANTGTTFQQTYDPLNNGATWLRPTAILNPRFVRFNATVDF*
Ga0157290_102359772	3300012909	Soil	RTNVALDLYNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF*
Ga0137419_108600631	3300012925	Vadose Zone Soil	NANTGTGFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0126375_103867732	3300012948	Tropical Forest Soil	LNSNTGTGFNQNWTGDGSTYLRPNAILNPRYVRFNATIDF*
Ga0126375_120711052	3300012948	Tropical Forest Soil	GVDLYNLFNANTGTTFNQNFGTDGSTWLRPNAILNPRYLRFNATVDF*
Ga0126369_135919361	3300012971	Tropical Forest Soil	NANTGTSFNQNFGIDGSAWLRPNAILNPRYVRFNATVDF*
Ga0164305_110648271	3300012989	Soil	LFNANTGTTFNQAYGTDGAAWLRPTAILNARFMRFNVTIDF*
Ga0157374_120125821	3300013296	Miscanthus Rhizosphere	LFNANTGTVFNEVFGSDGVRWLRPTSILNARFLRFNVTLDF*
Ga0157378_102736711	3300013297	Miscanthus Rhizosphere	LYNMLNSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF*
Ga0163162_113988442	3300013306	Switchgrass Rhizosphere	LDLYNLFNANTGSTFNQNFGGDGATYRQEQTVLNPRFVRFNITVDF*
Ga0157375_116967222	3300013308	Miscanthus Rhizosphere	FSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF*
Ga0163163_119320832	3300014325	Switchgrass Rhizosphere	RTNIGIDLYNLFNANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF*
Ga0157380_101466911	3300014326	Switchgrass Rhizosphere	NTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0157380_126604791	3300014326	Switchgrass Rhizosphere	LYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF*
Ga0157376_100300561	3300014969	Miscanthus Rhizosphere	VGVDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF*
Ga0157376_103922821	3300014969	Miscanthus Rhizosphere	RTNIGIDLYNLFNANTGTGFNQNYGTDGSTWLRPNSILNPRYLRFNATVDF*
Ga0157376_127672341	3300014969	Miscanthus Rhizosphere	VGVDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATLDF*
Ga0173478_104739891	3300015201	Soil	NANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF*
Ga0173478_108081152	3300015201	Soil	YNMFNSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF*
Ga0180093_10337821	3300015258	Soil	NTGTTFNQNFGTDGATWLRPNAILNPRYVRFNATVDF*
Ga0132258_134382701	3300015371	Arabidopsis Rhizosphere	NLFNSNVGTAFNQGFGTDGLLWLRPTAVLNPRFARFNVTFDF*
Ga0132256_1004397231	3300015372	Arabidopsis Rhizosphere	IGIDLYNLFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF*
Ga0132255_1010028141	3300015374	Arabidopsis Rhizosphere	LDLYNLFNANTGTAFNQAFGLDGSTWLRPTTIMNPRFVRFNVTFDF*
Ga0182038_111230951	3300016445	Soil	MGQKRVILGADIYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF
Ga0182038_113414952	3300016445	Soil	FNSNTGTAFNQAFGTDGSTWLRPTSILNPRFVRFNVTFDF
Ga0184640_101614583	3300018074	Groundwater Sediment	DLYNLFNSNTGTGFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF
Ga0184625_103734951	3300018081	Groundwater Sediment	TGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF
Ga0184628_102784271	3300018083	Groundwater Sediment	NTNVGTAFNTNYGSDGATWLRPTAIYTPRFLRFNVTFNY
Ga0190275_115671391	3300018432	Soil	YNLFNANTATTYDQGFTGDGSGWLRPTAVLNPRFVRFNLTFDF
Ga0066662_126948252	3300018468	Grasslands Soil	LYNLFNANPGTAFNQTFSAGSPTYLRPTTILNPRFVRFNVTVDF
Ga0190270_109118331	3300018469	Soil	GTTFNQAFGTDGTTWLRPTAVMSPRFVRFNVTMDF
Ga0190270_114060911	3300018469	Soil	NVGTAFNQAFGNDGATWLRPTAVLNPRFARFNVTFDF
Ga0190270_117501522	3300018469	Soil	GVDLYNLFNSNTGTTFNQNFGTDGSAWLRPNAILNPRYVRFNATVDF
Ga0190270_126679271	3300018469	Soil	RTNVGLDLFNLFNANTGTAFNQAFGGDGATWLRPTTILNPRFLRFNVTFDF
Ga0190274_105873602	3300018476	Soil	FNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF
Ga0190274_109820521	3300018476	Soil	LNSNVGTAFNQAFGNDGATWLRPTAVLNPRFARFNVTFDF
Ga0190274_113536701	3300018476	Soil	GTTFNQNFGTDGSTWLRPNAILNPRYVRFNVTLDF
Ga0190274_116781621	3300018476	Soil	IGVDLYNLLNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF
Ga0190274_125990361	3300018476	Soil	LYNIFNSNTGTTFNQGYGVDGSTYLRPLTILNPRFLRFNVTVDF
Ga0190274_136572981	3300018476	Soil	FNTNTGTTFNQNFGTDGATYRQEVTLLNPRFLRFNVTVDF
Ga0210380_104138172	3300021082	Groundwater Sediment	GLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF
Ga0210380_104883002	3300021082	Groundwater Sediment	DAYNVFNTNVGTAFNTNYGSDGATWLRPTAIYTPRFLRFNVTFNY
Ga0210339_14188751	3300021332	Estuarine	ANTGTAFNQVFGTNGAAWLRPNAILNPRYVRFNATIDF
Ga0222622_102978592	3300022756	Groundwater Sediment	NLFNANPGTAFLQNFSVTNPTYLRPTTVLRPRFVRFNVTVDF
Ga0247783_10326111	3300022911	Plant Litter	LYNLFNDNTGTTFNQAFGTDGATWLRPTAVMSPRFVRFNVTMDF
Ga0247754_11591162	3300023102	Soil	NDNTGTTFNQAFGTDGATWLRPTAVMSPRFVRFNVTMDF
Ga0209108_102074251	3300025165	Soil	LYNLFNANAGLTFQPAYGDGSGWLAPQTYLNARFVRFNATFDF
Ga0207642_100313293	3300025899	Miscanthus Rhizosphere	NTGTTFNQAYGTDGAAWLRPTAILNARFLRFNATIDF
Ga0207684_117167192	3300025910	Corn, Switchgrass And Miscanthus Rhizosphere	LYNLFNANTGTAFNQAFGTDGSLFLRPTAILNPRFVRFNVTFDF
Ga0207662_108365901	3300025918	Switchgrass Rhizosphere	SNTGTAFSQTFPAPPASDATFLRPTAILNPRFVRFNVTFDF
Ga0207681_101320401	3300025923	Switchgrass Rhizosphere	MDLYNMFNSNVGTAFNQGFGADGALWLRPTAVLNPRFARFNVTFDF
Ga0207681_113985431	3300025923	Switchgrass Rhizosphere	NTRTNVGIDLYNIFNTNTGTAFNQNFGVDGAQYLQEQTILNPRFLRFNVTFDF
Ga0207650_105944911	3300025925	Switchgrass Rhizosphere	VAIDLYNLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF
Ga0207700_117963212	3300025928	Corn, Switchgrass And Miscanthus Rhizosphere	ADIYNLFNSNAGTAYNGQFGVDGSTWNRPTAILNPRFVQFNGRFDF
Ga0207644_105265703	3300025931	Switchgrass Rhizosphere	VGTAFNTNYGSDGATWLRPTAIYTPRFLRFNVTFNY
Ga0207704_111776912	3300025938	Miscanthus Rhizosphere	QTNVGLDLYNMFNSNTGTSFNQGYGTDGALYLRPLTILNPRFLRFNVTFDF
Ga0207711_102114881	3300025941	Switchgrass Rhizosphere	LYNLFNANPGTAFNQMFSVGSPTYLRPTTILRPRFVRFNVTVDF
Ga0207651_110085961	3300025960	Switchgrass Rhizosphere	NANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF
Ga0207668_101171821	3300025972	Switchgrass Rhizosphere	NTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF
Ga0207658_106907611	3300025986	Switchgrass Rhizosphere	ANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF
Ga0207641_110400452	3300026088	Switchgrass Rhizosphere	GTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF
Ga0207648_101638503	3300026089	Miscanthus Rhizosphere	NTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF
Ga0207648_107292681	3300026089	Miscanthus Rhizosphere	ANTGTTFQQTYDPLNNGATWLRPTAILNPRFVRFNATVDF
Ga0207676_105037182	3300026095	Switchgrass Rhizosphere	MDLYNLFNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF
Ga0207675_1001995483	3300026118	Switchgrass Rhizosphere	YNLFNANTGTAFNQVFPVPPAADLTYLRPTAILNPRFVRFNVTFDF
Ga0207683_116631121	3300026121	Miscanthus Rhizosphere	TNIGIDLYNMLNANVGTAFNQGFGTDGALWMRPTAVLNPRFARFNVTFDF
Ga0209481_102473231	3300027880	Populus Rhizosphere	RSLNLFNTNTGTSFNENFGTDGSTWLRPNAILNPRYVRFNATVDF
Ga0209486_100009431	3300027886	Agricultural Soil	TGTSFNQNFGTDGSTWLRPNGILNPRYARFNATVDF
Ga0247749_10031321	3300027993	Soil	VGFDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF
Ga0209526_108738171	3300028047	Forest Soil	VDLYNLFNANTGITFNPNFGADGSTWLRPNAILNPRYLRFNATVDF
Ga0268265_118411922	3300028380	Switchgrass Rhizosphere	NLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF
Ga0268265_119082781	3300028380	Switchgrass Rhizosphere	TGTTFNQNFGTDGATYLRPNAILNPRYVRFNATIDF
Ga0268265_119203651	3300028380	Switchgrass Rhizosphere	LYNLFNANTGLFTGATTGFNPNWGADGSTYLRPNAILNPRYARFNATVDF
Ga0268264_106545631	3300028381	Switchgrass Rhizosphere	LDLYNLFNANTGTAFNQAFGTDGTTFLRPTAILNPRFVRFNVTFDF
Ga0268264_110463461	3300028381	Switchgrass Rhizosphere	NLFNANTGTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF
Ga0307501_101511601	3300031152	Soil	NLFNANPGTAFNQNFTAESTTYLRPTTILRPRFVRINATVDF
Ga0307498_101591021	3300031170	Soil	NVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF
Ga0307497_104993361	3300031226	Soil	VSKILNLWHTRTNIGIDFYNLNNANTGTSFNQSYGVDGAQYLRPLTVLNPRFMRFNVTVD
Ga0310907_108434812	3300031847	Soil	MFNSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF
Ga0310904_103025101	3300031854	Soil	NTNTGTAFNQNFGVDGAQYLQEQTILNPRFLRFNVTFDF
Ga0310892_107089062	3300031858	Soil	SNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF
Ga0310916_111636612	3300031942	Soil	KRVILGADIYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF
Ga0310884_106370252	3300031944	Soil	RTNVGLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF
Ga0310910_107477541	3300031946	Soil	LAKVLKLGRAKSTVGFDLYNIFNVNPGTAFNQTFSVGNPTYLRPTAILNPRFVRLNVTVD
Ga0310906_101289431	3300032013	Soil	MFNSNVGTAFNQAFGTDGATWMRPTAVLNPRFARFNVTFDF
Ga0318533_113451882	3300032059	Soil	AGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF
Ga0310890_100478644	3300032075	Soil	DLYNMFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF
Ga0310895_106918351	3300032122	Soil	VGLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF
Ga0315912_108996781	3300032157	Soil	VDLYNLFNANTGTTFNQNFGTDGATWLRPNAILNPRYVRFNATVDF
Ga0315912_116274362	3300032157	Soil	YNLFNANTGTSFNQNFGRDGSTWLRPNAILNPRYVRFNATIDF
Ga0310896_100506371	3300032211	Soil	NMFNANTETTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF
Ga0310812_102815922	3300032421	Soil	VDLYNLFNANTGTTFNQNFGTDGATYLRPNAILNPRYVRFNATIDF
Ga0335084_103656412	3300033004	Soil	NSNVGTAFNQAFGTDGSTWLRPTAVLNPRFVRFNVTVDF
Ga0310810_110933112	3300033412	Soil	VDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF
Ga0314781_108377_440_565	3300034660	Soil	LFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F026593

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences