| Basic Information | |
|---|---|
| Family ID | F026593 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 43 residues |
| Representative Sequence | YNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF |
| Number of Associated Samples | 152 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.49 % |
| % of genes from short scaffolds (< 2000 bps) | 94.92 % |
| Associated GOLD sequencing projects | 138 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.14 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.695 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.706 % of family members) |
| Environment Ontology (ENVO) | Unclassified (39.086 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (57.360 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF13517 | FG-GAP_3 | 12.18 |
| PF07593 | UnbV_ASPIC | 9.14 |
| PF13620 | CarboxypepD_reg | 8.63 |
| PF01212 | Beta_elim_lyase | 4.57 |
| PF01799 | Fer2_2 | 3.55 |
| PF02371 | Transposase_20 | 2.54 |
| PF12836 | HHH_3 | 2.54 |
| PF00106 | adh_short | 2.03 |
| PF01436 | NHL | 1.52 |
| PF12681 | Glyoxalase_2 | 1.52 |
| PF12704 | MacB_PCD | 1.52 |
| PF03372 | Exo_endo_phos | 1.02 |
| PF02687 | FtsX | 1.02 |
| PF00313 | CSD | 1.02 |
| PF00111 | Fer2 | 1.02 |
| PF03551 | PadR | 1.02 |
| PF13672 | PP2C_2 | 1.02 |
| PF08331 | QueG_DUF1730 | 0.51 |
| PF13282 | DUF4070 | 0.51 |
| PF05190 | MutS_IV | 0.51 |
| PF02823 | ATP-synt_DE_N | 0.51 |
| PF00202 | Aminotran_3 | 0.51 |
| PF03972 | MmgE_PrpD | 0.51 |
| PF02738 | MoCoBD_1 | 0.51 |
| PF09594 | GT87 | 0.51 |
| PF09994 | DUF2235 | 0.51 |
| PF01872 | RibD_C | 0.51 |
| PF13181 | TPR_8 | 0.51 |
| PF13673 | Acetyltransf_10 | 0.51 |
| PF14108 | ABA4-like | 0.51 |
| PF09359 | VTC | 0.51 |
| PF00144 | Beta-lactamase | 0.51 |
| PF00355 | Rieske | 0.51 |
| PF00589 | Phage_integrase | 0.51 |
| PF02826 | 2-Hacid_dh_C | 0.51 |
| PF14559 | TPR_19 | 0.51 |
| PF00011 | HSP20 | 0.51 |
| PF00486 | Trans_reg_C | 0.51 |
| PF00903 | Glyoxalase | 0.51 |
| PF08281 | Sigma70_r4_2 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG1167 | DNA-binding transcriptional regulator, MocR family, contains an aminotransferase domain | Transcription [K] | 9.14 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 4.57 |
| COG4992 | Acetylornithine/succinyldiaminopimelate/putrescine aminotransferase | Amino acid transport and metabolism [E] | 4.57 |
| COG3033 | Tryptophanase | Amino acid transport and metabolism [E] | 4.57 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 4.57 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 4.57 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 4.57 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 4.57 |
| COG1104 | Cysteine desulfurase/Cysteine sulfinate desulfinase IscS or related enzyme, NifS family | Amino acid transport and metabolism [E] | 4.57 |
| COG1003 | Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain | Amino acid transport and metabolism [E] | 4.57 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 4.57 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 4.57 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 4.57 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 4.57 |
| COG0076 | Glutamate or tyrosine decarboxylase or a related PLP-dependent protein | Amino acid transport and metabolism [E] | 4.57 |
| COG0112 | Glycine/serine hydroxymethyltransferase | Amino acid transport and metabolism [E] | 4.57 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 4.57 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 2.54 |
| COG1695 | DNA-binding transcriptional regulator, PadR family | Transcription [K] | 1.02 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 1.02 |
| COG1846 | DNA-binding transcriptional regulator, MarR family | Transcription [K] | 1.02 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| COG2367 | Beta-lactamase class A | Defense mechanisms [V] | 0.51 |
| COG2079 | 2-methylcitrate dehydratase PrpD | Carbohydrate transport and metabolism [G] | 0.51 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.51 |
| COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 0.51 |
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.51 |
| COG1686 | D-alanyl-D-alanine carboxypeptidase | Cell wall/membrane/envelope biogenesis [M] | 0.51 |
| COG1680 | CubicO group peptidase, beta-lactamase class C family | Defense mechanisms [V] | 0.51 |
| COG1600 | Epoxyqueuosine reductase QueG (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG0355 | FoF1-type ATP synthase, epsilon subunit | Energy production and conversion [C] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.70 % |
| Unclassified | root | N/A | 20.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2124908009|FWIRA_GRAM18401BHLX8 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 546 | Open in IMG/M |
| 3300000956|JGI10216J12902_100453521 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300000956|JGI10216J12902_103159241 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae | 1256 | Open in IMG/M |
| 3300000956|JGI10216J12902_114045518 | Not Available | 827 | Open in IMG/M |
| 3300002076|JGI24749J21850_1057615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300004020|Ga0055440_10041564 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 983 | Open in IMG/M |
| 3300004463|Ga0063356_101607036 | Not Available | 968 | Open in IMG/M |
| 3300004480|Ga0062592_102082272 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 563 | Open in IMG/M |
| 3300004643|Ga0062591_102817703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300005290|Ga0065712_10198669 | All Organisms → cellular organisms → Bacteria | 1117 | Open in IMG/M |
| 3300005295|Ga0065707_10551524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 720 | Open in IMG/M |
| 3300005330|Ga0070690_100262263 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300005332|Ga0066388_103904218 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300005333|Ga0070677_10044022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1775 | Open in IMG/M |
| 3300005343|Ga0070687_100676383 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300005353|Ga0070669_100152962 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1787 | Open in IMG/M |
| 3300005364|Ga0070673_100037021 | All Organisms → cellular organisms → Bacteria | 3714 | Open in IMG/M |
| 3300005365|Ga0070688_100983969 | All Organisms → cellular organisms → Bacteria | 669 | Open in IMG/M |
| 3300005436|Ga0070713_101420286 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005441|Ga0070700_101224050 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300005441|Ga0070700_101967809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300005456|Ga0070678_101923468 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300005457|Ga0070662_101227845 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 645 | Open in IMG/M |
| 3300005466|Ga0070685_10080959 | All Organisms → cellular organisms → Bacteria | 1946 | Open in IMG/M |
| 3300005466|Ga0070685_10997958 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300005466|Ga0070685_11343074 | All Organisms → cellular organisms → Bacteria | 547 | Open in IMG/M |
| 3300005529|Ga0070741_11068500 | All Organisms → cellular organisms → Bacteria | 688 | Open in IMG/M |
| 3300005536|Ga0070697_101383850 | All Organisms → cellular organisms → Bacteria | 628 | Open in IMG/M |
| 3300005543|Ga0070672_101395377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300005543|Ga0070672_101629448 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005543|Ga0070672_101780950 | Not Available | 554 | Open in IMG/M |
| 3300005545|Ga0070695_100129966 | All Organisms → cellular organisms → Bacteria | 1735 | Open in IMG/M |
| 3300005548|Ga0070665_102096052 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300005548|Ga0070665_102536520 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 514 | Open in IMG/M |
| 3300005549|Ga0070704_100757143 | Not Available | 865 | Open in IMG/M |
| 3300005615|Ga0070702_100031127 | All Organisms → cellular organisms → Bacteria | 2917 | Open in IMG/M |
| 3300005617|Ga0068859_101027481 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 906 | Open in IMG/M |
| 3300005617|Ga0068859_101732294 | Not Available | 690 | Open in IMG/M |
| 3300005617|Ga0068859_102380648 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 584 | Open in IMG/M |
| 3300005713|Ga0066905_101624518 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300005718|Ga0068866_10184481 | All Organisms → cellular organisms → Bacteria | 1235 | Open in IMG/M |
| 3300005718|Ga0068866_10594901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300005719|Ga0068861_102318432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 539 | Open in IMG/M |
| 3300005764|Ga0066903_101930275 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1132 | Open in IMG/M |
| 3300005764|Ga0066903_104592436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300005829|Ga0074479_10021910 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300005836|Ga0074470_10431342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3082 | Open in IMG/M |
| 3300005840|Ga0068870_10505863 | Not Available | 806 | Open in IMG/M |
| 3300005840|Ga0068870_10941846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria | 612 | Open in IMG/M |
| 3300005840|Ga0068870_11222867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300005843|Ga0068860_101058564 | Not Available | 830 | Open in IMG/M |
| 3300005844|Ga0068862_100509724 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1143 | Open in IMG/M |
| 3300005937|Ga0081455_10088471 | All Organisms → cellular organisms → Bacteria | 2516 | Open in IMG/M |
| 3300006058|Ga0075432_10195401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 798 | Open in IMG/M |
| 3300006237|Ga0097621_100765541 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Flavonifractor → Flavonifractor plautii | 893 | Open in IMG/M |
| 3300006237|Ga0097621_101332191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300006237|Ga0097621_102181082 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300006844|Ga0075428_101070867 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 852 | Open in IMG/M |
| 3300006844|Ga0075428_101985529 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300006845|Ga0075421_100510886 | All Organisms → cellular organisms → Bacteria | 1426 | Open in IMG/M |
| 3300006845|Ga0075421_102551057 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300006846|Ga0075430_100261005 | All Organisms → cellular organisms → Bacteria | 1435 | Open in IMG/M |
| 3300006847|Ga0075431_102047180 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300006876|Ga0079217_10690907 | Not Available | 684 | Open in IMG/M |
| 3300006881|Ga0068865_100791600 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300006894|Ga0079215_10158483 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1092 | Open in IMG/M |
| 3300006918|Ga0079216_10296330 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 954 | Open in IMG/M |
| 3300006918|Ga0079216_10795313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 693 | Open in IMG/M |
| 3300007004|Ga0079218_11984834 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300009012|Ga0066710_104798148 | Not Available | 506 | Open in IMG/M |
| 3300009036|Ga0105244_10412951 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300009053|Ga0105095_10123694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1407 | Open in IMG/M |
| 3300009078|Ga0105106_10972073 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 604 | Open in IMG/M |
| 3300009094|Ga0111539_12562286 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Methylococcales → Methylococcaceae | 591 | Open in IMG/M |
| 3300009094|Ga0111539_13086045 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 538 | Open in IMG/M |
| 3300009094|Ga0111539_13232344 | Not Available | 525 | Open in IMG/M |
| 3300009147|Ga0114129_13159306 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300009156|Ga0111538_11502886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300009156|Ga0111538_12329554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 672 | Open in IMG/M |
| 3300009162|Ga0075423_12399588 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300009177|Ga0105248_10741626 | Not Available | 1108 | Open in IMG/M |
| 3300009514|Ga0129284_10232444 | Not Available | 824 | Open in IMG/M |
| 3300009551|Ga0105238_12868587 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium | 518 | Open in IMG/M |
| 3300009553|Ga0105249_12277870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 614 | Open in IMG/M |
| 3300009840|Ga0126313_11358080 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300010159|Ga0099796_10551121 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300010301|Ga0134070_10226618 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300010358|Ga0126370_11441639 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300010358|Ga0126370_11884139 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300010362|Ga0126377_13482287 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300010366|Ga0126379_12862192 | Not Available | 577 | Open in IMG/M |
| 3300010398|Ga0126383_13387664 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300010400|Ga0134122_10948710 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300010403|Ga0134123_13050092 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300011410|Ga0137440_1050332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 796 | Open in IMG/M |
| 3300011415|Ga0137325_1108744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 631 | Open in IMG/M |
| 3300012212|Ga0150985_109650128 | Not Available | 573 | Open in IMG/M |
| 3300012232|Ga0137435_1218999 | Not Available | 581 | Open in IMG/M |
| 3300012893|Ga0157284_10194995 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300012898|Ga0157293_10313822 | Not Available | 523 | Open in IMG/M |
| 3300012902|Ga0157291_10019313 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300012902|Ga0157291_10125915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 732 | Open in IMG/M |
| 3300012905|Ga0157296_10160706 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 682 | Open in IMG/M |
| 3300012909|Ga0157290_10235977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 642 | Open in IMG/M |
| 3300012925|Ga0137419_10860063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 745 | Open in IMG/M |
| 3300012948|Ga0126375_10386773 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300012948|Ga0126375_12071105 | Not Available | 505 | Open in IMG/M |
| 3300012971|Ga0126369_13591936 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300012989|Ga0164305_11064827 | Not Available | 692 | Open in IMG/M |
| 3300013296|Ga0157374_12012582 | Not Available | 604 | Open in IMG/M |
| 3300013297|Ga0157378_10273671 | All Organisms → cellular organisms → Bacteria | 1625 | Open in IMG/M |
| 3300013306|Ga0163162_11398844 | All Organisms → cellular organisms → Bacteria | 796 | Open in IMG/M |
| 3300013308|Ga0157375_11696722 | Not Available | 748 | Open in IMG/M |
| 3300014325|Ga0163163_11932083 | All Organisms → cellular organisms → Bacteria | 650 | Open in IMG/M |
| 3300014326|Ga0157380_10146691 | All Organisms → cellular organisms → Bacteria | 2034 | Open in IMG/M |
| 3300014326|Ga0157380_12660479 | Not Available | 567 | Open in IMG/M |
| 3300014969|Ga0157376_10030056 | All Organisms → cellular organisms → Bacteria | 4333 | Open in IMG/M |
| 3300014969|Ga0157376_10392282 | Not Available | 1340 | Open in IMG/M |
| 3300014969|Ga0157376_12767234 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300015201|Ga0173478_10473989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 620 | Open in IMG/M |
| 3300015201|Ga0173478_10808115 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300015258|Ga0180093_1033782 | All Organisms → cellular organisms → Bacteria | 1105 | Open in IMG/M |
| 3300015371|Ga0132258_13438270 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1086 | Open in IMG/M |
| 3300015372|Ga0132256_100439723 | Not Available | 1410 | Open in IMG/M |
| 3300015374|Ga0132255_101002814 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1252 | Open in IMG/M |
| 3300016445|Ga0182038_11123095 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300016445|Ga0182038_11341495 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300018074|Ga0184640_10161458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
| 3300018081|Ga0184625_10373495 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 739 | Open in IMG/M |
| 3300018083|Ga0184628_10278427 | Not Available | 879 | Open in IMG/M |
| 3300018432|Ga0190275_11567139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Xanthomonadales → unclassified Xanthomonadales → Xanthomonadales bacterium | 736 | Open in IMG/M |
| 3300018468|Ga0066662_12694825 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300018469|Ga0190270_10911833 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 897 | Open in IMG/M |
| 3300018469|Ga0190270_11406091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 744 | Open in IMG/M |
| 3300018469|Ga0190270_11750152 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300018469|Ga0190270_12667927 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300018476|Ga0190274_10587360 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1137 | Open in IMG/M |
| 3300018476|Ga0190274_10982052 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 917 | Open in IMG/M |
| 3300018476|Ga0190274_11353670 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300018476|Ga0190274_11678162 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300018476|Ga0190274_12599036 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300018476|Ga0190274_13657298 | Not Available | 520 | Open in IMG/M |
| 3300021082|Ga0210380_10413817 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
| 3300021082|Ga0210380_10488300 | Not Available | 564 | Open in IMG/M |
| 3300021332|Ga0210339_1418875 | Not Available | 612 | Open in IMG/M |
| 3300022756|Ga0222622_10297859 | Not Available | 1109 | Open in IMG/M |
| 3300022911|Ga0247783_1032611 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → Luteitalea pratensis | 1358 | Open in IMG/M |
| 3300023102|Ga0247754_1159116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300025165|Ga0209108_10207425 | All Organisms → cellular organisms → Bacteria | 1010 | Open in IMG/M |
| 3300025899|Ga0207642_10031329 | All Organisms → cellular organisms → Bacteria | 2226 | Open in IMG/M |
| 3300025910|Ga0207684_11716719 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300025918|Ga0207662_10836590 | Not Available | 650 | Open in IMG/M |
| 3300025923|Ga0207681_10132040 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
| 3300025923|Ga0207681_11398543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300025925|Ga0207650_10594491 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300025928|Ga0207700_11796321 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300025931|Ga0207644_10526570 | All Organisms → cellular organisms → Bacteria | 977 | Open in IMG/M |
| 3300025938|Ga0207704_11177691 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300025941|Ga0207711_10211488 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300025960|Ga0207651_11008596 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300025972|Ga0207668_10117182 | Not Available | 2010 | Open in IMG/M |
| 3300025986|Ga0207658_10690761 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Flavonifractor → Flavonifractor plautii | 922 | Open in IMG/M |
| 3300026088|Ga0207641_11040045 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300026089|Ga0207648_10163850 | All Organisms → cellular organisms → Bacteria | 1964 | Open in IMG/M |
| 3300026089|Ga0207648_10729268 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 920 | Open in IMG/M |
| 3300026095|Ga0207676_10503718 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300026118|Ga0207675_100199548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1921 | Open in IMG/M |
| 3300026121|Ga0207683_11663112 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300027880|Ga0209481_10247323 | Not Available | 898 | Open in IMG/M |
| 3300027886|Ga0209486_10000943 | All Organisms → cellular organisms → Bacteria | 12730 | Open in IMG/M |
| 3300027993|Ga0247749_1003132 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. TBR-22 | 1456 | Open in IMG/M |
| 3300028047|Ga0209526_10873817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300028380|Ga0268265_11841192 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300028380|Ga0268265_11908278 | Not Available | 601 | Open in IMG/M |
| 3300028380|Ga0268265_11920365 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300028381|Ga0268264_10654563 | Not Available | 1040 | Open in IMG/M |
| 3300028381|Ga0268264_11046346 | Not Available | 824 | Open in IMG/M |
| 3300031152|Ga0307501_10151160 | Not Available | 631 | Open in IMG/M |
| 3300031170|Ga0307498_10159102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 756 | Open in IMG/M |
| 3300031226|Ga0307497_10499336 | Not Available | 600 | Open in IMG/M |
| 3300031847|Ga0310907_10843481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300031854|Ga0310904_10302510 | All Organisms → cellular organisms → Bacteria | 1013 | Open in IMG/M |
| 3300031858|Ga0310892_10708906 | All Organisms → cellular organisms → Bacteria | 691 | Open in IMG/M |
| 3300031942|Ga0310916_11163661 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300031944|Ga0310884_10637025 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300031946|Ga0310910_10747754 | Not Available | 772 | Open in IMG/M |
| 3300032013|Ga0310906_10128943 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300032059|Ga0318533_11345188 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300032075|Ga0310890_10047864 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
| 3300032122|Ga0310895_10691835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 530 | Open in IMG/M |
| 3300032157|Ga0315912_10899678 | Not Available | 704 | Open in IMG/M |
| 3300032157|Ga0315912_11627436 | Not Available | 508 | Open in IMG/M |
| 3300032211|Ga0310896_10050637 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1676 | Open in IMG/M |
| 3300032421|Ga0310812_10281592 | Not Available | 736 | Open in IMG/M |
| 3300033004|Ga0335084_10365641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1488 | Open in IMG/M |
| 3300033412|Ga0310810_11093311 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae | 665 | Open in IMG/M |
| 3300034660|Ga0314781_108377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.71% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 7.61% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.11% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 5.58% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.08% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.57% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.57% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.06% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 3.55% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.05% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.05% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 2.03% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.03% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.52% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.52% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.52% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.02% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.02% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.02% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.02% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.02% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.02% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.02% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.51% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Beach Aquifer Porewater | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater | 0.51% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.51% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.51% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.51% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.51% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.51% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908009 | Soil microbial communities from sample at FACE Site Metagenome WIR_Amb2 | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Host-Associated | Open in IMG/M |
| 3300004020 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
| 3300005836 | Microbial communities from Youngs Bay mouth sediment, Columbia River estuary, Oregon - S.42_YBB | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006058 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009053 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009514 | Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - F-1W | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011410 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT222_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012232 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT100_2 | Environmental | Open in IMG/M |
| 3300012893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S059-202B-1 | Environmental | Open in IMG/M |
| 3300012898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S194-509B-1 | Environmental | Open in IMG/M |
| 3300012902 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S169-409C-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012909 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S149-409B-1 | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015258 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT45_16_1Da | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300018074 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021332 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.384 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022911 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L064-202C-5 | Environmental | Open in IMG/M |
| 3300023102 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S184-509B-5 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027993 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5 | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032157 | Garden soil microbial communities collected in Santa Monica, California, United States - V. faba soil | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300032421 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NN3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FWIRA_05915560 | 2124908009 | Soil | TGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF |
| JGI10216J12902_1004535211 | 3300000956 | Soil | DLYNLFNANTGTAFNQNFGTDGSTWLRPNAILNPRYARFNATVDF* |
| JGI10216J12902_1031592413 | 3300000956 | Soil | GFNQVFGNASTPATLGATWLRPNTILNPRYLRFNATVDF* |
| JGI10216J12902_1140455181 | 3300000956 | Soil | NGNTATGYDNGFGTDGSTWLRPTAVLNPRFVRFNMTFDF* |
| JGI24749J21850_10576152 | 3300002076 | Corn, Switchgrass And Miscanthus Rhizosphere | YNLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF* |
| Ga0055440_100415643 | 3300004020 | Natural And Restored Wetlands | NANTGTSFNQNFGSDGSTWLRPNGILNPRYMRFNATVDF* |
| Ga0063356_1016070361 | 3300004463 | Arabidopsis Thaliana Rhizosphere | DLYNLFNANTGTSFNQNFGADGSTWLRPNGILNPRYVRFNATVDF* |
| Ga0062592_1020822722 | 3300004480 | Soil | NSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF* |
| Ga0062591_1028177031 | 3300004643 | Soil | NLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF* |
| Ga0065712_101986693 | 3300005290 | Miscanthus Rhizosphere | NLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF* |
| Ga0065707_105515242 | 3300005295 | Switchgrass Rhizosphere | RKWCVSNANPGAAFNQTFSVGSPTYLRPTTILSPRFVRFNVTIDF* |
| Ga0070690_1002622632 | 3300005330 | Switchgrass Rhizosphere | FNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF* |
| Ga0066388_1039042181 | 3300005332 | Tropical Forest Soil | GQKRVILGADIYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF* |
| Ga0070677_100440221 | 3300005333 | Miscanthus Rhizosphere | YNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF* |
| Ga0070687_1006763832 | 3300005343 | Switchgrass Rhizosphere | FNANTGTAFNQNFGTNGATWLRPNAILNPRYARFNATVDF* |
| Ga0070669_1001529623 | 3300005353 | Switchgrass Rhizosphere | FNDNTGTTFNQAFGTDGATWLRPTAVMSPRFVRFNVTVDF* |
| Ga0070673_1000370214 | 3300005364 | Switchgrass Rhizosphere | TGTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF* |
| Ga0070688_1009839692 | 3300005365 | Switchgrass Rhizosphere | NLFNANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF* |
| Ga0070713_1014202861 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ADIYNLFNSNAGTAYNGQFGVDGSTWNRPTAILNPRFVQFNGRFDF* |
| Ga0070700_1012240501 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MDLYNLFNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF* |
| Ga0070700_1019678092 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | IDLYNLFNANTGTTFNQAYGTDGAAWLRPTAIMNARFVRFNATIDF* |
| Ga0070678_1019234681 | 3300005456 | Miscanthus Rhizosphere | LNANVGTAFNQGFGTDGALWMRPTAVLNPRFARFNVTFDF* |
| Ga0070662_1012278452 | 3300005457 | Corn Rhizosphere | NANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF* |
| Ga0070685_100809591 | 3300005466 | Switchgrass Rhizosphere | DLYNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF* |
| Ga0070685_109979582 | 3300005466 | Switchgrass Rhizosphere | NVALDLYNLFNANTGTAFNQVFPVPPAADLTYLRPTAILNPRFVRFNVTFDF* |
| Ga0070685_113430741 | 3300005466 | Switchgrass Rhizosphere | NANTGTAFNQNFGTNGATWLRPNAILNPRYARFNATVDF* |
| Ga0070741_110685001 | 3300005529 | Surface Soil | GVDLYNLFNANTGTSFNPNWGADGSTWLRPNAILNPRYVRFNATVDF* |
| Ga0070697_1013838501 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | ALDLYNLFNANTGTAFNQAFGTDGSLFLRPTAILNPRFVRFNVTFDF* |
| Ga0070672_1013953771 | 3300005543 | Miscanthus Rhizosphere | FNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF* |
| Ga0070672_1016294482 | 3300005543 | Miscanthus Rhizosphere | LYNVFNANTGTAFNQAFGTDGATFLRPTAILNPRFVRFNVTFDF* |
| Ga0070672_1017809501 | 3300005543 | Miscanthus Rhizosphere | FNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATLDF* |
| Ga0070695_1001299663 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | DLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF* |
| Ga0070665_1020960522 | 3300005548 | Switchgrass Rhizosphere | ANTGTTFNQAYGTDGAAWLRPTAIMNARFVRFNATIDF* |
| Ga0070665_1025365202 | 3300005548 | Switchgrass Rhizosphere | VGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF* |
| Ga0070704_1007571431 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LYNLFNANTGTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF* |
| Ga0070702_1000311274 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | NANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF* |
| Ga0068859_1010274811 | 3300005617 | Switchgrass Rhizosphere | KTNVALDLYNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF* |
| Ga0068859_1017322941 | 3300005617 | Switchgrass Rhizosphere | GFDLYNLFNANTGLFTGATTGFNPNWGADGSTYLRPNAILNPRYARFNATVDF* |
| Ga0068859_1023806481 | 3300005617 | Switchgrass Rhizosphere | TGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF* |
| Ga0066905_1016245181 | 3300005713 | Tropical Forest Soil | RTRAKVGIDLYNLLNSNTGTGFNQNWTGDGSTYLRPNAILNPRYVRFNATIDF* |
| Ga0068866_101844813 | 3300005718 | Miscanthus Rhizosphere | NTGTTFNQAYGTDGAAWLRPTAILNARFLRFNATIDF* |
| Ga0068866_105949012 | 3300005718 | Miscanthus Rhizosphere | ANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF* |
| Ga0068861_1023184321 | 3300005719 | Switchgrass Rhizosphere | NTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVAF* |
| Ga0066903_1019302751 | 3300005764 | Tropical Forest Soil | NTGTAFNQNFGLDGSTWLRPNAILNPRYVRFNATVDF* |
| Ga0066903_1045924361 | 3300005764 | Tropical Forest Soil | LFNSNTGTAFNQNFGTDGSTWLRPVGILNPRYLRFNATVDF* |
| Ga0074479_100219102 | 3300005829 | Sediment (Intertidal) | VGTAFNQGFGADGATWLRPTAVLNPRFARFNVTFDF* |
| Ga0074470_104313421 | 3300005836 | Sediment (Intertidal) | NSNTGTGFNQNYGTDGSTYLRPNAILNPRYVRFNATIDF* |
| Ga0068870_105058632 | 3300005840 | Miscanthus Rhizosphere | DLYNLFNANTGTTFNQNFGTDGATWLRPNAILNPRYVRFNATVDF* |
| Ga0068870_109418461 | 3300005840 | Miscanthus Rhizosphere | DLYNMFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF* |
| Ga0068870_112228671 | 3300005840 | Miscanthus Rhizosphere | GIDLYNVFNTNTGTTFNQNFGTDGAIYRQEVTILNPRFARFNVTVDF* |
| Ga0068860_1010585642 | 3300005843 | Switchgrass Rhizosphere | DLYNLFNANTGTAFNQVFPVPPAADLTYLRPTAILNPRFVRFNVTFDF* |
| Ga0068862_1005097241 | 3300005844 | Switchgrass Rhizosphere | GIDLYNLFNANTGTTFNQNFGTDGSTWLRPNAILNPRYVRFNVTLDF* |
| Ga0081455_100884714 | 3300005937 | Tabebuia Heterophylla Rhizosphere | GRTRAKVGIDLYNLLNSNTGTGFNQNWGADGSTYLRPNAILNPRYVRFNATIDF* |
| Ga0075432_101954012 | 3300006058 | Populus Rhizosphere | DLYNLFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF* |
| Ga0097621_1007655412 | 3300006237 | Miscanthus Rhizosphere | TSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF* |
| Ga0097621_1013321912 | 3300006237 | Miscanthus Rhizosphere | RTNIGIDLYNLFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF* |
| Ga0097621_1021810822 | 3300006237 | Miscanthus Rhizosphere | NVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF* |
| Ga0075428_1010708672 | 3300006844 | Populus Rhizosphere | LLNANTGTSFNQNFGRDGSTWLRPNAILNPRYVRFNATIDF* |
| Ga0075428_1019855292 | 3300006844 | Populus Rhizosphere | LNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF* |
| Ga0075421_1005108861 | 3300006845 | Populus Rhizosphere | LFNANTGTAYNANFGIDGATWNRETAILNPRAVRLNITFNY* |
| Ga0075421_1025510573 | 3300006845 | Populus Rhizosphere | ANTGTTFNENFGTDGSTWLRPNAILNPRYVRFNATVDF* |
| Ga0075430_1002610051 | 3300006846 | Populus Rhizosphere | RTNVGVDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF* |
| Ga0075431_1020471801 | 3300006847 | Populus Rhizosphere | NTGTTFNENFGTDGSTWLRPNAILNPRYVRFNATVDF* |
| Ga0079217_106909071 | 3300006876 | Agricultural Soil | YRANVGFDLYNLFNANTGVFTNATTGFNPNWGTDGSTYLRPNATLNPRYARFSATVDF* |
| Ga0068865_1007916001 | 3300006881 | Miscanthus Rhizosphere | TAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF* |
| Ga0079215_101584833 | 3300006894 | Agricultural Soil | GFDLYNLFNANTGTSFNQNFGTDGSTWLRPNGILNPRYARFNATVDF* |
| Ga0079216_102963301 | 3300006918 | Agricultural Soil | NTGTTFSEGFGTDGSLYLREVTILNPRFVRFNVTVDF* |
| Ga0079216_107953131 | 3300006918 | Agricultural Soil | LYNLFNGNTATGYDQGFGTDGSTWLRPTAVLNPRFVRFNVTFDF* |
| Ga0079218_119848342 | 3300007004 | Agricultural Soil | NSNVGTAFNQGFGTNGATWLRPTAVLNPRFARFNVTFDF* |
| Ga0066710_1047981481 | 3300009012 | Grasslands Soil | NSNAGTAYNGQFGTNGSTWNRPTAILSPRFVQFNGRFDF |
| Ga0105244_104129511 | 3300009036 | Miscanthus Rhizosphere | LYNLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF* |
| Ga0105095_101236943 | 3300009053 | Freshwater Sediment | NSGTAFDQGFGADGSTWLRPTTIMNPRFVRFNVTFDF* |
| Ga0105106_109720731 | 3300009078 | Freshwater Sediment | IDLYNLLNANTGTGFNTGFGADGATYLRPTGILNPRFARFNVTIEY* |
| Ga0111539_125622861 | 3300009094 | Populus Rhizosphere | MFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF* |
| Ga0111539_130860451 | 3300009094 | Populus Rhizosphere | NANTGTAFNQAFGLDGSTWLRPTTIMNPRFVRFNVTFDF* |
| Ga0111539_132323442 | 3300009094 | Populus Rhizosphere | YNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF* |
| Ga0114129_131593062 | 3300009147 | Populus Rhizosphere | NANTGTTFNENFGTDGSTWLRPNAILNPRYVRFNATVDF* |
| Ga0111538_115028862 | 3300009156 | Populus Rhizosphere | GLDLYNLFNANTGTAFNQAFGLDGSTWLRPTTIMNPRFVRFNVTFDF* |
| Ga0111538_123295541 | 3300009156 | Populus Rhizosphere | IRRIRANVGFDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF* |
| Ga0075423_123995881 | 3300009162 | Populus Rhizosphere | FRRTRANVGIDLYNVFNTNTGTTFNQNFGVDGATYRQEVTILNPRFVRFNATVDF* |
| Ga0105248_107416261 | 3300009177 | Switchgrass Rhizosphere | GTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF* |
| Ga0129284_102324441 | 3300009514 | Beach Aquifer Porewater | IYNLFNANTPTAFNEGFGTDGTGWLTPTGILNPRFVRFNITIDY* |
| Ga0105238_128685871 | 3300009551 | Corn Rhizosphere | RTNIGIDLYNLFNANTGTAFNQAFGTDGSTWLRPTTVLNPRFLRLNVTFDF* |
| Ga0105249_122778701 | 3300009553 | Switchgrass Rhizosphere | TAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF* |
| Ga0126313_113580803 | 3300009840 | Serpentine Soil | YNLFNANTTTGYNTAYGADGSAWLNPTAILNPRFVRFNVRFDF* |
| Ga0099796_105511212 | 3300010159 | Vadose Zone Soil | LYNIFNSSNGTAFNQSFGFDGSTWLRPTAILNPRAVRFNLTFNY* |
| Ga0134070_102266182 | 3300010301 | Grasslands Soil | TGTGFNQSFGTDGATWLRPTTILNPRFVRFNVTMDF* |
| Ga0126370_114416391 | 3300010358 | Tropical Forest Soil | NLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF* |
| Ga0126370_118841392 | 3300010358 | Tropical Forest Soil | FNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF* |
| Ga0126377_134822871 | 3300010362 | Tropical Forest Soil | TAYNQAFGTDGSTWLRPTSVLNPRFVRFNVTFDF* |
| Ga0126379_128621921 | 3300010366 | Tropical Forest Soil | GVDLYNLFNANTGITFNPNYGVDGSTWLRPNAILNPRYLRFNATVDF* |
| Ga0126383_133876641 | 3300010398 | Tropical Forest Soil | GRKRVILGADVYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF* |
| Ga0134122_109487101 | 3300010400 | Terrestrial Soil | DLYNLFNANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTLDF* |
| Ga0134123_130500922 | 3300010403 | Terrestrial Soil | DLYNVFNSNTGTTFNGNFGNDGSTWLRPTAILNARFVRCNVTVNF* |
| Ga0137440_10503321 | 3300011410 | Soil | AGTAFNQNFGTNGATWLRPNGILNPRYARFNATVDF* |
| Ga0137325_11087442 | 3300011415 | Soil | TRTNVGLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF* |
| Ga0150985_1096501281 | 3300012212 | Avena Fatua Rhizosphere | GTGFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF* |
| Ga0137435_12189992 | 3300012232 | Soil | FDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF* |
| Ga0157284_101949952 | 3300012893 | Soil | DLYNVFNTNTGTTFNQNFGTDGATYRQEVTLLNPRFLRFNVTVDF* |
| Ga0157293_103138222 | 3300012898 | Soil | FNTNVGTVFNTNYGADGATWLRPTAIYTPRFLRFNVTFNY* |
| Ga0157291_100193131 | 3300012902 | Soil | LLNSNVGTAFNQAFGNDGATWLRPTVVLNPRFARFNVTFDF* |
| Ga0157291_101259151 | 3300012902 | Soil | GTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF* |
| Ga0157296_101607062 | 3300012905 | Soil | ANTGTTFQQTYDPLNNGATWLRPTAILNPRFVRFNATVDF* |
| Ga0157290_102359772 | 3300012909 | Soil | RTNVALDLYNLFNANTGTAFNQAFGTDGATYLRPTAILNPRFVRFNVTFDF* |
| Ga0137419_108600631 | 3300012925 | Vadose Zone Soil | NANTGTGFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF* |
| Ga0126375_103867732 | 3300012948 | Tropical Forest Soil | LNSNTGTGFNQNWTGDGSTYLRPNAILNPRYVRFNATIDF* |
| Ga0126375_120711052 | 3300012948 | Tropical Forest Soil | GVDLYNLFNANTGTTFNQNFGTDGSTWLRPNAILNPRYLRFNATVDF* |
| Ga0126369_135919361 | 3300012971 | Tropical Forest Soil | NANTGTSFNQNFGIDGSAWLRPNAILNPRYVRFNATVDF* |
| Ga0164305_110648271 | 3300012989 | Soil | LFNANTGTTFNQAYGTDGAAWLRPTAILNARFMRFNVTIDF* |
| Ga0157374_120125821 | 3300013296 | Miscanthus Rhizosphere | LFNANTGTVFNEVFGSDGVRWLRPTSILNARFLRFNVTLDF* |
| Ga0157378_102736711 | 3300013297 | Miscanthus Rhizosphere | LYNMLNSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF* |
| Ga0163162_113988442 | 3300013306 | Switchgrass Rhizosphere | LDLYNLFNANTGSTFNQNFGGDGATYRQEQTVLNPRFVRFNITVDF* |
| Ga0157375_116967222 | 3300013308 | Miscanthus Rhizosphere | FSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF* |
| Ga0163163_119320832 | 3300014325 | Switchgrass Rhizosphere | RTNIGIDLYNLFNANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF* |
| Ga0157380_101466911 | 3300014326 | Switchgrass Rhizosphere | NTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF* |
| Ga0157380_126604791 | 3300014326 | Switchgrass Rhizosphere | LYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF* |
| Ga0157376_100300561 | 3300014969 | Miscanthus Rhizosphere | VGVDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF* |
| Ga0157376_103922821 | 3300014969 | Miscanthus Rhizosphere | RTNIGIDLYNLFNANTGTGFNQNYGTDGSTWLRPNSILNPRYLRFNATVDF* |
| Ga0157376_127672341 | 3300014969 | Miscanthus Rhizosphere | VGVDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATLDF* |
| Ga0173478_104739891 | 3300015201 | Soil | NANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF* |
| Ga0173478_108081152 | 3300015201 | Soil | YNMFNSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF* |
| Ga0180093_10337821 | 3300015258 | Soil | NTGTTFNQNFGTDGATWLRPNAILNPRYVRFNATVDF* |
| Ga0132258_134382701 | 3300015371 | Arabidopsis Rhizosphere | NLFNSNVGTAFNQGFGTDGLLWLRPTAVLNPRFARFNVTFDF* |
| Ga0132256_1004397231 | 3300015372 | Arabidopsis Rhizosphere | IGIDLYNLFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF* |
| Ga0132255_1010028141 | 3300015374 | Arabidopsis Rhizosphere | LDLYNLFNANTGTAFNQAFGLDGSTWLRPTTIMNPRFVRFNVTFDF* |
| Ga0182038_111230951 | 3300016445 | Soil | MGQKRVILGADIYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF |
| Ga0182038_113414952 | 3300016445 | Soil | FNSNTGTAFNQAFGTDGSTWLRPTSILNPRFVRFNVTFDF |
| Ga0184640_101614583 | 3300018074 | Groundwater Sediment | DLYNLFNSNTGTGFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF |
| Ga0184625_103734951 | 3300018081 | Groundwater Sediment | TGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF |
| Ga0184628_102784271 | 3300018083 | Groundwater Sediment | NTNVGTAFNTNYGSDGATWLRPTAIYTPRFLRFNVTFNY |
| Ga0190275_115671391 | 3300018432 | Soil | YNLFNANTATTYDQGFTGDGSGWLRPTAVLNPRFVRFNLTFDF |
| Ga0066662_126948252 | 3300018468 | Grasslands Soil | LYNLFNANPGTAFNQTFSAGSPTYLRPTTILNPRFVRFNVTVDF |
| Ga0190270_109118331 | 3300018469 | Soil | GTTFNQAFGTDGTTWLRPTAVMSPRFVRFNVTMDF |
| Ga0190270_114060911 | 3300018469 | Soil | NVGTAFNQAFGNDGATWLRPTAVLNPRFARFNVTFDF |
| Ga0190270_117501522 | 3300018469 | Soil | GVDLYNLFNSNTGTTFNQNFGTDGSAWLRPNAILNPRYVRFNATVDF |
| Ga0190270_126679271 | 3300018469 | Soil | RTNVGLDLFNLFNANTGTAFNQAFGGDGATWLRPTTILNPRFLRFNVTFDF |
| Ga0190274_105873602 | 3300018476 | Soil | FNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF |
| Ga0190274_109820521 | 3300018476 | Soil | LNSNVGTAFNQAFGNDGATWLRPTAVLNPRFARFNVTFDF |
| Ga0190274_113536701 | 3300018476 | Soil | GTTFNQNFGTDGSTWLRPNAILNPRYVRFNVTLDF |
| Ga0190274_116781621 | 3300018476 | Soil | IGVDLYNLLNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF |
| Ga0190274_125990361 | 3300018476 | Soil | LYNIFNSNTGTTFNQGYGVDGSTYLRPLTILNPRFLRFNVTVDF |
| Ga0190274_136572981 | 3300018476 | Soil | FNTNTGTTFNQNFGTDGATYRQEVTLLNPRFLRFNVTVDF |
| Ga0210380_104138172 | 3300021082 | Groundwater Sediment | GLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF |
| Ga0210380_104883002 | 3300021082 | Groundwater Sediment | DAYNVFNTNVGTAFNTNYGSDGATWLRPTAIYTPRFLRFNVTFNY |
| Ga0210339_14188751 | 3300021332 | Estuarine | ANTGTAFNQVFGTNGAAWLRPNAILNPRYVRFNATIDF |
| Ga0222622_102978592 | 3300022756 | Groundwater Sediment | NLFNANPGTAFLQNFSVTNPTYLRPTTVLRPRFVRFNVTVDF |
| Ga0247783_10326111 | 3300022911 | Plant Litter | LYNLFNDNTGTTFNQAFGTDGATWLRPTAVMSPRFVRFNVTMDF |
| Ga0247754_11591162 | 3300023102 | Soil | NDNTGTTFNQAFGTDGATWLRPTAVMSPRFVRFNVTMDF |
| Ga0209108_102074251 | 3300025165 | Soil | LYNLFNANAGLTFQPAYGDGSGWLAPQTYLNARFVRFNATFDF |
| Ga0207642_100313293 | 3300025899 | Miscanthus Rhizosphere | NTGTTFNQAYGTDGAAWLRPTAILNARFLRFNATIDF |
| Ga0207684_117167192 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | LYNLFNANTGTAFNQAFGTDGSLFLRPTAILNPRFVRFNVTFDF |
| Ga0207662_108365901 | 3300025918 | Switchgrass Rhizosphere | SNTGTAFSQTFPAPPASDATFLRPTAILNPRFVRFNVTFDF |
| Ga0207681_101320401 | 3300025923 | Switchgrass Rhizosphere | MDLYNMFNSNVGTAFNQGFGADGALWLRPTAVLNPRFARFNVTFDF |
| Ga0207681_113985431 | 3300025923 | Switchgrass Rhizosphere | NTRTNVGIDLYNIFNTNTGTAFNQNFGVDGAQYLQEQTILNPRFLRFNVTFDF |
| Ga0207650_105944911 | 3300025925 | Switchgrass Rhizosphere | VAIDLYNLLNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF |
| Ga0207700_117963212 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ADIYNLFNSNAGTAYNGQFGVDGSTWNRPTAILNPRFVQFNGRFDF |
| Ga0207644_105265703 | 3300025931 | Switchgrass Rhizosphere | VGTAFNTNYGSDGATWLRPTAIYTPRFLRFNVTFNY |
| Ga0207704_111776912 | 3300025938 | Miscanthus Rhizosphere | QTNVGLDLYNMFNSNTGTSFNQGYGTDGALYLRPLTILNPRFLRFNVTFDF |
| Ga0207711_102114881 | 3300025941 | Switchgrass Rhizosphere | LYNLFNANPGTAFNQMFSVGSPTYLRPTTILRPRFVRFNVTVDF |
| Ga0207651_110085961 | 3300025960 | Switchgrass Rhizosphere | NANTGTAFNQAFGTDGAAWLRPTTVLNPRFLRFNVTFDF |
| Ga0207668_101171821 | 3300025972 | Switchgrass Rhizosphere | NTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF |
| Ga0207658_106907611 | 3300025986 | Switchgrass Rhizosphere | ANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF |
| Ga0207641_110400452 | 3300026088 | Switchgrass Rhizosphere | GTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF |
| Ga0207648_101638503 | 3300026089 | Miscanthus Rhizosphere | NTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF |
| Ga0207648_107292681 | 3300026089 | Miscanthus Rhizosphere | ANTGTTFQQTYDPLNNGATWLRPTAILNPRFVRFNATVDF |
| Ga0207676_105037182 | 3300026095 | Switchgrass Rhizosphere | MDLYNLFNSNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF |
| Ga0207675_1001995483 | 3300026118 | Switchgrass Rhizosphere | YNLFNANTGTAFNQVFPVPPAADLTYLRPTAILNPRFVRFNVTFDF |
| Ga0207683_116631121 | 3300026121 | Miscanthus Rhizosphere | TNIGIDLYNMLNANVGTAFNQGFGTDGALWMRPTAVLNPRFARFNVTFDF |
| Ga0209481_102473231 | 3300027880 | Populus Rhizosphere | RSLNLFNTNTGTSFNENFGTDGSTWLRPNAILNPRYVRFNATVDF |
| Ga0209486_100009431 | 3300027886 | Agricultural Soil | TGTSFNQNFGTDGSTWLRPNGILNPRYARFNATVDF |
| Ga0247749_10031321 | 3300027993 | Soil | VGFDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF |
| Ga0209526_108738171 | 3300028047 | Forest Soil | VDLYNLFNANTGITFNPNFGADGSTWLRPNAILNPRYLRFNATVDF |
| Ga0268265_118411922 | 3300028380 | Switchgrass Rhizosphere | NLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYARFNATVDF |
| Ga0268265_119082781 | 3300028380 | Switchgrass Rhizosphere | TGTTFNQNFGTDGATYLRPNAILNPRYVRFNATIDF |
| Ga0268265_119203651 | 3300028380 | Switchgrass Rhizosphere | LYNLFNANTGLFTGATTGFNPNWGADGSTYLRPNAILNPRYARFNATVDF |
| Ga0268264_106545631 | 3300028381 | Switchgrass Rhizosphere | LDLYNLFNANTGTAFNQAFGTDGTTFLRPTAILNPRFVRFNVTFDF |
| Ga0268264_110463461 | 3300028381 | Switchgrass Rhizosphere | NLFNANTGTAFSQTFPVPPAPDATFLRPTAILNPRFVRFNVTFDF |
| Ga0307501_101511601 | 3300031152 | Soil | NLFNANPGTAFNQNFTAESTTYLRPTTILRPRFVRINATVDF |
| Ga0307498_101591021 | 3300031170 | Soil | NVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF |
| Ga0307497_104993361 | 3300031226 | Soil | VSKILNLWHTRTNIGIDFYNLNNANTGTSFNQSYGVDGAQYLRPLTVLNPRFMRFNVTVD |
| Ga0310907_108434812 | 3300031847 | Soil | MFNSNVGTAFNQGFGTDGATWMRPTAVLNPRFARFNVTFDF |
| Ga0310904_103025101 | 3300031854 | Soil | NTNTGTAFNQNFGVDGAQYLQEQTILNPRFLRFNVTFDF |
| Ga0310892_107089062 | 3300031858 | Soil | SNVGTAFNQGFGTDGALWLRPTAVLNPRFARFNVTFDF |
| Ga0310916_111636612 | 3300031942 | Soil | KRVILGADIYNLFNSNAGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF |
| Ga0310884_106370252 | 3300031944 | Soil | RTNVGLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF |
| Ga0310910_107477541 | 3300031946 | Soil | LAKVLKLGRAKSTVGFDLYNIFNVNPGTAFNQTFSVGNPTYLRPTAILNPRFVRLNVTVD |
| Ga0310906_101289431 | 3300032013 | Soil | MFNSNVGTAFNQAFGTDGATWMRPTAVLNPRFARFNVTFDF |
| Ga0318533_113451882 | 3300032059 | Soil | AGTAYNGQFGTDGSTWNRPTAILNPRFVQFNGRFDF |
| Ga0310890_100478644 | 3300032075 | Soil | DLYNMFNANTGTTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF |
| Ga0310895_106918351 | 3300032122 | Soil | VGLDLYNLFNANTGTAFNQGFGDGSSWLRPTTIMNPRFVRFNVTFDF |
| Ga0315912_108996781 | 3300032157 | Soil | VDLYNLFNANTGTTFNQNFGTDGATWLRPNAILNPRYVRFNATVDF |
| Ga0315912_116274362 | 3300032157 | Soil | YNLFNANTGTSFNQNFGRDGSTWLRPNAILNPRYVRFNATIDF |
| Ga0310896_100506371 | 3300032211 | Soil | NMFNANTETTFNQNYGTDGSTYLRPNAILNPRYVRFNATVDF |
| Ga0310812_102815922 | 3300032421 | Soil | VDLYNLFNANTGTTFNQNFGTDGATYLRPNAILNPRYVRFNATIDF |
| Ga0335084_103656412 | 3300033004 | Soil | NSNVGTAFNQAFGTDGSTWLRPTAVLNPRFVRFNVTVDF |
| Ga0310810_110933112 | 3300033412 | Soil | VDLYNLFNANTGTSFNQNFGTDGSTWLRPNAILNPRYVRFNATVDF |
| Ga0314781_108377_440_565 | 3300034660 | Soil | LFNANTGTGFNQNYGTDGSTWLRPNAILNPRYLRFNATVDF |
| ⦗Top⦘ |