| Basic Information | |
|---|---|
| Family ID | F026557 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MINSVLTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPE |
| Number of Associated Samples | 129 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 82.74 % |
| % of genes near scaffold ends (potentially truncated) | 32.49 % |
| % of genes from short scaffolds (< 2000 bps) | 64.47 % |
| Associated GOLD sequencing projects | 110 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.31 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (68.020 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (16.244 % of family members) |
| Environment Ontology (ENVO) | Unclassified (51.777 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (60.914 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.09% β-sheet: 23.38% Coil/Unstructured: 67.53% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.31 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF06067 | DUF932 | 5.08 |
| PF13640 | 2OG-FeII_Oxy_3 | 3.05 |
| PF14025 | DUF4241 | 1.52 |
| PF01391 | Collagen | 1.02 |
| PF02945 | Endonuclease_7 | 1.02 |
| PF00685 | Sulfotransfer_1 | 1.02 |
| PF00255 | GSHPx | 0.51 |
| PF01555 | N6_N4_Mtase | 0.51 |
| PF05050 | Methyltransf_21 | 0.51 |
| PF02867 | Ribonuc_red_lgC | 0.51 |
| PF02543 | Carbam_trans_N | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG0209 | Ribonucleotide reductase alpha subunit | Nucleotide transport and metabolism [F] | 0.51 |
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 0.51 |
| COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 0.51 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 0.51 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 68.02 % |
| All Organisms | root | All Organisms | 31.98 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352005|2200035949 | Not Available | 643 | Open in IMG/M |
| 3300000756|JGI12421J11937_10046651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1434 | Open in IMG/M |
| 3300000756|JGI12421J11937_10134585 | Not Available | 628 | Open in IMG/M |
| 3300001266|B570J13884_103321 | Not Available | 1091 | Open in IMG/M |
| 3300002161|JGI24766J26685_10061066 | Not Available | 832 | Open in IMG/M |
| 3300002272|B570J29579_101302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1371 | Open in IMG/M |
| 3300002274|B570J29581_102082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1314 | Open in IMG/M |
| 3300002387|B570J29608_1000921 | Not Available | 2361 | Open in IMG/M |
| 3300002408|B570J29032_108902204 | Not Available | 536 | Open in IMG/M |
| 3300002408|B570J29032_109004100 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 564 | Open in IMG/M |
| 3300002408|B570J29032_109509330 | Not Available | 822 | Open in IMG/M |
| 3300002408|B570J29032_109643579 | Not Available | 982 | Open in IMG/M |
| 3300002408|B570J29032_109662753 | Not Available | 1013 | Open in IMG/M |
| 3300002835|B570J40625_100000090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 118981 | Open in IMG/M |
| 3300002835|B570J40625_100072546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4546 | Open in IMG/M |
| 3300002835|B570J40625_100302728 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 1620 | Open in IMG/M |
| 3300003388|JGI25910J50241_10120240 | Not Available | 705 | Open in IMG/M |
| 3300003388|JGI25910J50241_10168383 | Not Available | 563 | Open in IMG/M |
| 3300003395|JGI25917J50250_1016507 | Not Available | 1747 | Open in IMG/M |
| 3300003413|JGI25922J50271_10049871 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300003413|JGI25922J50271_10119757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 554 | Open in IMG/M |
| 3300003429|JGI25914J50564_10018830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2101 | Open in IMG/M |
| 3300003429|JGI25914J50564_10103348 | Not Available | 705 | Open in IMG/M |
| 3300003490|JGI25926J51410_1002285 | All Organisms → Viruses → Predicted Viral | 3870 | Open in IMG/M |
| 3300003491|JGI25924J51412_1054317 | Not Available | 625 | Open in IMG/M |
| 3300003497|JGI25925J51416_10073287 | Not Available | 857 | Open in IMG/M |
| 3300004796|Ga0007763_11547810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 804 | Open in IMG/M |
| 3300005517|Ga0070374_10570177 | Not Available | 562 | Open in IMG/M |
| 3300005527|Ga0068876_10406107 | Not Available | 759 | Open in IMG/M |
| 3300005528|Ga0068872_10217208 | Not Available | 1085 | Open in IMG/M |
| 3300005580|Ga0049083_10032615 | All Organisms → Viruses → Predicted Viral | 1858 | Open in IMG/M |
| 3300005580|Ga0049083_10244182 | Not Available | 605 | Open in IMG/M |
| 3300005582|Ga0049080_10084334 | All Organisms → Viruses → Predicted Viral | 1085 | Open in IMG/M |
| 3300005584|Ga0049082_10000834 | Not Available | 9237 | Open in IMG/M |
| 3300005584|Ga0049082_10004751 | All Organisms → Viruses → Predicted Viral | 4487 | Open in IMG/M |
| 3300005584|Ga0049082_10052899 | Not Available | 1424 | Open in IMG/M |
| 3300005585|Ga0049084_10044197 | Not Available | 1696 | Open in IMG/M |
| 3300005662|Ga0078894_10009916 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 7453 | Open in IMG/M |
| 3300005662|Ga0078894_10029468 | Not Available | 4513 | Open in IMG/M |
| 3300005662|Ga0078894_10175107 | All Organisms → Viruses → Predicted Viral | 1936 | Open in IMG/M |
| 3300005662|Ga0078894_10224854 | Not Available | 1700 | Open in IMG/M |
| 3300005662|Ga0078894_10970246 | Not Available | 733 | Open in IMG/M |
| 3300005662|Ga0078894_11240767 | Not Available | 630 | Open in IMG/M |
| 3300005662|Ga0078894_11257295 | Not Available | 624 | Open in IMG/M |
| 3300005805|Ga0079957_1016651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5278 | Open in IMG/M |
| 3300005805|Ga0079957_1091957 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1679 | Open in IMG/M |
| 3300005941|Ga0070743_10106235 | Not Available | 943 | Open in IMG/M |
| 3300005941|Ga0070743_10238905 | Not Available | 592 | Open in IMG/M |
| 3300005941|Ga0070743_10313573 | Not Available | 505 | Open in IMG/M |
| 3300006484|Ga0070744_10009611 | All Organisms → Viruses → Predicted Viral | 2867 | Open in IMG/M |
| 3300006484|Ga0070744_10109550 | Not Available | 797 | Open in IMG/M |
| 3300006484|Ga0070744_10138478 | Not Available | 699 | Open in IMG/M |
| 3300006484|Ga0070744_10188325 | Not Available | 588 | Open in IMG/M |
| 3300006484|Ga0070744_10249181 | Not Available | 502 | Open in IMG/M |
| 3300006639|Ga0079301_1006380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4719 | Open in IMG/M |
| 3300006641|Ga0075471_10023563 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3615 | Open in IMG/M |
| 3300006805|Ga0075464_10438965 | Not Available | 796 | Open in IMG/M |
| 3300006805|Ga0075464_10970557 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 532 | Open in IMG/M |
| 3300007162|Ga0079300_10006603 | Not Available | 4477 | Open in IMG/M |
| 3300007177|Ga0102978_1231560 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2230 | Open in IMG/M |
| 3300007545|Ga0102873_1026704 | All Organisms → Viruses → Predicted Viral | 1771 | Open in IMG/M |
| 3300007545|Ga0102873_1204701 | Not Available | 593 | Open in IMG/M |
| 3300007546|Ga0102874_1200116 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 612 | Open in IMG/M |
| 3300007548|Ga0102877_1183470 | Not Available | 590 | Open in IMG/M |
| 3300007555|Ga0102817_1089365 | Not Available | 676 | Open in IMG/M |
| 3300007562|Ga0102915_1149757 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300007597|Ga0102919_1128975 | Not Available | 796 | Open in IMG/M |
| 3300007627|Ga0102869_1195699 | Not Available | 541 | Open in IMG/M |
| 3300007629|Ga0102895_1171551 | Not Available | 564 | Open in IMG/M |
| 3300007630|Ga0102903_1172991 | Not Available | 589 | Open in IMG/M |
| 3300007642|Ga0102876_1171624 | Not Available | 578 | Open in IMG/M |
| 3300007642|Ga0102876_1172155 | Not Available | 577 | Open in IMG/M |
| 3300007644|Ga0102902_1006547 | Not Available | 3427 | Open in IMG/M |
| 3300007861|Ga0105736_1151176 | Not Available | 531 | Open in IMG/M |
| 3300007992|Ga0105748_10562038 | Not Available | 502 | Open in IMG/M |
| 3300008261|Ga0114336_1058979 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 2266 | Open in IMG/M |
| 3300008953|Ga0104241_1008574 | Not Available | 706 | Open in IMG/M |
| 3300008962|Ga0104242_1016857 | Not Available | 1272 | Open in IMG/M |
| 3300008999|Ga0102816_1095406 | Not Available | 906 | Open in IMG/M |
| 3300009026|Ga0102829_1312257 | Not Available | 525 | Open in IMG/M |
| 3300009059|Ga0102830_1016774 | All Organisms → Viruses → Predicted Viral | 2317 | Open in IMG/M |
| 3300009068|Ga0114973_10005957 | Not Available | 8236 | Open in IMG/M |
| 3300009086|Ga0102812_10690612 | Not Available | 562 | Open in IMG/M |
| 3300009152|Ga0114980_10077683 | Not Available | 1993 | Open in IMG/M |
| 3300009155|Ga0114968_10000102 | Not Available | 65137 | Open in IMG/M |
| 3300009155|Ga0114968_10002102 | Not Available | 15367 | Open in IMG/M |
| 3300009159|Ga0114978_10002606 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14860 | Open in IMG/M |
| 3300009160|Ga0114981_10251923 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 962 | Open in IMG/M |
| 3300009160|Ga0114981_10355448 | Not Available | 792 | Open in IMG/M |
| 3300009160|Ga0114981_10556195 | Not Available | 611 | Open in IMG/M |
| 3300009161|Ga0114966_10108049 | Not Available | 1861 | Open in IMG/M |
| 3300009170|Ga0105096_10185104 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
| 3300009180|Ga0114979_10732025 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300009181|Ga0114969_10336098 | Not Available | 881 | Open in IMG/M |
| 3300010370|Ga0129336_10001034 | Not Available | 16581 | Open in IMG/M |
| 3300010885|Ga0133913_12827920 | Not Available | 1167 | Open in IMG/M |
| 3300011268|Ga0151620_1003781 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 5650 | Open in IMG/M |
| 3300011268|Ga0151620_1053231 | Not Available | 1330 | Open in IMG/M |
| 3300013004|Ga0164293_10727186 | Not Available | 634 | Open in IMG/M |
| 3300013006|Ga0164294_10487307 | Not Available | 840 | Open in IMG/M |
| 3300013014|Ga0164295_10052547 | All Organisms → Viruses → Predicted Viral | 3059 | Open in IMG/M |
| 3300017761|Ga0181356_1025315 | Not Available | 2152 | Open in IMG/M |
| 3300019784|Ga0181359_1034103 | Not Available | 1970 | Open in IMG/M |
| 3300020141|Ga0211732_1085364 | Not Available | 1019 | Open in IMG/M |
| 3300020141|Ga0211732_1132867 | Not Available | 1224 | Open in IMG/M |
| 3300020141|Ga0211732_1183813 | Not Available | 2268 | Open in IMG/M |
| 3300020141|Ga0211732_1284890 | Not Available | 1791 | Open in IMG/M |
| 3300020159|Ga0211734_10280578 | Not Available | 713 | Open in IMG/M |
| 3300020160|Ga0211733_11223922 | Not Available | 563 | Open in IMG/M |
| 3300020506|Ga0208091_1001188 | Not Available | 4213 | Open in IMG/M |
| 3300020542|Ga0208857_1007175 | Not Available | 1915 | Open in IMG/M |
| 3300020561|Ga0207934_1001289 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 3645 | Open in IMG/M |
| 3300021140|Ga0214168_1004422 | Not Available | 5037 | Open in IMG/M |
| 3300021141|Ga0214163_1026211 | All Organisms → Viruses → Predicted Viral | 1701 | Open in IMG/M |
| 3300021519|Ga0194048_10000420 | Not Available | 20590 | Open in IMG/M |
| 3300021519|Ga0194048_10005716 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5918 | Open in IMG/M |
| 3300021519|Ga0194048_10006821 | Not Available | 5384 | Open in IMG/M |
| 3300021602|Ga0194060_10277089 | Not Available | 834 | Open in IMG/M |
| 3300021956|Ga0213922_1001890 | Not Available | 7499 | Open in IMG/M |
| 3300021962|Ga0222713_10032004 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → Gaiavirus → Mycobacterium virus Gaia | 4227 | Open in IMG/M |
| 3300021962|Ga0222713_10066093 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2693 | Open in IMG/M |
| 3300022407|Ga0181351_1073596 | Not Available | 1378 | Open in IMG/M |
| 3300023174|Ga0214921_10006379 | All Organisms → Viruses | 16205 | Open in IMG/M |
| 3300023174|Ga0214921_10007594 | Not Available | 14394 | Open in IMG/M |
| 3300023174|Ga0214921_10014584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9082 | Open in IMG/M |
| 3300023174|Ga0214921_10057863 | All Organisms → Viruses → Predicted Viral | 3315 | Open in IMG/M |
| 3300023174|Ga0214921_10298454 | Not Available | 899 | Open in IMG/M |
| 3300023174|Ga0214921_10373551 | Not Available | 744 | Open in IMG/M |
| 3300023179|Ga0214923_10319582 | Not Available | 834 | Open in IMG/M |
| 3300024346|Ga0244775_10003389 | Not Available | 16955 | Open in IMG/M |
| 3300024346|Ga0244775_10014843 | Not Available | 7250 | Open in IMG/M |
| 3300024346|Ga0244775_10020304 | Not Available | 6065 | Open in IMG/M |
| 3300024346|Ga0244775_10054640 | All Organisms → Viruses → Predicted Viral | 3464 | Open in IMG/M |
| 3300024346|Ga0244775_10069780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3015 | Open in IMG/M |
| 3300024346|Ga0244775_10073723 | All Organisms → Viruses → Predicted Viral | 2923 | Open in IMG/M |
| 3300024346|Ga0244775_10085118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2698 | Open in IMG/M |
| 3300024346|Ga0244775_10123420 | Not Available | 2193 | Open in IMG/M |
| 3300024346|Ga0244775_10337718 | Not Available | 1245 | Open in IMG/M |
| 3300024346|Ga0244775_10642835 | Not Available | 858 | Open in IMG/M |
| 3300024346|Ga0244775_10650561 | Not Available | 852 | Open in IMG/M |
| 3300024346|Ga0244775_10745791 | Not Available | 786 | Open in IMG/M |
| 3300024346|Ga0244775_11054188 | Not Available | 639 | Open in IMG/M |
| 3300024348|Ga0244776_10104651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2112 | Open in IMG/M |
| 3300024348|Ga0244776_10212748 | Not Available | 1367 | Open in IMG/M |
| 3300025872|Ga0208783_10034523 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2387 | Open in IMG/M |
| 3300027084|Ga0208443_1080241 | Not Available | 643 | Open in IMG/M |
| 3300027084|Ga0208443_1100721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300027114|Ga0208009_1005019 | Not Available | 3505 | Open in IMG/M |
| 3300027114|Ga0208009_1013031 | All Organisms → Viruses → Predicted Viral | 1993 | Open in IMG/M |
| 3300027135|Ga0255073_1006219 | Not Available | 2318 | Open in IMG/M |
| 3300027138|Ga0255064_1016122 | Not Available | 1300 | Open in IMG/M |
| 3300027216|Ga0208677_1047150 | Not Available | 571 | Open in IMG/M |
| 3300027231|Ga0208172_1073991 | Not Available | 572 | Open in IMG/M |
| 3300027308|Ga0208796_1101159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300027320|Ga0208923_1019119 | Not Available | 1208 | Open in IMG/M |
| 3300027492|Ga0255093_1083687 | Not Available | 595 | Open in IMG/M |
| 3300027571|Ga0208897_1173907 | Not Available | 526 | Open in IMG/M |
| 3300027581|Ga0209651_1000733 | Not Available | 11576 | Open in IMG/M |
| 3300027581|Ga0209651_1057706 | Not Available | 1144 | Open in IMG/M |
| 3300027586|Ga0208966_1000036 | Not Available | 38973 | Open in IMG/M |
| 3300027586|Ga0208966_1000747 | Not Available | 10227 | Open in IMG/M |
| 3300027586|Ga0208966_1012382 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2537 | Open in IMG/M |
| 3300027597|Ga0255088_1028968 | Not Available | 1213 | Open in IMG/M |
| 3300027621|Ga0208951_1000956 | Not Available | 13054 | Open in IMG/M |
| 3300027627|Ga0208942_1186781 | Not Available | 539 | Open in IMG/M |
| 3300027631|Ga0208133_1072453 | Not Available | 817 | Open in IMG/M |
| 3300027644|Ga0209356_1062696 | Not Available | 1135 | Open in IMG/M |
| 3300027679|Ga0209769_1071091 | Not Available | 1148 | Open in IMG/M |
| 3300027707|Ga0209443_1327468 | Not Available | 503 | Open in IMG/M |
| 3300027720|Ga0209617_10361177 | Not Available | 535 | Open in IMG/M |
| 3300027744|Ga0209355_1197901 | Not Available | 824 | Open in IMG/M |
| 3300027754|Ga0209596_1000050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 100398 | Open in IMG/M |
| 3300027754|Ga0209596_1029420 | Not Available | 3129 | Open in IMG/M |
| 3300027769|Ga0209770_10250462 | Not Available | 686 | Open in IMG/M |
| 3300027782|Ga0209500_10000724 | Not Available | 27249 | Open in IMG/M |
| 3300027797|Ga0209107_10067434 | Not Available | 1982 | Open in IMG/M |
| 3300027797|Ga0209107_10182919 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1046 | Open in IMG/M |
| 3300027805|Ga0209229_10006260 | Not Available | 4970 | Open in IMG/M |
| 3300027805|Ga0209229_10169162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 982 | Open in IMG/M |
| 3300027892|Ga0209550_10434235 | Not Available | 804 | Open in IMG/M |
| 3300027963|Ga0209400_1001021 | Not Available | 23804 | Open in IMG/M |
| 3300027973|Ga0209298_10000721 | Not Available | 21990 | Open in IMG/M |
| 3300027973|Ga0209298_10002210 | Not Available | 12195 | Open in IMG/M |
| 3300027974|Ga0209299_1000011 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae | 115619 | Open in IMG/M |
| 3300027974|Ga0209299_1177453 | Not Available | 790 | Open in IMG/M |
| 3300031758|Ga0315907_11067434 | Not Available | 577 | Open in IMG/M |
| 3300031857|Ga0315909_10033124 | Not Available | 4979 | Open in IMG/M |
| 3300031951|Ga0315904_11457211 | Not Available | 507 | Open in IMG/M |
| 3300032116|Ga0315903_10108302 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2637 | Open in IMG/M |
| 3300033992|Ga0334992_0017139 | All Organisms → Viruses → Predicted Viral | 4571 | Open in IMG/M |
| 3300033992|Ga0334992_0078883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1798 | Open in IMG/M |
| 3300034013|Ga0334991_0019759 | Not Available | 3964 | Open in IMG/M |
| 3300034022|Ga0335005_0345108 | Not Available | 871 | Open in IMG/M |
| 3300034023|Ga0335021_0353711 | Not Available | 776 | Open in IMG/M |
| 3300034066|Ga0335019_0013185 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C403 | 5687 | Open in IMG/M |
| 3300034102|Ga0335029_0115516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1876 | Open in IMG/M |
| 3300034356|Ga0335048_0083114 | All Organisms → Viruses → Predicted Viral | 1964 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 16.24% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 12.69% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 11.68% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 10.15% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.14% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 6.60% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.09% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.06% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.54% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.03% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 2.03% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.03% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 2.03% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.03% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 2.03% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.52% |
| Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.02% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.02% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.02% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 1.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.51% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.51% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 0.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 0.51% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352005 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001266 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
| 3300002272 | Freshwater microbial communities from Lake Mendota, WI - 27JUL2010 deep hole epilimnion ns | Environmental | Open in IMG/M |
| 3300002274 | Freshwater microbial communities from Lake Mendota, WI - 12OCT2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002387 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003388 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003490 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003491 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003497 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN | Environmental | Open in IMG/M |
| 3300004796 | Metatranscriptome of freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
| 3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
| 3300005528 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel1S_2200h metaG | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005585 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ON33MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300007162 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series HT 2014_7_11 | Environmental | Open in IMG/M |
| 3300007177 | Combined Assembly of cyanobacterial bloom in Marina Bay water reservoir, Singapore (Diel cycle-Surface and Bottom layers) 16 sequencing projects | Environmental | Open in IMG/M |
| 3300007545 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-3 | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007597 | Estuarine microbial communities from the Columbia River estuary - metaG 1563A-02 | Environmental | Open in IMG/M |
| 3300007627 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-02 | Environmental | Open in IMG/M |
| 3300007629 | Estuarine microbial communities from the Columbia River estuary - metaG 1554B-3 | Environmental | Open in IMG/M |
| 3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007644 | Estuarine microbial communities from the Columbia River estuary - metaG 1555B-02 | Environmental | Open in IMG/M |
| 3300007861 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1372B_3um | Environmental | Open in IMG/M |
| 3300007992 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008953 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT4 | Environmental | Open in IMG/M |
| 3300008962 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007_MT5 | Environmental | Open in IMG/M |
| 3300008999 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.545 | Environmental | Open in IMG/M |
| 3300009026 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009086 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.713 | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009161 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG | Environmental | Open in IMG/M |
| 3300009170 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
| 3300010885 | northern Canada Lakes Co-assembly | Environmental | Open in IMG/M |
| 3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020506 | Freshwater microbial communities from Lake Mendota, WI - 26OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020542 | Freshwater microbial communities from Lake Mendota, WI - 05NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020561 | Freshwater microbial communities from Lake Mendota, WI - 22APR2009 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021602 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Sep2016-L222-5m | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027114 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes) | Environmental | Open in IMG/M |
| 3300027135 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepB_8h | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027216 | Estuarine microbial communities from the Columbia River estuary - metaG 1546A-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027231 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027308 | Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.725 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027492 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d | Environmental | Open in IMG/M |
| 3300027571 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027644 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027707 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.DCMD (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027744 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027769 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027963 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027974 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300033992 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME16Jun2014-rr0035 | Environmental | Open in IMG/M |
| 3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034023 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Oct2016-rr0090 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034356 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jun2014-rr0152 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| 2200247771 | 2199352005 | Freshwater | MINSVLTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAN |
| JGI12421J11937_100466517 | 3300000756 | Freshwater And Sediment | MINSVLTIPCEECHSTGLIFFGDNDNFDVETCVCDFGIEQDLNLFNTPEAN* |
| JGI12421J11937_101345853 | 3300000756 | Freshwater And Sediment | MINSVMTIPCEECHSTGLIFFGEGDTYDVETCVCDFGMEQDLNLFNTPESN* |
| B570J13884_1033213 | 3300001266 | Freshwater | MINSVLSIPCDECNSTGLIFFGNDYDYDVETCECDFGIEQDNFLNNN* |
| JGI24766J26685_100610661 | 3300002161 | Freshwater And Sediment | MINSVLTIPCDECNSSGLIFFGDGNDYDVETCECDFGIEQDNLLNNN* |
| B570J29579_1013021 | 3300002272 | Freshwater | MINSVMRIDCSDCNSTGLIFFGDNNNFDVETCDCDXGKEQDLFXN* |
| B570J29581_1020826 | 3300002274 | Freshwater | PCEECNSTGLIFFGNDFDYDVETCECDFGIEQDLNQFNN* |
| B570J29608_100092110 | 3300002387 | Freshwater | VLTIPCEECNSTGLIFFGNDFDYDVETCSCDFGIAQDNLLDNN* |
| B570J29032_1089022042 | 3300002408 | Freshwater | MINSVMTIPCEECHSTGLIFFGDNDTFDTETCVCDFGMEQDLNLFNTPESN* |
| B570J29032_1090041001 | 3300002408 | Freshwater | IMINSVMRIDCSDCNSTGLIFFGDNNNFDVETCDCDFGKEQDLFFN* |
| B570J29032_1095093302 | 3300002408 | Freshwater | MINSVLTIPCEECNSSGLIFFGNGEDYDVETCSCDFGIEQDNLLDNN* |
| B570J29032_1096435794 | 3300002408 | Freshwater | SVLTIPCEECNSTGLIFFGNDFDYDVETCECDFGIEQDLNQFNN* |
| B570J29032_1096627532 | 3300002408 | Freshwater | MINSVLTIPCDECNSSGLIFFGNDYDYDVETCECDFGIEQDNLLNNN* |
| B570J40625_100000090131 | 3300002835 | Freshwater | MINSVLTIPCEECNSTGLIFFGNDFDYDVETCECDFGIEQDLNQFNN* |
| B570J40625_1000725469 | 3300002835 | Freshwater | MINSVLTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAN* |
| B570J40625_1003027282 | 3300002835 | Freshwater | MINSVMRIDCSECNSTGLIFFGDNNNFDVETCDCDFGKEQDLFFN* |
| JGI25910J50241_101202401 | 3300003388 | Freshwater Lake | MINSVLTIPCEECNSTGLLFFGNDNDFDVETCECDFSLEQDLNLFNTPESN* |
| JGI25910J50241_101683832 | 3300003388 | Freshwater Lake | MINSVLTIPCEECHATGLIFFGDEDNFDVETCVCDFGMEQDLNLFNTPESN* |
| JGI25917J50250_10165072 | 3300003395 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAD* |
| JGI25922J50271_100498713 | 3300003413 | Freshwater Lake | MINSVMRIDCSECNSTGLIFFGDNNNFDVETCDCDFGKEQDSFFN* |
| JGI25922J50271_101197571 | 3300003413 | Freshwater Lake | MINSVMRIDCSDCNSTGLIFFGDNNNFDVETCDCDFGKEQDSFFN |
| JGI25914J50564_100188306 | 3300003429 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGNDEDFDVETCVCDFGMEQDLNLFNTPEAN* |
| JGI25914J50564_101033482 | 3300003429 | Freshwater Lake | MINSVLTIPCEECHATGLIFFGDEDNFDVETCVCDFGMEQDLNLFNTPES |
| JGI25926J51410_10022858 | 3300003490 | Freshwater Lake | MINSVMSIPCEECHSTGLIFFGDNDNFDVETCECDFGIEQDLNQFNN* |
| JGI25924J51412_10543172 | 3300003491 | Freshwater Lake | MINSVLTIPCEECHATGLIFFGDEDNFDVETCVCDFGMEQDLN |
| JGI25925J51416_100732872 | 3300003497 | Freshwater Lake | MINSVLTIPCEECHATGLIFFGDEDXXDVETCVCDXGMEQDLNLFNTPEXN* |
| Ga0007763_115478103 | 3300004796 | Freshwater Lake | MINSVMRIDCSDCNSTGLIFFGDNNNFDVETCDCDFGKEQDLFFN* |
| Ga0070374_105701771 | 3300005517 | Freshwater Lake | MTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFN |
| Ga0068876_104061072 | 3300005527 | Freshwater Lake | MINSVLTIPCEECHSTGLIFFGNDEDFDVETCSCDFGIEQDNLLDNN* |
| Ga0068872_102172085 | 3300005528 | Freshwater Lake | MINSVLTIPCEECHSTGLIFFGNDEDFDVETCSCDFGIEQDNLLNNN |
| Ga0049083_100326157 | 3300005580 | Freshwater Lentic | MINSVLTIPCEECHATGLIFFGDEDNFDVETCVCDFGMEQDLYLFNTPEAN* |
| Ga0049083_102441822 | 3300005580 | Freshwater Lentic | MINSVLTIPCEECHSTGLIFFGNDEDFDIETCVCDFGIEQDLNLFNTPEAN* |
| Ga0049080_100843344 | 3300005582 | Freshwater Lentic | MINSVMTIPCEECHSTGLIFFGNDEDFDVETCVCDF |
| Ga0049082_1000083410 | 3300005584 | Freshwater Lentic | MINSVLSIPCEECHATGLIFFGDEDNFDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0049082_1000475114 | 3300005584 | Freshwater Lentic | MTIPCEECHSTGLIFFGEGDTYDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0049082_100528996 | 3300005584 | Freshwater Lentic | HSTGLIFFGEGDTYDVETCVCDFGMEQDLNLFNTPESN* |
| Ga0049084_100441972 | 3300005585 | Freshwater Lentic | MINSVMTIPCEECHSTGLIFFGDNDNFDTETCVCDFGAEQDLNLFNTPEAN* |
| Ga0078894_100099166 | 3300005662 | Freshwater Lake | MINSVLTIPCEECNSTGLIFFGNDFDYDVETCSCDFGIAQDNLLDNN* |
| Ga0078894_100294685 | 3300005662 | Freshwater Lake | MINSVLTIPCDECNSTGLIFFGNDNDFDVETCNCDFGQEQDFNLFNN* |
| Ga0078894_101751072 | 3300005662 | Freshwater Lake | MINSVLTIPCEECHSTGLIFFGNDNDYDVETCECDFGIEQDLNQFNN* |
| Ga0078894_102248546 | 3300005662 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGNDEDFDVETCVCDFGIEQDLNLFNTPEAN* |
| Ga0078894_109702462 | 3300005662 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGDNDNFDVETCVCDFGIEQDLNLFNTPEAN* |
| Ga0078894_112407673 | 3300005662 | Freshwater Lake | MINSVMTIPCDECNSTGLIFFGNDNDFDVETCNCDFGAEQDFFLFNTPEAN* |
| Ga0078894_112572952 | 3300005662 | Freshwater Lake | MINSVLSIPCDECNSTGLIFFGNDYDYDVETCECDFGIEQDEFLNNN* |
| Ga0079957_101665111 | 3300005805 | Lake | MINSVLTIPCEECHSTGLIFFGNDEDFDVETCVCDFGIEQDLNLFNTPEAN* |
| Ga0079957_10919572 | 3300005805 | Lake | MINSVLTIPCEECNSTGLIFFGNDLDFDVETCVCDFGIEQDNLLDNN* |
| Ga0070743_101062355 | 3300005941 | Estuarine | INSVLTIPCEECNSTGLIFFGNDEDFDVETCECDFGIEQDLEQFNN* |
| Ga0070743_102389052 | 3300005941 | Estuarine | MINSVMTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0070743_103135731 | 3300005941 | Estuarine | INSVLTIPCEECNSTGLIFFGNDFDYDVETCSCDFGMEQDLNLFNTPEAN* |
| Ga0070744_100096113 | 3300006484 | Estuarine | MINSVLTIPCEECNSTGLLFFGNANDYDVETCECDFSLEQDLNLFNTPESN* |
| Ga0070744_101095501 | 3300006484 | Estuarine | CEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0070744_101384782 | 3300006484 | Estuarine | MINSVLSIPCEECHSTGLIFFGDEDNFDVETCVCDFGMEQDLNLFNTPESN* |
| Ga0070744_101883251 | 3300006484 | Estuarine | MINSVLTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPE |
| Ga0070744_102491812 | 3300006484 | Estuarine | MINSVLSIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPE |
| Ga0079301_100638010 | 3300006639 | Deep Subsurface | MINSVLSVPCDECHSTGLIFFGDNNNFDVETCECDFGIEQDLNQFNN* |
| Ga0075471_100235639 | 3300006641 | Aqueous | MINSVLTIPCDECNSTGLIFFGNGNDYDVETCDCDFGAEQDLNLFNN* |
| Ga0075464_104389652 | 3300006805 | Aqueous | MINSVLTIPCEECHSTGLIFFGNDNDFDVETCECDFGIEQDLNQFNN* |
| Ga0075464_109705571 | 3300006805 | Aqueous | MINSVMRIDCSECNSTGLIFFGDNNNFDVETCDCDFGKEQDLF |
| Ga0079300_100066034 | 3300007162 | Deep Subsurface | MINSVLSIPCDECNSTGLIFFGNNDDFDTETCSCDFGKEQDFFLFTTPEAN* |
| Ga0102978_12315602 | 3300007177 | Freshwater Lake | MINSVLTIPCDECNSTGLIFFGNGNDYDVETCNCDFGQEQDLNLFNN* |
| Ga0102873_10267041 | 3300007545 | Estuarine | MINSVLTIPCEECNSTGLIFFGNDEDFDVETCECDFGIEQDLEQFNN* |
| Ga0102873_12047011 | 3300007545 | Estuarine | MINSVMRIDCSECNSTGLIFFGNENDFDVETCDCDFGKEQD |
| Ga0102874_12001161 | 3300007546 | Estuarine | INSVMRIDCSECNSTGLIFFGNENDFDVETCDCDFGKEQDLIN* |
| Ga0102877_11834702 | 3300007548 | Estuarine | MINSVLSIPCDECNSTGLIFFGNDYDYDVETCECDFGIEQDLQQFNN* |
| Ga0102817_10893652 | 3300007555 | Estuarine | MINSVLSIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0102915_11497573 | 3300007562 | Estuarine | MINSVLEIECNECHSSGLIFFGDGNDFDVETCDCDFGKE |
| Ga0102919_11289751 | 3300007597 | Estuarine | STGLIFFGNDNDFDVETCNCDFGAEQDFFLFNTPEAN* |
| Ga0102869_11956992 | 3300007627 | Estuarine | MINSVLSIPCEECHSTGLIFFGDKDNFDVETCVCDFGIEQDLNLFNTPEAN* |
| Ga0102895_11715511 | 3300007629 | Estuarine | NSVLTIPCDECNSTGLIFFGNDFDYDVETCSCDFGKEQDLNFFNN* |
| Ga0102903_11729913 | 3300007630 | Estuarine | MINSVMRIDCSECNSTGLIFFGNENDFDVETCDCDFGKEQ |
| Ga0102876_11716243 | 3300007642 | Estuarine | MINSVMRIDCSECNSTGLIFFGNENDFDVETCDCDF |
| Ga0102876_11721551 | 3300007642 | Estuarine | MINSVLTIPCEECNSTGLIFFGNDFDYDVETCSCDFGMEQDLNLFNTPEAN* |
| Ga0102902_10065478 | 3300007644 | Estuarine | MINSVMRIDCSECNSTGLIFFGNENDFDVETCDCDFGKEQDLIN* |
| Ga0105736_11511761 | 3300007861 | Estuary Water | MINSVMTIPCDECNSTGLIFFGNDNDFDVETCECDFGIEQDLNQFNN* |
| Ga0105748_105620382 | 3300007992 | Estuary Water | IPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0114336_10589793 | 3300008261 | Freshwater, Plankton | MINSVMRIDCSECNSTGLIFFGDNNNFDVETCDCDFGKEHDLFFN* |
| Ga0104241_10085742 | 3300008953 | Freshwater | MINSVMTFPCDECNGSGLIFFGNDFDYDVETCECDFGIEQDNLLDNN* |
| Ga0104242_10168572 | 3300008962 | Freshwater | MINSVLSIPCEECHSTGLIFFGNENDFDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0102816_10954061 | 3300008999 | Estuarine | MINSVLTIPCEECNSTGLLFFGNDNDFDVETCECDFGTEQDLQQFNN* |
| Ga0102829_13122572 | 3300009026 | Estuarine | MINSVMTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPESN* |
| Ga0102830_10167741 | 3300009059 | Estuarine | VINSVMRIDCSECNSTGLIFFGNENDFDVETCDCDFGKEQD |
| Ga0114973_1000595723 | 3300009068 | Freshwater Lake | MINSVLSIPCEECHSTGLIFWGNDLDYDVETCVCDFGMEQDLKLFNTPEAN* |
| Ga0102812_106906121 | 3300009086 | Estuarine | MTIPCDECNSTGLIFFGNDNDFDVETCNCDFGAEQDFFLFNTPEAN |
| Ga0114980_100776837 | 3300009152 | Freshwater Lake | MINSVMTFPCDECNSTGLIFWGNDLDYDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0114968_1000010271 | 3300009155 | Freshwater Lake | MINSVLSIPCEECHSTGLIFWGNDLDYDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0114968_1000210214 | 3300009155 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGDNDNFDTETCECDFGIEQDLYFFNNNN* |
| Ga0114978_100026069 | 3300009159 | Freshwater Lake | MINSVLTIPCEECHSTGLIFFGNGNDFDVETCVCDFGMEQDLNLFNTPESN* |
| Ga0114981_102519231 | 3300009160 | Freshwater Lake | MTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0114981_103554483 | 3300009160 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLN |
| Ga0114981_105561953 | 3300009160 | Freshwater Lake | EECHSTGLLFFGNDNDFDVETCECDFGTEQDLQQFNN* |
| Ga0114966_101080495 | 3300009161 | Freshwater Lake | MINSVLEIPCEECHATGLLFFGNANDFDVETCECDFSLEQDLNLFNTPESN* |
| Ga0105096_101851043 | 3300009170 | Freshwater Sediment | MINSVLTIPCEDCNSSGLIFFGEGDDYDVETCDCDFGKEQDEFLNNN* |
| Ga0114979_107320251 | 3300009180 | Freshwater Lake | MINSVLTIPCEECHSTGLIFFGNGNDFDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0114969_103360982 | 3300009181 | Freshwater Lake | MINSVLTIPCEECHATGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAN* |
| Ga0129336_1000103419 | 3300010370 | Freshwater To Marine Saline Gradient | MINSVLTIPCDECNSTGLIFFGNDFDYDVETCSCDFGKEQDLNFFNN* |
| Ga0133913_128279204 | 3300010885 | Freshwater Lake | SVMTIPCEECHSTGLIFFGDNDNFDTETCECDFGIEQDLYFFNNNN* |
| Ga0151620_10037815 | 3300011268 | Freshwater | MINSVLTIPCDECNSTGLIFFGNGDDYDVETCDCDFGAEQDLNLFNN* |
| Ga0151620_10532312 | 3300011268 | Freshwater | MINSVLTIPCDECNSSGLIFFGDGNDFDVETCSCDFGIEQDNLLDNN* |
| Ga0164293_107271862 | 3300013004 | Freshwater | MINSVMTIPCEECHSTGLIFFGNDEDFDVETCVCDFGMEQDLNLFNTPESN* |
| Ga0164294_104873074 | 3300013006 | Freshwater | MINSVLSIPCEECHSTGLIFFGDNDNFDTETCQGDYGMEQDLYLFNTPEAN* |
| Ga0164295_100525479 | 3300013014 | Freshwater | MINSVMTFPCEECNSTGLIFWGNDLDYDVETCVCDFGIEQDLNLFNTPEAN* |
| Ga0181356_10253156 | 3300017761 | Freshwater Lake | MINSVLTIPCEECHATGLIFFGDEDNFDVETCVCDFGMEQDLYLFNTPEAN |
| Ga0181359_10341035 | 3300019784 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAD |
| Ga0211732_10853642 | 3300020141 | Freshwater | MINSVLTIPCEECHSTGLIFFGDNDNFDVETCVCDFGKEQDLNLFNTPEAN |
| Ga0211732_11328673 | 3300020141 | Freshwater | MINSVLTIPCEECNSSGLIFFGNGEDFDVETCSCDFGIEQDNLLDNN |
| Ga0211732_11838132 | 3300020141 | Freshwater | MINSVLTIPCEECHSTGLIFFGDNDNFDVETCVCDFGIEQDLNLFNTPEAN |
| Ga0211732_12848907 | 3300020141 | Freshwater | MINSVLSIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDFNLFNTPEAN |
| Ga0211734_102805782 | 3300020159 | Freshwater | MINSVLTIPCEECHSTGLIFFGDNDNFDTETCVCDFGAEQDLYLFNTPEAN |
| Ga0211733_112239222 | 3300020160 | Freshwater | MINSVLTIPCEECHSTGLIFFGDNDNFDVETCVCDF |
| Ga0208091_10011889 | 3300020506 | Freshwater | MINSVLTIPCEECNSTGLIFFGNDFDYDVETCECDFGIEQDLNQFNN |
| Ga0208857_10071752 | 3300020542 | Freshwater | MINSVLTIPCEECNLTGLIFFGNDFDYDVETCECDFGIEQDLNQFNN |
| Ga0207934_10012896 | 3300020561 | Freshwater | MINSVMRIDCSECNSTGLIFFGDNNNFDVETCDCDFGKEQDLFFN |
| Ga0214168_10044227 | 3300021140 | Freshwater | MINSVLTIPCEECNSSGLIFFGNGEDYDVETCSCDFGIEQDNLLDNN |
| Ga0214163_10262117 | 3300021141 | Freshwater | PCEECHSTGLIFFGDNDTFDTETCVCDFGMEQDLNLFNTPESN |
| Ga0194048_1000042041 | 3300021519 | Anoxic Zone Freshwater | MINSVLTIPCEECNSTGLLFFGNDNDFDVETCQCDFGTEQDLQQFNN |
| Ga0194048_100057166 | 3300021519 | Anoxic Zone Freshwater | MINSVLAIDCSECNSTGLIFFGNENDFDVETCDCDFGKEQDLIN |
| Ga0194048_1000682113 | 3300021519 | Anoxic Zone Freshwater | MINSVMTIPCEECHSTGLIFFGDEDNFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0194060_102770894 | 3300021602 | Anoxic Zone Freshwater | LRYSRNYWHTKRQGGTVMINSVMTIPCEECHSTGLIFFGDEDNFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0213922_100189019 | 3300021956 | Freshwater | MINSVMRIECDECNSTGLIFFGNGNDYDVETCDCDFGNEQDLFFN |
| Ga0222713_1003200414 | 3300021962 | Estuarine Water | MINSVMRIDCSECNSTGLIFFGDNHNFDVETCDCDFGKEQDLFFN |
| Ga0222713_100660937 | 3300021962 | Estuarine Water | MINSVLTIPCDECNSTGLIFFGNDFDYDVETCSCDFGKEQDLNFFNN |
| Ga0181351_10735962 | 3300022407 | Freshwater Lake | MINSVLTIPCEECHATGLIFFGDEDNFDVETCVCDFGMEQDLNLFNTPESN |
| Ga0214921_1000637928 | 3300023174 | Freshwater | MINSVMRIDCSECNSTGLIFFGDNNNFDVETCDCDFGKEQDSFFN |
| Ga0214921_100075948 | 3300023174 | Freshwater | MINSVLSIPCEECHSTGLIFFGNENDFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0214921_1001458412 | 3300023174 | Freshwater | MINSVMTIPCEECHSTGLIFFGENDNFDVETCVCDFGMEQDLNLFNTPESN |
| Ga0214921_1005786310 | 3300023174 | Freshwater | MINSVMTIPCEECHATGLIFFGDKDNFDVETCVCDFGMEQDLNLFNTPESN |
| Ga0214921_102984543 | 3300023174 | Freshwater | MINSVLTIPCEECNSTGLIFFGNDFDYDVETCECNFGIEQDNLLDNN |
| Ga0214921_103735512 | 3300023174 | Freshwater | MINSVMTFPCDECNGSGLIFFGNDFDYDVETCECDFGIEQDNLLDNN |
| Ga0214923_103195823 | 3300023179 | Freshwater | MINSVMTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPESN |
| Ga0244775_1000338928 | 3300024346 | Estuarine | MINSVMTIPCDECNSTGLIFFGNDNDFDVETCNCDFGAEQDFFLFNTPEAN |
| Ga0244775_1001484315 | 3300024346 | Estuarine | MINSVLSIPCDECNSTGLIFFGNDYDYDVETCECDFGIEQDLQQFNN |
| Ga0244775_100203046 | 3300024346 | Estuarine | MINSVLTIPCEECNSTGLIFFGNDEDFDVETCECDFGIEQDLEQFNN |
| Ga0244775_100546409 | 3300024346 | Estuarine | MINSVLTIPCEECNSTGLLFFGNANDYDVETCECDFSLEQDLNLFNTPESN |
| Ga0244775_100697806 | 3300024346 | Estuarine | MINSVMSILCEDCNSTGLIFFGSGEDYDVETCDCVTNEMENN |
| Ga0244775_100737234 | 3300024346 | Estuarine | MINSVMTIPCEECHSTGLIFFGEGDTYDVETCVCDFGMEQDLNLFNTPESN |
| Ga0244775_100851182 | 3300024346 | Estuarine | MINSVMTIPCEECNETGLIFFGNGEDFDVETCECDFGAEQDLYFFNNNN |
| Ga0244775_101234206 | 3300024346 | Estuarine | MINSVLTIPCEECHSTGLLFFGNDNDFDVETCECDFGTEQDLQQFNN |
| Ga0244775_103377184 | 3300024346 | Estuarine | MINSVLTIPCEECNSTGLLFFGNDNDFDVETCECDFGTEQDLQQFNN |
| Ga0244775_106428352 | 3300024346 | Estuarine | MINSVLSIPCEECHSTGLIFFGDEDNFDVETCVCDFGMEQDLNLFNTPESN |
| Ga0244775_106505612 | 3300024346 | Estuarine | MINSVMTIPCDECNSTGLIFFGNDNDFDVETCECDFGIEQDLNQFNN |
| Ga0244775_107457911 | 3300024346 | Estuarine | TGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0244775_110541883 | 3300024346 | Estuarine | IMINSVMTIPCEECHSTGLIFFGENDNFDVETCVCDFGMEQDLNLFNTPESN |
| Ga0244776_101046516 | 3300024348 | Estuarine | MINSVMTIPCDECNSTGLIFFGNDNDFDVETCNCDFGA |
| Ga0244776_102127482 | 3300024348 | Estuarine | MINSVMTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0208783_100345238 | 3300025872 | Aqueous | MINSVLTIPCDECNSTGLIFFGNGDDYDVETCDCDFGAEQDLNLFNN |
| Ga0208443_10802411 | 3300027084 | Estuarine | MINSVMRIDCSECNSTGLIFFGNENDFDVETCDCDFGKEQDLIN |
| Ga0208443_11007211 | 3300027084 | Estuarine | IMINSVMRIDCSECNSTGLIFFGDNNNFDVETCDCDFGKEQDSFFN |
| Ga0208009_100501910 | 3300027114 | Deep Subsurface | MINSVLSVPCDECHSTGLIFFGDNNNFDVETCECDFGIEQDLNQFNN |
| Ga0208009_10130316 | 3300027114 | Deep Subsurface | MINSVLSIPCDECNSTGLIFFGNNDDFDTETCSCDFGKEQDFFLFTTPEAN |
| Ga0255073_10062194 | 3300027135 | Freshwater | MINSVMTIPCEECHSTGLIFFGNDEDFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0255064_10161226 | 3300027138 | Freshwater | INSVMTIPCEECNSTGLIFFGNNEDFDVETCVCDFGIEQDLNLFNTPEAN |
| Ga0208677_10471503 | 3300027216 | Estuarine | MINSVMRIDCSECNSTGLIFFGNENDFDVETCDCDFGK |
| Ga0208172_10739911 | 3300027231 | Estuarine | MINSVMRIDCSECNSTGLIFFGNENDFDVETCDCDFG |
| Ga0208796_11011591 | 3300027308 | Estuarine | MRIDCSECNSTGLIFFGNENDFDVETCDCDFGKEQDLFFN |
| Ga0208923_10191192 | 3300027320 | Estuarine | MINSVMTIPCEECHSTGLIFFGDNDNFDVETCVCDFGIEQDLNLFNTPEAN |
| Ga0255093_10836871 | 3300027492 | Freshwater | PCEECHSTGLIFFGNDEDFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0208897_11739073 | 3300027571 | Estuarine | SVMINSVLSIPCDECNSTGLIFFGNDYDYDVETCECDFGIEQDLQQFNN |
| Ga0209651_100073321 | 3300027581 | Freshwater Lake | MINSVMSIPCEECHSTGLIFFGDNDNFDVETCECDFGIEQDLNQFNN |
| Ga0209651_10577063 | 3300027581 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGNDEDFDVETCVCDFGIEQDLNLFNTPEAN |
| Ga0208966_100003646 | 3300027586 | Freshwater Lentic | MINSVMTIPCEECHSTGLIFFGEGDTYDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0208966_100074720 | 3300027586 | Freshwater Lentic | MINSVMTIPCEECHATGLIFFGDEDNFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0208966_101238211 | 3300027586 | Freshwater Lentic | MINSVMTIPCEECHSTGLIFFGEGDTYDVETCVCDF |
| Ga0255088_10289685 | 3300027597 | Freshwater | SLMINSVMTIPCEECHSTGLIFFGNDEDFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0208951_100095610 | 3300027621 | Freshwater Lentic | MINSVLTIPCEECNSTGLLFFGNDNDFDVETCECDFSLEQDLNLFNTPESN |
| Ga0208942_11867811 | 3300027627 | Freshwater Lentic | MINSVLTIPCEECNSTGLLFFGNDNDFDVETCECDFSL |
| Ga0208133_10724531 | 3300027631 | Estuarine | MINSVLSIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFN |
| Ga0209356_10626962 | 3300027644 | Freshwater Lake | MINSVLTIPCEECHATGLIFFGDEDNFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0209769_10710912 | 3300027679 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGNDEDFDVETCVCDFGMEQDLNLFNTPESN |
| Ga0209443_13274682 | 3300027707 | Freshwater Lake | MINSVLTIPCEECHATGLIFFGDEDNFDVETCVCDFGMEQDLYLFNTPEA |
| Ga0209617_103611771 | 3300027720 | Freshwater And Sediment | MINSVMTIPCEECHSTGLIFFGNNEDFDVETCVCDFGIEQDLNLFNTPEAN |
| Ga0209355_11979014 | 3300027744 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGEGDTYDVETCVCDFG |
| Ga0209596_1000050126 | 3300027754 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGDNDNFDTETCECDFGIEQDLYFFNNNN |
| Ga0209596_102942010 | 3300027754 | Freshwater Lake | MINSVLEIPCEECHATGLLFFGNANDFDVETCECDFSLEQDLNLFNTPESN |
| Ga0209770_102504622 | 3300027769 | Freshwater Lake | MINSVLTIPCEECNSTGLIFFGNDFDYDVETCSCDFGIAQDNLLDNN |
| Ga0209500_1000072420 | 3300027782 | Freshwater Lake | MINSVLTIPCEECHSTGLIFFGNGNDFDVETCVCDFGMEQDLNLFNTPESN |
| Ga0209107_100674349 | 3300027797 | Freshwater And Sediment | IPCEECNSTGLIFFGNDEDFDVETCVCDFGIEQDLNLFNTPEAN |
| Ga0209107_101829194 | 3300027797 | Freshwater And Sediment | KRKGGSLMINSVLTIPCEECNSTGLIFFGNDEDFDVETCVCDFGIEQDLNLFNTPEAN |
| Ga0209229_1000626010 | 3300027805 | Freshwater And Sediment | MINSVLTIPCDECNSSGLIFFGDGNDYDVETCECDFGIEQDNLLNNN |
| Ga0209229_101691621 | 3300027805 | Freshwater And Sediment | LTIPCDECNSTGLIFFGNDFDYDVETCECDFGKEQDLMLFNN |
| Ga0209550_104342351 | 3300027892 | Freshwater Lake | MINSVMTIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEA |
| Ga0209400_100102134 | 3300027963 | Freshwater Lake | MINSVLSIPCEECHSTGLIFWGNDLDYDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0209298_1000072111 | 3300027973 | Freshwater Lake | MINSVMTFPCDECNSTGLIFWGNDLDYDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0209298_1000221033 | 3300027973 | Freshwater Lake | MINSVLTIPCEECHSTGLIFFGNDNDFDVETCECDFGIEQDLNQFNN |
| Ga0209299_1000011101 | 3300027974 | Freshwater Lake | MINSVMSIPCEECHSTGLIFFGDNDNFDVETCVCDFGMEQDLNLFNTPEVN |
| Ga0209299_11774531 | 3300027974 | Freshwater Lake | CEECHSTGLLFFGNDNDFDVETCECDFGTEQDLQQFNN |
| Ga0315907_110674342 | 3300031758 | Freshwater | MINSVLTIPCEECHSTGLIFFGNDEDFDVETCVCDFGIEQDLN |
| Ga0315909_100331245 | 3300031857 | Freshwater | MINSVLTIPCEECHSTGLIFFGNDEDFDVETCVCDFGIEQDLNLFNTPEAN |
| Ga0315904_114572112 | 3300031951 | Freshwater | MINSVLTIPCEECHSTGLIFFGNDEDFDVETCECDFGIEQDLNLF |
| Ga0315903_1010830211 | 3300032116 | Freshwater | MINSVLTIPCEECHSTGLIFFGNDEDFDVETCVCDFGIEQD |
| Ga0334992_0017139_1693_1848 | 3300033992 | Freshwater | MINSVMTIPCEECHSTGLIFFGDNDTFDTETCVCDFGMEQDLNLFNTPESN |
| Ga0334992_0078883_1223_1378 | 3300033992 | Freshwater | MINSVLSIPCEECHATGLIFFGDEDNFDVESCVCDFGMEQDLNLFNTPESN |
| Ga0334991_0019759_3575_3730 | 3300034013 | Freshwater | MINSVLTIPCEECNSTGLIFFGNDEDFDVETCVCDFGMEQDLNLFNTPEAN |
| Ga0335005_0345108_2_115 | 3300034022 | Freshwater | MINSVLTIPCEECNSSGLIFFGNDYDYDVETCECDFGI |
| Ga0335021_0353711_646_774 | 3300034023 | Freshwater | CEECHSTGLIFFGEGDTYDVETCVCDFGMEQDLNLFNTPESN |
| Ga0335019_0013185_1383_1520 | 3300034066 | Freshwater | MINSVMRVDCSECNSTGLIFFGDNHNFDVETCDCDFGKEQDLFFN |
| Ga0335029_0115516_1758_1874 | 3300034102 | Freshwater | MINSVLSIPCDECNSTGLIFFGNDYDYDVETCECDFGIE |
| Ga0335048_0083114_1841_1963 | 3300034356 | Freshwater | ECHSTGLIFFGDNDTFDTETCVCDFGMEQDLNLFNTPESN |
| ⦗Top⦘ |