| Basic Information | |
|---|---|
| Family ID | F026461 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 197 |
| Average Sequence Length | 40 residues |
| Representative Sequence | TILYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIQPK |
| Number of Associated Samples | 106 |
| Number of Associated Scaffolds | 197 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 94.92 % |
| % of genes from short scaffolds (< 2000 bps) | 90.86 % |
| Associated GOLD sequencing projects | 106 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (79.695 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (48.223 % of family members) |
| Environment Ontology (ENVO) | Unclassified (99.492 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (79.695 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 197 Family Scaffolds |
|---|---|---|
| PF08263 | LRRNT_2 | 0.51 |
| PF06058 | DCP1 | 0.51 |
| PF01094 | ANF_receptor | 0.51 |
| PF01157 | Ribosomal_L21e | 0.51 |
| PF00179 | UQ_con | 0.51 |
| PF01546 | Peptidase_M20 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 197 Family Scaffolds |
|---|---|---|---|
| COG0683 | ABC-type branched-chain amino acid transport system, periplasmic component | Amino acid transport and metabolism [E] | 0.51 |
| COG2139 | Ribosomal protein L21E | Translation, ribosomal structure and biogenesis [J] | 0.51 |
| COG5078 | Ubiquitin-protein ligase | Posttranslational modification, protein turnover, chaperones [O] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 79.70 % |
| All Organisms | root | All Organisms | 20.30 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300009981|Ga0105133_122876 | Not Available | 563 | Open in IMG/M |
| 3300013296|Ga0157374_12295954 | Not Available | 567 | Open in IMG/M |
| 3300014486|Ga0182004_10014027 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae | 6309 | Open in IMG/M |
| 3300014486|Ga0182004_10016228 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 5772 | Open in IMG/M |
| 3300014486|Ga0182004_10051868 | Not Available | 2375 | Open in IMG/M |
| 3300014486|Ga0182004_10179439 | Not Available | 751 | Open in IMG/M |
| 3300015269|Ga0182113_1048071 | Not Available | 624 | Open in IMG/M |
| 3300015280|Ga0182100_1028892 | Not Available | 759 | Open in IMG/M |
| 3300015282|Ga0182124_1022226 | Not Available | 726 | Open in IMG/M |
| 3300015282|Ga0182124_1058887 | Not Available | 556 | Open in IMG/M |
| 3300015286|Ga0182176_1053152 | Not Available | 586 | Open in IMG/M |
| 3300015287|Ga0182171_1024083 | Not Available | 729 | Open in IMG/M |
| 3300015287|Ga0182171_1044503 | Not Available | 616 | Open in IMG/M |
| 3300015293|Ga0182103_1059557 | Not Available | 606 | Open in IMG/M |
| 3300015294|Ga0182126_1018045 | Not Available | 813 | Open in IMG/M |
| 3300015295|Ga0182175_1020922 | Not Available | 788 | Open in IMG/M |
| 3300015295|Ga0182175_1037394 | Not Available | 671 | Open in IMG/M |
| 3300015295|Ga0182175_1039369 | Not Available | 661 | Open in IMG/M |
| 3300015298|Ga0182106_1045753 | Not Available | 643 | Open in IMG/M |
| 3300015299|Ga0182107_1054914 | Not Available | 613 | Open in IMG/M |
| 3300015300|Ga0182108_1019533 | Not Available | 830 | Open in IMG/M |
| 3300015300|Ga0182108_1025098 | Not Available | 772 | Open in IMG/M |
| 3300015300|Ga0182108_1026803 | Not Available | 758 | Open in IMG/M |
| 3300015304|Ga0182112_1057911 | Not Available | 604 | Open in IMG/M |
| 3300015307|Ga0182144_1032526 | Not Available | 721 | Open in IMG/M |
| 3300015307|Ga0182144_1039107 | Not Available | 683 | Open in IMG/M |
| 3300015308|Ga0182142_1114265 | Not Available | 504 | Open in IMG/M |
| 3300015311|Ga0182182_1061738 | Not Available | 643 | Open in IMG/M |
| 3300015311|Ga0182182_1092320 | Not Available | 558 | Open in IMG/M |
| 3300015312|Ga0182168_1014997 | Not Available | 1071 | Open in IMG/M |
| 3300015312|Ga0182168_1029146 | Not Available | 876 | Open in IMG/M |
| 3300015313|Ga0182164_1018264 | Not Available | 1011 | Open in IMG/M |
| 3300015314|Ga0182140_1073425 | Not Available | 581 | Open in IMG/M |
| 3300015317|Ga0182136_1093001 | Not Available | 592 | Open in IMG/M |
| 3300015320|Ga0182165_1027964 | Not Available | 921 | Open in IMG/M |
| 3300015320|Ga0182165_1088249 | Not Available | 617 | Open in IMG/M |
| 3300015321|Ga0182127_1051938 | Not Available | 662 | Open in IMG/M |
| 3300015321|Ga0182127_1075492 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 591 | Open in IMG/M |
| 3300015321|Ga0182127_1097181 | Not Available | 545 | Open in IMG/M |
| 3300015322|Ga0182110_1114647 | Not Available | 516 | Open in IMG/M |
| 3300015323|Ga0182129_1032736 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 733 | Open in IMG/M |
| 3300015323|Ga0182129_1040184 | Not Available | 691 | Open in IMG/M |
| 3300015323|Ga0182129_1054779 | Not Available | 631 | Open in IMG/M |
| 3300015324|Ga0182134_1104769 | Not Available | 577 | Open in IMG/M |
| 3300015327|Ga0182114_1118297 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 574 | Open in IMG/M |
| 3300015328|Ga0182153_1126735 | Not Available | 542 | Open in IMG/M |
| 3300015329|Ga0182135_1011214 | Not Available | 1227 | Open in IMG/M |
| 3300015329|Ga0182135_1071228 | Not Available | 680 | Open in IMG/M |
| 3300015330|Ga0182152_1021721 | Not Available | 1015 | Open in IMG/M |
| 3300015331|Ga0182131_1110127 | Not Available | 580 | Open in IMG/M |
| 3300015331|Ga0182131_1124415 | Not Available | 552 | Open in IMG/M |
| 3300015331|Ga0182131_1151745 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 508 | Open in IMG/M |
| 3300015335|Ga0182116_1094161 | Not Available | 664 | Open in IMG/M |
| 3300015335|Ga0182116_1166618 | Not Available | 520 | Open in IMG/M |
| 3300015337|Ga0182151_1102804 | Not Available | 612 | Open in IMG/M |
| 3300015339|Ga0182149_1031745 | Not Available | 960 | Open in IMG/M |
| 3300015341|Ga0182187_1120113 | Not Available | 606 | Open in IMG/M |
| 3300015342|Ga0182109_1097616 | Not Available | 686 | Open in IMG/M |
| 3300015342|Ga0182109_1168520 | Not Available | 560 | Open in IMG/M |
| 3300015343|Ga0182155_1105537 | Not Available | 664 | Open in IMG/M |
| 3300015343|Ga0182155_1174692 | Not Available | 553 | Open in IMG/M |
| 3300015343|Ga0182155_1210545 | Not Available | 515 | Open in IMG/M |
| 3300015345|Ga0182111_1028599 | All Organisms → Viruses → Predicted Viral | 1102 | Open in IMG/M |
| 3300015345|Ga0182111_1055243 | Not Available | 877 | Open in IMG/M |
| 3300015345|Ga0182111_1063038 | Not Available | 837 | Open in IMG/M |
| 3300015346|Ga0182139_1056879 | Not Available | 870 | Open in IMG/M |
| 3300015346|Ga0182139_1068637 | Not Available | 814 | Open in IMG/M |
| 3300015346|Ga0182139_1096010 | Not Available | 720 | Open in IMG/M |
| 3300015346|Ga0182139_1103606 | Not Available | 699 | Open in IMG/M |
| 3300015346|Ga0182139_1124433 | Not Available | 654 | Open in IMG/M |
| 3300015347|Ga0182177_1096745 | Not Available | 720 | Open in IMG/M |
| 3300015347|Ga0182177_1234202 | Not Available | 514 | Open in IMG/M |
| 3300015347|Ga0182177_1250787 | Not Available | 500 | Open in IMG/M |
| 3300015348|Ga0182115_1008362 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 2190 | Open in IMG/M |
| 3300015349|Ga0182185_1033924 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 1263 | Open in IMG/M |
| 3300015349|Ga0182185_1125499 | Not Available | 752 | Open in IMG/M |
| 3300015349|Ga0182185_1253973 | Not Available | 536 | Open in IMG/M |
| 3300015349|Ga0182185_1257048 | Not Available | 532 | Open in IMG/M |
| 3300015350|Ga0182163_1132785 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 769 | Open in IMG/M |
| 3300015350|Ga0182163_1146353 | Not Available | 733 | Open in IMG/M |
| 3300015350|Ga0182163_1151230 | Not Available | 721 | Open in IMG/M |
| 3300015350|Ga0182163_1244918 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 562 | Open in IMG/M |
| 3300015351|Ga0182161_1020087 | Not Available | 1311 | Open in IMG/M |
| 3300015351|Ga0182161_1046431 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa | 985 | Open in IMG/M |
| 3300015351|Ga0182161_1054496 | Not Available | 930 | Open in IMG/M |
| 3300015351|Ga0182161_1081998 | Not Available | 799 | Open in IMG/M |
| 3300015351|Ga0182161_1108278 | Not Available | 718 | Open in IMG/M |
| 3300015352|Ga0182169_1192455 | Not Available | 667 | Open in IMG/M |
| 3300015353|Ga0182179_1096538 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 879 | Open in IMG/M |
| 3300015353|Ga0182179_1240334 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 583 | Open in IMG/M |
| 3300015354|Ga0182167_1062608 | Not Available | 1306 | Open in IMG/M |
| 3300015354|Ga0182167_1130645 | Not Available | 926 | Open in IMG/M |
| 3300015354|Ga0182167_1236706 | Not Available | 661 | Open in IMG/M |
| 3300015354|Ga0182167_1254051 | Not Available | 633 | Open in IMG/M |
| 3300015354|Ga0182167_1255665 | Not Available | 631 | Open in IMG/M |
| 3300015354|Ga0182167_1294079 | Not Available | 578 | Open in IMG/M |
| 3300015354|Ga0182167_1324808 | Not Available | 542 | Open in IMG/M |
| 3300015354|Ga0182167_1350192 | Not Available | 516 | Open in IMG/M |
| 3300015355|Ga0182159_1007220 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 2115 | Open in IMG/M |
| 3300015355|Ga0182159_1043909 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 1179 | Open in IMG/M |
| 3300015355|Ga0182159_1044881 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales | 1170 | Open in IMG/M |
| 3300015355|Ga0182159_1053910 | Not Available | 1093 | Open in IMG/M |
| 3300015355|Ga0182159_1161493 | Not Available | 704 | Open in IMG/M |
| 3300015355|Ga0182159_1178845 | Not Available | 674 | Open in IMG/M |
| 3300015355|Ga0182159_1189654 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 658 | Open in IMG/M |
| 3300015355|Ga0182159_1219103 | Not Available | 618 | Open in IMG/M |
| 3300015355|Ga0182159_1254881 | Not Available | 579 | Open in IMG/M |
| 3300015355|Ga0182159_1265964 | Not Available | 568 | Open in IMG/M |
| 3300015361|Ga0182145_1056239 | Not Available | 760 | Open in IMG/M |
| 3300015361|Ga0182145_1114027 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 602 | Open in IMG/M |
| 3300017404|Ga0182203_1081580 | Not Available | 631 | Open in IMG/M |
| 3300017404|Ga0182203_1132454 | Not Available | 540 | Open in IMG/M |
| 3300017407|Ga0182220_1011249 | Not Available | 926 | Open in IMG/M |
| 3300017407|Ga0182220_1040252 | Not Available | 663 | Open in IMG/M |
| 3300017409|Ga0182204_1073400 | Not Available | 585 | Open in IMG/M |
| 3300017410|Ga0182207_1040211 | Not Available | 816 | Open in IMG/M |
| 3300017410|Ga0182207_1048319 | Not Available | 771 | Open in IMG/M |
| 3300017410|Ga0182207_1085183 | Not Available | 643 | Open in IMG/M |
| 3300017411|Ga0182208_1023628 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 840 | Open in IMG/M |
| 3300017412|Ga0182199_1041115 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 912 | Open in IMG/M |
| 3300017412|Ga0182199_1182947 | Not Available | 526 | Open in IMG/M |
| 3300017413|Ga0182222_1012752 | Not Available | 870 | Open in IMG/M |
| 3300017413|Ga0182222_1075838 | Not Available | 552 | Open in IMG/M |
| 3300017414|Ga0182195_1026558 | Not Available | 1092 | Open in IMG/M |
| 3300017414|Ga0182195_1059935 | Not Available | 832 | Open in IMG/M |
| 3300017414|Ga0182195_1112726 | Not Available | 660 | Open in IMG/M |
| 3300017414|Ga0182195_1129773 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 625 | Open in IMG/M |
| 3300017415|Ga0182202_1118454 | Not Available | 530 | Open in IMG/M |
| 3300017417|Ga0182230_1063703 | Not Available | 655 | Open in IMG/M |
| 3300017425|Ga0182224_1035958 | Not Available | 810 | Open in IMG/M |
| 3300017430|Ga0182192_1084058 | Not Available | 646 | Open in IMG/M |
| 3300017432|Ga0182196_1101493 | Not Available | 585 | Open in IMG/M |
| 3300017433|Ga0182206_1040223 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 776 | Open in IMG/M |
| 3300017436|Ga0182209_1001010 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays | 2165 | Open in IMG/M |
| 3300017436|Ga0182209_1007465 | Not Available | 1293 | Open in IMG/M |
| 3300017438|Ga0182191_1083521 | Not Available | 655 | Open in IMG/M |
| 3300017438|Ga0182191_1138581 | Not Available | 553 | Open in IMG/M |
| 3300017440|Ga0182214_1151076 | Not Available | 516 | Open in IMG/M |
| 3300017442|Ga0182221_1088585 | Not Available | 617 | Open in IMG/M |
| 3300017443|Ga0182193_1071412 | Not Available | 711 | Open in IMG/M |
| 3300017443|Ga0182193_1101813 | Not Available | 632 | Open in IMG/M |
| 3300017443|Ga0182193_1154988 | Not Available | 547 | Open in IMG/M |
| 3300017445|Ga0182198_1008796 | Not Available | 1469 | Open in IMG/M |
| 3300017445|Ga0182198_1049451 | Not Available | 851 | Open in IMG/M |
| 3300017683|Ga0182218_1021230 | Not Available | 909 | Open in IMG/M |
| 3300017683|Ga0182218_1098066 | Not Available | 579 | Open in IMG/M |
| 3300017684|Ga0182225_1033792 | Not Available | 789 | Open in IMG/M |
| 3300017686|Ga0182205_1074379 | Not Available | 666 | Open in IMG/M |
| 3300017686|Ga0182205_1080801 | Not Available | 648 | Open in IMG/M |
| 3300017693|Ga0182216_1042604 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae | 947 | Open in IMG/M |
| 3300028049|Ga0268322_1024721 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 665 | Open in IMG/M |
| 3300028056|Ga0268330_1000839 | Not Available | 1968 | Open in IMG/M |
| 3300028056|Ga0268330_1023515 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 711 | Open in IMG/M |
| 3300028476|Ga0268329_1003426 | Not Available | 918 | Open in IMG/M |
| 3300032466|Ga0214503_1280237 | Not Available | 514 | Open in IMG/M |
| 3300032467|Ga0214488_1048104 | Not Available | 941 | Open in IMG/M |
| 3300032467|Ga0214488_1083486 | Not Available | 702 | Open in IMG/M |
| 3300032468|Ga0214482_1048819 | Not Available | 818 | Open in IMG/M |
| 3300032469|Ga0214491_1116425 | Not Available | 637 | Open in IMG/M |
| 3300032490|Ga0214495_1080264 | Not Available | 758 | Open in IMG/M |
| 3300032502|Ga0214490_1041429 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 1030 | Open in IMG/M |
| 3300032551|Ga0321339_1081259 | Not Available | 745 | Open in IMG/M |
| 3300032591|Ga0214484_1028525 | Not Available | 1141 | Open in IMG/M |
| 3300032591|Ga0214484_1097845 | Not Available | 605 | Open in IMG/M |
| 3300032593|Ga0321338_1381580 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 503 | Open in IMG/M |
| 3300032625|Ga0214501_1094979 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 949 | Open in IMG/M |
| 3300032689|Ga0214497_1041323 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 1013 | Open in IMG/M |
| 3300032689|Ga0214497_1080008 | Not Available | 720 | Open in IMG/M |
| 3300032697|Ga0214499_1269711 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 524 | Open in IMG/M |
| 3300032698|Ga0214485_1015889 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae | 1321 | Open in IMG/M |
| 3300032699|Ga0214494_1004626 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 2005 | Open in IMG/M |
| 3300032757|Ga0314753_1042880 | Not Available | 822 | Open in IMG/M |
| 3300032761|Ga0314733_1002199 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 2427 | Open in IMG/M |
| 3300032761|Ga0314733_1004774 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica | 1942 | Open in IMG/M |
| 3300032761|Ga0314733_1083586 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 605 | Open in IMG/M |
| 3300032789|Ga0314725_1004579 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii | 1522 | Open in IMG/M |
| 3300032789|Ga0314725_1023669 | Not Available | 750 | Open in IMG/M |
| 3300032792|Ga0314744_1094482 | Not Available | 567 | Open in IMG/M |
| 3300032824|Ga0314735_1103090 | Not Available | 526 | Open in IMG/M |
| 3300032844|Ga0314743_1044318 | Not Available | 1037 | Open in IMG/M |
| 3300032875|Ga0314737_1034418 | Not Available | 878 | Open in IMG/M |
| 3300032915|Ga0314749_1078610 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 711 | Open in IMG/M |
| 3300032976|Ga0314752_1051103 | All Organisms → cellular organisms → Eukaryota → Viridiplantae | 793 | Open in IMG/M |
| 3300033525|Ga0314758_1223609 | Not Available | 507 | Open in IMG/M |
| 3300033526|Ga0314761_1082046 | Not Available | 716 | Open in IMG/M |
| 3300033535|Ga0314759_1067903 | Not Available | 1089 | Open in IMG/M |
| 3300033540|Ga0314764_1020962 | Not Available | 1051 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 48.22% |
| Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 45.69% |
| Root | Host-Associated → Plants → Roots → Unclassified → Unclassified → Root | 3.05% |
| Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 2.03% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300009981 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014486 | Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015269 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015282 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015286 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015287 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015294 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015295 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015298 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015299 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015300 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015304 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015307 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015308 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015312 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015314 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015321 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015322 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015323 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015327 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015328 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015331 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015341 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015342 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015343 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015345 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015346 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015347 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015351 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015355 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300015361 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017404 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017407 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017409 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017410 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017411 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017413 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017415 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017417 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017425 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017430 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017432 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017433 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017436 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017438 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017440 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017442 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017443 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017445 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017683 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017684 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017686 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
| 3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028056 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300028476 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1 | Host-Associated | Open in IMG/M |
| 3300032466 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032467 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032468 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032469 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032490 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032502 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032551 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032591 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032593 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032625 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032689 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032697 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032698 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032699 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032757 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032761 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032789 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032792 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032824 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032844 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032875 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032915 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300032976 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033525 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033526 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| 3300033540 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| Ga0105133_1228761 | 3300009981 | Switchgrass Associated | YILLYIHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIKSK* |
| Ga0157374_122959541 | 3300013296 | Miscanthus Rhizosphere | TILYIHCVDLLMWSPIKLDFPFYGFSVIYYDFSKIQPK* |
| Ga0182004_100140271 | 3300014486 | Root | QKRFILKYTILYIHCVDLLMWSLTKLDFLFYDFSVIYYDFSKII* |
| Ga0182004_100162286 | 3300014486 | Root | KFVLKCTILYVHYVDLLIWSPTKSDLIFYEFYVIYYNFTNI* |
| Ga0182004_100518682 | 3300014486 | Root | SYNKNFVLKCTILYVHYVDLLIWSPIKSDLLFYKFYVIYYNFINIQPK* |
| Ga0182004_100814851 | 3300014486 | Root | VHYVDLLIWSPIKSDLLFYKFYVIYYNFTNIQPK* |
| Ga0182004_101794392 | 3300014486 | Root | IILYIHYVDLLIRSPTKLNFIFYDFSMIYYDFSKIQRK* |
| Ga0182004_101935071 | 3300014486 | Root | ILYVHYVDLLIWSPTQLELLFYEFYVIYSNFTNIQPK* |
| Ga0182113_10480711 | 3300015269 | Miscanthus Phyllosphere | KYTILYVHCVDLLMWSPTKLDFSFYDFSMIYYDFLKIQPK* |
| Ga0182100_10288921 | 3300015280 | Switchgrass Phyllosphere | MIFFIAVKNVLKHTILYVYYVNLLIWSLTQLNFLFYDFSAIYYDFSK |
| Ga0182124_10222261 | 3300015282 | Miscanthus Phyllosphere | KHIILYMHCVDLLMWSPIKLNFLFYDFSVIYYDFSKIQPK* |
| Ga0182124_10588871 | 3300015282 | Miscanthus Phyllosphere | TILYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIQPK* |
| Ga0182176_10531521 | 3300015286 | Miscanthus Phyllosphere | VHCVDLLMWSPTKLDFSFYDFSVIYYDFSKIQRK* |
| Ga0182171_10240832 | 3300015287 | Miscanthus Phyllosphere | LKYTILYMQCVDLLIWSSTKLDFLFYDISVIYYDFSNIQPK* |
| Ga0182171_10445031 | 3300015287 | Miscanthus Phyllosphere | LYIHYVDLLMWSPIKLDFSFYDFSMIYYDFSKIQRK* |
| Ga0182103_10595571 | 3300015293 | Switchgrass Phyllosphere | TKNILKHTILYIYCVDLFIWSLTKLDFLIYDFFVIYYDFSKIELK* |
| Ga0182126_10180452 | 3300015294 | Miscanthus Phyllosphere | VYCVDLLMWSPTKLDIRVYDFSVIYYDFSNIQPK* |
| Ga0182175_10209221 | 3300015295 | Miscanthus Phyllosphere | LKHTILYVHCVDLLMWSPTKLDFSFLDFSMIYYDFSKIQLK* |
| Ga0182175_10373941 | 3300015295 | Miscanthus Phyllosphere | SQNFVLKHTILYVQCVDLPMWSPTKLDFLFYDFSMIYYDFSKI* |
| Ga0182175_10393691 | 3300015295 | Miscanthus Phyllosphere | HTILYINCVDLLMWSLTKLDFPFYDFSVIYYDFLKIRSK* |
| Ga0182106_10457531 | 3300015298 | Miscanthus Phyllosphere | LKHTILYVQCVDLLMWSPTKLDFLFYDFSVIYYNFSKIQQK* |
| Ga0182107_10549142 | 3300015299 | Miscanthus Phyllosphere | KHTILYVHRVDLLMWSPTKLDFLFYIFFVIYYDFSKIQLK* |
| Ga0182108_10195332 | 3300015300 | Miscanthus Phyllosphere | TILYVHCVDLLMWSPTKLDFSSYDFSVIYYDFSKIQPK* |
| Ga0182108_10250981 | 3300015300 | Miscanthus Phyllosphere | NSILYVHCLDLLMWSPTKLDFLFYDFSVIYYDFSKIQPK* |
| Ga0182108_10268031 | 3300015300 | Miscanthus Phyllosphere | KNFVLKHTILYVHCVDILTWIPTKLDFPFYDFSVIYYDFAKIQPK* |
| Ga0182112_10579111 | 3300015304 | Miscanthus Phyllosphere | HTILYVHCVDLLMWSPTKLDFLFYDFSMIYYDFSKIQPK* |
| Ga0182144_10325261 | 3300015307 | Miscanthus Phyllosphere | ILYVHCVDLLMWNPTKLDFLFYDFSVIYYDFSKIHPK* |
| Ga0182144_10391071 | 3300015307 | Miscanthus Phyllosphere | TVLYIHCVDLLMWSPTKLEFSFYDFSMIYYDFSKIHRK* |
| Ga0182142_11142651 | 3300015308 | Miscanthus Phyllosphere | ILYVHCVDLLMWSPTKLDFLFYDFPVIYYDFLKIQPK* |
| Ga0182182_10617381 | 3300015311 | Switchgrass Phyllosphere | VKNVLKHTILYVHCVDLLIWSPTQLDYSFYDFSVIYYDFSKLL* |
| Ga0182182_10923201 | 3300015311 | Switchgrass Phyllosphere | VHCIDLLMWSQTKLDFSFYDFSVIYYDFSKIQPK* |
| Ga0182168_10149971 | 3300015312 | Switchgrass Phyllosphere | LKYILLYVHCVDLLMWSPTKLDFLFYDFSMIYYDFSKIKSK* |
| Ga0182168_10291461 | 3300015312 | Switchgrass Phyllosphere | TILYVHCVDLLIWSLTQLDFPFYDFSVIYYDFSKLL* |
| Ga0182164_10182641 | 3300015313 | Switchgrass Phyllosphere | LLYIHCVDLLMWSPTKLDFLFFDFSVIYYDFSKIKSK* |
| Ga0182140_10734251 | 3300015314 | Miscanthus Phyllosphere | LKHTILYVHCVNVLMWSPTKLDFLFCDFSVIYYDFFMI* |
| Ga0182136_10930011 | 3300015317 | Switchgrass Phyllosphere | KHNILYVHSVDPLMWSPTNLDFPFYDFSVIYYDFLKIQPK* |
| Ga0182165_10279641 | 3300015320 | Switchgrass Phyllosphere | FFKILLKYTILYVHCVVLLIWSPTKLDFPIYDFSMIYYNFFMIQSK* |
| Ga0182165_10882491 | 3300015320 | Switchgrass Phyllosphere | IVLKHTILYVHCVDLLIWSLTQFDFLFYDFSVIYYDFSKLI* |
| Ga0182127_10519381 | 3300015321 | Miscanthus Phyllosphere | VHGIDLLVWSPTQLYFPFYNFFVIYYDVSKILTK* |
| Ga0182127_10754921 | 3300015321 | Miscanthus Phyllosphere | FVLKHTVLYIHYVDLLMWSPIKLDFSIIYYDFSKIHRK* |
| Ga0182127_10971811 | 3300015321 | Miscanthus Phyllosphere | VHCVNLLMWSPTKLDFLFYDFFVIYYVFSKIQSK* |
| Ga0182110_11146472 | 3300015322 | Miscanthus Phyllosphere | HTILYVHYVYLLMWSPTKLDFTFYDFSMIYYDFSKI* |
| Ga0182129_10327362 | 3300015323 | Miscanthus Phyllosphere | VHYVDLLMWSSTKLDYPFYDFSVIYNDFSKIQPK* |
| Ga0182129_10401841 | 3300015323 | Miscanthus Phyllosphere | KHTILYIHYVDLLMWSQRKLDFLFYNFAMFYYDFSKI* |
| Ga0182129_10547791 | 3300015323 | Miscanthus Phyllosphere | HTVLYIHYVDLLMWSPTKLDFLFYDFSVIYYDFSKIQ*K* |
| Ga0182134_11047691 | 3300015324 | Switchgrass Phyllosphere | KIVLKHTILYVHCVGRLIWSLTQLDFLFYDFSVIYYDFSKLF* |
| Ga0182114_11182971 | 3300015327 | Switchgrass Phyllosphere | KHISTATVKNILKHTILYVHYVDLLIWSLTQLDFLFYDFSVIYYDFLKLL* |
| Ga0182153_11267351 | 3300015328 | Switchgrass Phyllosphere | TILYVHCVDLLIWSLTQLDFLFYDFSVIYYDFSKLL* |
| Ga0182135_10112141 | 3300015329 | Switchgrass Phyllosphere | ILYTHCVDMRMWSLTELDFLFYKFSVIYYDFLKIQPNK* |
| Ga0182135_10712282 | 3300015329 | Switchgrass Phyllosphere | HTILYVHCVDLLIWSLTQLDFPFYDFFVIYYDFSKLI* |
| Ga0182152_10217211 | 3300015330 | Switchgrass Phyllosphere | LYVQYVDLLMWSLKKLNFLFYDFSIIYNDFSKIQLDFF* |
| Ga0182131_11101272 | 3300015331 | Switchgrass Phyllosphere | VLKHTILYIYCVDLLIWILIQLDFPFYDFSVIYYDFLKLL* |
| Ga0182131_11244151 | 3300015331 | Switchgrass Phyllosphere | LKHTILYVYCVVLLIWSLTKLEFLFYDFSVIYYDFSKLF* |
| Ga0182131_11517451 | 3300015331 | Switchgrass Phyllosphere | NIPKHTILYVHCVDLLIRSPAQLDFSFYDFSVIYYDFSKLFLGVI* |
| Ga0182132_10784932 | 3300015334 | Switchgrass Phyllosphere | VKNVLKHTILYVHCVDLLIWSPTELDFLFYDFFVILL* |
| Ga0182116_10941611 | 3300015335 | Switchgrass Phyllosphere | QNYTILYAHCVDLLMWSPTKVDFSFYDFSVIYYDFLKLLYGVI* |
| Ga0182116_11666181 | 3300015335 | Switchgrass Phyllosphere | KHNILYVHSVDLLIWSPTQLNFLFYDFFVIYYDFLKLL* |
| Ga0182151_11028041 | 3300015337 | Switchgrass Phyllosphere | NYTILYAHCVDLLMWSPTKLDFPFYDFSVIYYDFSKI* |
| Ga0182149_10317451 | 3300015339 | Switchgrass Phyllosphere | TILYIYSVDLLIWSPTQLNFSFYDFFVIYYDFSKLL* |
| Ga0182149_10937821 | 3300015339 | Switchgrass Phyllosphere | ICSLVDLLMLSPKNLDFSFYDFSISYYDFSKIQSKC* |
| Ga0182133_10229411 | 3300015340 | Switchgrass Phyllosphere | SYSKNFIQKYIILYVYCVDLLMWSPIKLDFLFYDFLVIYCDF* |
| Ga0182187_11201132 | 3300015341 | Miscanthus Phyllosphere | VHCIDLLIWSPTKLDFLFYDFSVIYYDFSNIQRI* |
| Ga0182109_10976161 | 3300015342 | Miscanthus Phyllosphere | KHTVLYIHYVDLLMWSPIKLDFLFYDFSMIYYDFLKIHRK* |
| Ga0182109_11685202 | 3300015342 | Miscanthus Phyllosphere | VNYVDLLMWSPTKLDFPFYDFSMIYYVFSKIQRK* |
| Ga0182155_10415512 | 3300015343 | Miscanthus Phyllosphere | FVLKHTVLYIHCVDLLMWSPIKLDFLFYDFSMIYCDF* |
| Ga0182155_11055371 | 3300015343 | Miscanthus Phyllosphere | YTILYVHYVDLLMWSPTKLNFPFYDFSVIYYGFSKI* |
| Ga0182155_11746921 | 3300015343 | Miscanthus Phyllosphere | VHCVDLLMWSPTKLDFLFYDFPVIYYDFLKIQPK* |
| Ga0182155_12105451 | 3300015343 | Miscanthus Phyllosphere | NFVLKHIILYVHYIDLLIWSLAKLDFLFYDFSVIYYNFSKIQPK* |
| Ga0182111_10285991 | 3300015345 | Miscanthus Phyllosphere | LCTKAYLLYVHCVDLIMWSPTKLDFLLNDFSVIYYNFSKIQRK* |
| Ga0182111_10552431 | 3300015345 | Miscanthus Phyllosphere | SKNFILKYTILYVHCVDVFMWSPTKLKFPFYDFYVIYYDFSKI* |
| Ga0182111_10630381 | 3300015345 | Miscanthus Phyllosphere | VHCVDLLMWSPTKLDFTFYDFSVIYYDFSKIQRK* |
| Ga0182139_10568791 | 3300015346 | Miscanthus Phyllosphere | QQNFVLKHTILYVYCVDLLMWSPTKLDFLFYDFYMIYYDFSKI* |
| Ga0182139_10686372 | 3300015346 | Miscanthus Phyllosphere | TILYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIQSK* |
| Ga0182139_10960102 | 3300015346 | Miscanthus Phyllosphere | HTVLYIHYVDLLMWSPTKLDFLFYDFSMIYCDFLKIYRK* |
| Ga0182139_11036061 | 3300015346 | Miscanthus Phyllosphere | VHYVDLLMWSPTKLDFLFYDFSVIYYDFSKIQRK* |
| Ga0182139_11244331 | 3300015346 | Miscanthus Phyllosphere | LYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIQRK* |
| Ga0182177_10967451 | 3300015347 | Miscanthus Phyllosphere | HTILYVHCVDLLMWSPIKLDFPFYDFFVIYYDFLKIQPK* |
| Ga0182177_12342021 | 3300015347 | Miscanthus Phyllosphere | ILYVHCVDLLMWSPTKLDFPFYDFSVIYYDFSKIKRK* |
| Ga0182177_12507871 | 3300015347 | Miscanthus Phyllosphere | VKHTILYIHYVDLVMWSPRKIDFPFYDFVFYYDFSKIQPK* |
| Ga0182115_10083624 | 3300015348 | Switchgrass Phyllosphere | HTILYVHCVDLLIWSLTQLDFIFYDFSVIYYDFLKLLYGVI* |
| Ga0182185_10339241 | 3300015349 | Switchgrass Phyllosphere | KHTILYVHCVDLLIWSLTQLDFLFYDFFVIYYDFSKLL* |
| Ga0182185_11254991 | 3300015349 | Switchgrass Phyllosphere | TILYVHCVDLLIWSLPQLDFLFYDFSVIYYDFSKLL* |
| Ga0182185_12539731 | 3300015349 | Switchgrass Phyllosphere | IILYVYYVDLLIRSPTQFDFPFYEFSVIYYDFSKLL* |
| Ga0182185_12570481 | 3300015349 | Switchgrass Phyllosphere | KHIILYVHCVDLLIWSPIQLDFLFYDFSVIYYDFLKLL* |
| Ga0182163_11327851 | 3300015350 | Switchgrass Phyllosphere | LKLQQKNILKHTILYIHCVDLLIWSLTQLDVSFYDFSVIYYDFLKLL* |
| Ga0182163_11463531 | 3300015350 | Switchgrass Phyllosphere | IKNFVQNYTILYAHCVDLLMWSPTKLDFSFYDFSVVYYDFSKI* |
| Ga0182163_11512301 | 3300015350 | Switchgrass Phyllosphere | NILKHTILYVHCVDLLIWSLTQLDFLFYNFSVIYYDFSKLI* |
| Ga0182163_12449182 | 3300015350 | Switchgrass Phyllosphere | MHTILYVHCVYLLIWSLTQLNFLFYNFFVIYYNFSKLL |
| Ga0182161_10200871 | 3300015351 | Miscanthus Phyllosphere | KHTILYINCVDILTWSPTKFDFPFYDVSMIYYDFSKI* |
| Ga0182161_10464311 | 3300015351 | Miscanthus Phyllosphere | KNFVIKHTILYVYCGDLLIWSPAKLDFSFYDFSMIYYNFSNI* |
| Ga0182161_10544961 | 3300015351 | Miscanthus Phyllosphere | KNFVLKHTILYVHCVDLLMWSPTKLDFLFYDFFMIYYDFSKI* |
| Ga0182161_10819981 | 3300015351 | Miscanthus Phyllosphere | KHTILYIHCGDLLMWSATKLNFLFYDFSVIYYDFSKIQPK* |
| Ga0182161_11082782 | 3300015351 | Miscanthus Phyllosphere | VLKHTILYVHCVDLLMWSPTKLNLLFYDFSVIYYDFLKIQQK* |
| Ga0182169_11924551 | 3300015352 | Switchgrass Phyllosphere | HCVDLLIWSPTQLDFSFYDFSLIYYDFSKLLYGII* |
| Ga0182179_10965381 | 3300015353 | Switchgrass Phyllosphere | TILCVHCVDLLILSPTQLDFSFYDFSVIYYDFSKLL* |
| Ga0182179_12403341 | 3300015353 | Switchgrass Phyllosphere | HTILYIHCVDLLIWSLTQLNFLFYDFFVIYYDFLKLLYEIIDRF* |
| Ga0182167_10626082 | 3300015354 | Switchgrass Phyllosphere | LQQKNILKHTILYVHCVDLLILSLTQLDFSFYDFSVIY* |
| Ga0182167_11306451 | 3300015354 | Switchgrass Phyllosphere | KHIILYIQCVDLLIWSLTQLDFLFYDFSVIYYIFQNCFRR* |
| Ga0182167_12367061 | 3300015354 | Switchgrass Phyllosphere | HTILYIHCVDLLIWSLTQLNFIFYDFSVIYYDFLKLF* |
| Ga0182167_12540511 | 3300015354 | Switchgrass Phyllosphere | HTILYVHCLDLLIWSLTQLNFLFYDFSVIHYDFLKLI* |
| Ga0182167_12556651 | 3300015354 | Switchgrass Phyllosphere | SNNFVLKHTILYLHCVDLLMWSPTKLGFPFYDFFVIYYDFSKFSGNK* |
| Ga0182167_12940791 | 3300015354 | Switchgrass Phyllosphere | LKHIILYIQCVDLLMWSLTKLKFSFYDFSMIYNNFSKIQ* |
| Ga0182167_13248081 | 3300015354 | Switchgrass Phyllosphere | KIVLKHTILYVHCVDLLIWSLTQFDFLFYDFSVIYYDFSKLI* |
| Ga0182167_13501921 | 3300015354 | Switchgrass Phyllosphere | VLKHTILYVHCVALLIWSPTQLDFSFYDFSVIYYDFLKLI* |
| Ga0182159_10072201 | 3300015355 | Miscanthus Phyllosphere | NFVLKHTILYIHCVDQLMWSPTKLNFLFYDFSVIYYDFTKIQPK* |
| Ga0182159_10439092 | 3300015355 | Miscanthus Phyllosphere | VHCVDLLMWSPTKLNFLFYDVFVIYYDFSKIQPK* |
| Ga0182159_10448811 | 3300015355 | Miscanthus Phyllosphere | IVLKYTILYVHCVDLLIWSPTKLDFLFYDFSVIYYDFSKI* |
| Ga0182159_10539101 | 3300015355 | Miscanthus Phyllosphere | VHCVDLLMWSPTKLDFLFYDFSMIYYDVSKIQQK* |
| Ga0182159_11614932 | 3300015355 | Miscanthus Phyllosphere | KHTILYVQCVDLLMWSPTKLDFLFYDFFVIYHDFSNIQPK* |
| Ga0182159_11788451 | 3300015355 | Miscanthus Phyllosphere | ILYVHCVDLLMWSPTKLDFLFYDFSMIYYDFSKI* |
| Ga0182159_11896542 | 3300015355 | Miscanthus Phyllosphere | FVLKHTILYIHYVDLLMWSPTELDFLFYDFSVIYYDFSKIQPK* |
| Ga0182159_12191032 | 3300015355 | Miscanthus Phyllosphere | ILYIHCVDLLMSSPTKLDFLFYGFSMIYYDFSKI* |
| Ga0182159_12548811 | 3300015355 | Miscanthus Phyllosphere | NHTILYFHCVDLLTWSPINLDFSSYGFYVIYYDFLKIQPK* |
| Ga0182159_12659641 | 3300015355 | Miscanthus Phyllosphere | SKNFVLKHTILYIHCVDLLMWSPTELDFSFYDFSMIYYDFSKIQLK* |
| Ga0182145_10562391 | 3300015361 | Miscanthus Phyllosphere | SKNFVLKHIILYVHCIDLLMWSPKKLNFLFYDFSVIYYDFFKD* |
| Ga0182145_10740292 | 3300015361 | Miscanthus Phyllosphere | LYIHCIGLLTWSSTKLDFSFYDFSVIYYDFSKIQLKKIK* |
| Ga0182145_11140271 | 3300015361 | Miscanthus Phyllosphere | YVHCVDLLMWSPTKLDFPFYDFSVIYYDFSKIQRK* |
| Ga0182203_10815801 | 3300017404 | Miscanthus Phyllosphere | KHTILYIHCIDLLIWSPTKLDFLFYDFSVIYYDSTKIQPK |
| Ga0182203_11324541 | 3300017404 | Miscanthus Phyllosphere | YSKKFVLKHTVLYIHYVDLLMWSPTKLDFLFYDFSMIYCDFLKF |
| Ga0182220_10112491 | 3300017407 | Miscanthus Phyllosphere | TKNFVLKYIILYVHCVDLLMWNPTKLDFLFYDFSVIYYDFSKI |
| Ga0182220_10402521 | 3300017407 | Miscanthus Phyllosphere | KHTILYVHCVDLLMWSPTKLDFPFYDFSVIYYDFSKIQPK |
| Ga0182204_10734002 | 3300017409 | Miscanthus Phyllosphere | VVLKHTILYIHYVDLFMWSPTKLDFPFYDFSVIYYDFSKIQSK |
| Ga0182207_10402111 | 3300017410 | Miscanthus Phyllosphere | LKHTILYVHCVDLLMWSPTKLDLPFYDFSTIYYDFLKIQPK |
| Ga0182207_10483191 | 3300017410 | Miscanthus Phyllosphere | LKYTILYVHYVDLLMWSPTKLDFLFYDFSVIYYDFSKIWPK |
| Ga0182207_10851831 | 3300017410 | Miscanthus Phyllosphere | KHTILYIHYVDLLMWSQRKLDFLFYNFAMIYYDFSKF |
| Ga0182208_10236281 | 3300017411 | Miscanthus Phyllosphere | ILYVHCVDLLMWSPIKLDFLFYDFSVIYYDFSKIQ |
| Ga0182199_10411151 | 3300017412 | Switchgrass Phyllosphere | HTILYVHCIDLLIWSPTQLDFLFYDFSVIYYDFLKLF |
| Ga0182199_11829471 | 3300017412 | Switchgrass Phyllosphere | MLFFIAVKNVLKHIILYVHSVDLLIWSPTQLNFSFYDF |
| Ga0182222_10127521 | 3300017413 | Miscanthus Phyllosphere | KHTILYVHCIDLLMWSPTELDFLFYDFSMIYYDFLKI |
| Ga0182222_10758381 | 3300017413 | Miscanthus Phyllosphere | KNFVLKHTILYVHCVDLLMWSPIKLDFLFYDFSVIYYDFLKIQPK |
| Ga0182195_10265581 | 3300017414 | Switchgrass Phyllosphere | HTILYVHCVALLIWSRTQLDFLFYDFSVIYYDFSKLL |
| Ga0182195_10599351 | 3300017414 | Switchgrass Phyllosphere | SKATAKNILKHTILYFHCVDLLIWSLTQLDFLFYNFFVIYYDFLKLL |
| Ga0182195_11127261 | 3300017414 | Switchgrass Phyllosphere | ILKHIILYVHCVDLLIWSLTQLNFLFYDFSVIYYDFSKLF |
| Ga0182195_11297732 | 3300017414 | Switchgrass Phyllosphere | KYILLYVHCVDLLMWSPTKLDFLFYDFFVIYYDFSKIKSK |
| Ga0182202_11184541 | 3300017415 | Miscanthus Phyllosphere | TILYVHCVDLLMWSPTKLDFPFYDFFVIYYDFSNIQ |
| Ga0182230_10637032 | 3300017417 | Miscanthus Phyllosphere | TILYVHCVDLIMWSPIKLDLPFYVFSVIYYNFLKIQPK |
| Ga0182224_10359581 | 3300017425 | Miscanthus Phyllosphere | KIILKYTILYIHCVDLHTWSLTKLDFLFYNFSVIYYDFSKIQLK |
| Ga0182192_10840581 | 3300017430 | Miscanthus Phyllosphere | YVHCVDLLMWSPTKLDFPFYNFSVIYYDFLKIHQK |
| Ga0182192_10977402 | 3300017430 | Miscanthus Phyllosphere | LLMWSPTKLDFSFYDFSVIYYNFLKIQRKEIKKKKKPRSL |
| Ga0182196_11014931 | 3300017432 | Switchgrass Phyllosphere | KKKLKHTILYVHCVDLLIWSLTQLDFSFYDFSVIYYDFSKLLSRVI |
| Ga0182206_10402231 | 3300017433 | Miscanthus Phyllosphere | TILYVHCVDLLMWSPTKLDFPFYDFSVIYYDFSKIQQK |
| Ga0182209_10010101 | 3300017436 | Miscanthus Phyllosphere | ILYVHCVDLLMWSPIKLDFPFYDFSVIYYDFSKIQRI |
| Ga0182209_10074652 | 3300017436 | Miscanthus Phyllosphere | YIHYVDLLMWSPIKLDFSFYDFSMIYYDFKKIHQK |
| Ga0182191_10110514 | 3300017438 | Miscanthus Phyllosphere | IYLKLQQKNCTKNIILYVHCVDPLMWCPTKLDFLFYDFIVIYYDFSKIQPK |
| Ga0182191_10835211 | 3300017438 | Miscanthus Phyllosphere | VLKHTVLYIHCVDLLMWSPIKLDFLFYDFSMIYYDFLKIHQK |
| Ga0182191_11385811 | 3300017438 | Miscanthus Phyllosphere | YIHYVDLLMWSPTKLDFLFYDFSMIYYDFSKIHRK |
| Ga0182214_11510761 | 3300017440 | Switchgrass Phyllosphere | LLYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSNIKSK |
| Ga0182221_10885851 | 3300017442 | Miscanthus Phyllosphere | LKNTILYVHCVDLLMWSSTKLDFLFYDFSMIYYDFSKIQPK |
| Ga0182193_10714121 | 3300017443 | Miscanthus Phyllosphere | LKHITLYVNYVDLLMWSSTKLDFPFYDFSLIFYDFSKIQRK |
| Ga0182193_11018131 | 3300017443 | Miscanthus Phyllosphere | TTAKKIVLKDIILYVHYVDLVMWSPTKLDFPFYDFFVIYYDFLNIQPK |
| Ga0182193_11549881 | 3300017443 | Miscanthus Phyllosphere | TILYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIQPK |
| Ga0182198_10087961 | 3300017445 | Switchgrass Phyllosphere | KYTILYVHCVDLLTWSPIKLDFLFYDFSVIYYDFSKIQSK |
| Ga0182198_10494511 | 3300017445 | Switchgrass Phyllosphere | MYRSKAITKNILKHTILYVHCVNLVIWSLTQLNFLFYNFSVIY |
| Ga0182218_10212301 | 3300017683 | Miscanthus Phyllosphere | LKHTILYVHCIDLLMWSPTKFDFSFYDFSVIYYDFSKIQPK |
| Ga0182218_10980662 | 3300017683 | Miscanthus Phyllosphere | KHTILYVCCVDLLMWSLEKLDFLFYDFSVIYYDFSNIQRK |
| Ga0182225_10337921 | 3300017684 | Miscanthus Phyllosphere | FILKHAILYVHCVDLLMWSLTKLDFSFYDFSVIYYYFSKI |
| Ga0182205_10345802 | 3300017686 | Miscanthus Phyllosphere | LYVHCVDLLMWSPIQLDFLFSDFSVIYYDFSKIQSK |
| Ga0182205_10743791 | 3300017686 | Miscanthus Phyllosphere | LKLTILYVYCVDLFMWSPTKLDFPFYNFFMIYNVFSKIHSK |
| Ga0182205_10808011 | 3300017686 | Miscanthus Phyllosphere | TILYVHYVDLLMWSLTKLDFLFYNFSVIYYDFSKIQLK |
| Ga0182216_10426041 | 3300017693 | Switchgrass Phyllosphere | DLKVQQKNVLKHTILYVHCVDLLIWSPTQLNFSFYDFSVIYYDFSKLL |
| Ga0268322_10247212 | 3300028049 | Phyllosphere | KKHTILYVHSVDLLIWSLTQLDFPFYDFSVIYYDFLKLL |
| Ga0268330_10008391 | 3300028056 | Phyllosphere | TILYTHCVDMRMWSLTELDFLFYKFSVIYYDFLKIQPNK |
| Ga0268330_10235151 | 3300028056 | Phyllosphere | YIYCVDLLMWSPIKLDFLFYDFSVIYYDFSKIKPK |
| Ga0268329_10034261 | 3300028476 | Phyllosphere | MFFFIAVKNILKHTILYVHSVDLLIWSSTQLNFLFYNFFVIYYDF |
| Ga0214503_12802371 | 3300032466 | Switchgrass Phyllosphere | NVLKHTILYIHCVDLLIWSLTQLDFSFYDFSVIYYNFLKLFYEIIDRF |
| Ga0214488_10481042 | 3300032467 | Switchgrass Phyllosphere | LDLCFFIATKNVLKHTILYVHCIDLLIWSPTQLDFLFYDFSVIYYNFLKLL |
| Ga0214488_10834861 | 3300032467 | Switchgrass Phyllosphere | LDLYVHCVDLLIWSPTQLNFSFYDFSVFNYDFLKLL |
| Ga0214482_10488191 | 3300032468 | Switchgrass Phyllosphere | YSKQNILKHTILYVHCVDLLIWSLTQLDFPFYDFSVIYYDFSKLL |
| Ga0214491_11164251 | 3300032469 | Switchgrass Phyllosphere | NVLKHTILYVHCIDLLIWSPTQLDFLFYDFSVIYYNFLKLL |
| Ga0214495_10802642 | 3300032490 | Switchgrass Phyllosphere | KNFVLKHSILCVHCIDLLMWSPTKLDFLFYDFSVIYYDFSKLV |
| Ga0214490_10414291 | 3300032502 | Switchgrass Phyllosphere | NVLKHTILYIHCVDLLIWSLTQLDFSCYDFSVIYYNFLKLFYEIIDRF |
| Ga0321339_10812592 | 3300032551 | Switchgrass Phyllosphere | LKHTILYVHCVDLLIWSLTQLDFPFYDFSVIYYDFSKLL |
| Ga0214484_10285253 | 3300032591 | Switchgrass Phyllosphere | YVHCVDLLIWSPTQLSFSFYDFFVINYDFLKLLQRAI |
| Ga0214484_10978451 | 3300032591 | Switchgrass Phyllosphere | ILYVHSVDLLIWSSTQLNFLFYNFFVIYYDFSKLF |
| Ga0321338_13815801 | 3300032593 | Switchgrass Phyllosphere | VHCVDLLIWSLTQLDFIFDDFSVIYYDFLKLLYGVI |
| Ga0214501_10949791 | 3300032625 | Switchgrass Phyllosphere | KNVLKHTILYVHCVDLLIWSLTQLDFSFYDFSVIYYNFLKLFYEIIDRF |
| Ga0214497_10413231 | 3300032689 | Switchgrass Phyllosphere | KNVLKHTTLYVHRVDLLIWSPTQLDFSFYDFFVIYYNFSKLL |
| Ga0214497_10800081 | 3300032689 | Switchgrass Phyllosphere | KNILKHTILYVHCVDLLIWSLTQLDFLFYDFSVIYYDFSKLL |
| Ga0214499_12697111 | 3300032697 | Switchgrass Phyllosphere | KIYKKNILKNTILYVHCVVLLMWSPTKFDFPFYDFSMIYYDFSKLL |
| Ga0214485_10158891 | 3300032698 | Switchgrass Phyllosphere | HTILYVHCVDLLIWSLTQLDFPFYDFSVIYYDFSKLL |
| Ga0214494_10046261 | 3300032699 | Switchgrass Phyllosphere | YTLVFFCCSFRSMLFFITVKKVLKHTILYDRCVDLLIWSPTQLNFSFYDFSVIYYDFSKL |
| Ga0314753_10428801 | 3300032757 | Switchgrass Phyllosphere | SYGKKNILKHTILYVNCVDLLIRSLTQLDFLFSDFSVIYYDF |
| Ga0314733_10021994 | 3300032761 | Switchgrass Phyllosphere | KLQQKNILKHIILYVHCVDLLIWSLTQLDFSFYDFSMIYYNFSKLFSGVI |
| Ga0314733_10047741 | 3300032761 | Switchgrass Phyllosphere | IDLKLRQKNILKHTILYVNCVDLLIRSLTQLDFLFSDFSVIYYDF |
| Ga0314733_10835861 | 3300032761 | Switchgrass Phyllosphere | LKHTILYVHCVDLLIWSSTQLDFLFYDFFMIYYDFSKLLYEVI |
| Ga0314725_10045791 | 3300032789 | Switchgrass Phyllosphere | FRVMLFFIAVKNVLKHTTLYVHCVDLLIWSPTQLDFLFYDFFVIYYDFSKLL |
| Ga0314725_10236692 | 3300032789 | Switchgrass Phyllosphere | QQKNILKHTILYVHCVDLLIWSLTQLDFLFYNFSVIYCDFSKLI |
| Ga0314744_10944821 | 3300032792 | Switchgrass Phyllosphere | KHTILYVHCVDLLIWSLTQFDFLFYDFSVIYYDFSKLI |
| Ga0314735_11030901 | 3300032824 | Switchgrass Phyllosphere | HTILYVDCVDLLIWSLTQLDFLFYDFSVIYYDFSKLL |
| Ga0314743_10443181 | 3300032844 | Switchgrass Phyllosphere | TILYVHYVDLIMWSPTKLDFPFFDFSTIYYDFSKIQRK |
| Ga0314737_10344181 | 3300032875 | Switchgrass Phyllosphere | HTILYVHCIDLLIWSPTQLDFLFYDFSVIYYNFFEITLGVI |
| Ga0314749_10786102 | 3300032915 | Switchgrass Phyllosphere | LHYLYLLMWSPRKLNFSFYDFSVIYYNFLKLFYEIIDRF |
| Ga0314752_10511031 | 3300032976 | Switchgrass Phyllosphere | LYIHCVDLLIWSLTQLDFSFYDFSVIYYNFLKLFYEIIDRF |
| Ga0314758_12236091 | 3300033525 | Switchgrass Phyllosphere | MLFLHSCKKNVLKHTILYVHCIDLFIWSPTQLDFLFYDFSVIYYDFLKLR |
| Ga0314761_10820462 | 3300033526 | Switchgrass Phyllosphere | ILYVDCVDLLIWSLTQLDFLFYDFSVIYYDFSKLV |
| Ga0314759_10679031 | 3300033535 | Switchgrass Phyllosphere | LQQKNILKHIILYVHCVDLLIWSLTQLDFSFYDFSMIYYNFSKLFSGVI |
| Ga0314764_10209621 | 3300033540 | Switchgrass Phyllosphere | KNVLKHTILYVHSVDLLIWSPTQLNFSFYDFSVIYYDFSKLL |
| ⦗Top⦘ |