Metagenome / Metatranscriptome Family F026461

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F026461
Family Type	Metagenome / Metatranscriptome
Number of Sequences	197
Average Sequence Length	40 residues
Representative Sequence	TILYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIQPK
Number of Associated Samples	106
Number of Associated Scaffolds	197

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	94.92 %
% of genes from short scaffolds (< 2000 bps)	90.86 %
Associated GOLD sequencing projects	106
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.44

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (79.695 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (48.223 % of family members)
Environment Ontology (ENVO)	Unclassified (99.492 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (79.695 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 50.00% β-sheet: 0.00% Coil/Unstructured: 50.00%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.44
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.44
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 197 Family Scaffolds
PF08263	LRRNT_2	0.51
PF06058	DCP1	0.51
PF01094	ANF_receptor	0.51
PF01157	Ribosomal_L21e	0.51
PF00179	UQ_con	0.51
PF01546	Peptidase_M20	0.51

COG ID	Name	Functional Category	% Frequency in 197 Family Scaffolds
COG0683	ABC-type branched-chain amino acid transport system, periplasmic component	Amino acid transport and metabolism [E]	0.51
COG2139	Ribosomal protein L21E	Translation, ribosomal structure and biogenesis [J]	0.51
COG5078	Ubiquitin-protein ligase	Posttranslational modification, protein turnover, chaperones [O]	0.51

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
All Organisms	root	All Organisms	20.30 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
cellular organisms	root	All Organisms → cellular organisms	19.80 %
Viruses	superkingdom	All Organisms → Viruses	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	19.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	19.80 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	17.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	17.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	17.77 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	12.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	12.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	12.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	12.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	12.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	12.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	12.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	12.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	12.69 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	12.18 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
PACMAD clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade	9.14 %
BOP clade	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade	1.02 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Panicoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	8.63 %
Oryzoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae	0.51 %
Arundinoideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae	0.51 %
Pooideae	subfamily	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae	0.51 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Panicodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae	5.08 %
Andropogonodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae	2.03 %
Triticodae	no rank	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae	0.51 %
Arundineae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae	0.51 %
Oryzeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae	0.51 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Paniceae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae	5.08 %
Andropogoneae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	2.03 %
Oryzinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae	0.51 %
Arundo	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo	0.51 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.51 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Panicinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae	4.57 %
Tripsacinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae	1.52 %
Oryza	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza	0.51 %
Cenchrinae	subtribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae	0.51 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.51 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.51 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Panicum	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum	4.57 %
Zea	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea	1.52 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.51 %
Setaria	genus	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria	0.51 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.51 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.51 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Panicum sect. Hiantes	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes	2.03 %
Panicum sect. Panicum	section	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum	2.03 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1.52 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.51 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	0.51 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.51 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.51 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.51 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	79.70 %
Panicum hallii	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	2.03 %
Panicum virgatum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2.03 %
Zea mays	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	1.52 %
Panicum miliaceum	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	0.51 %
Setaria italica	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	0.51 %
Oryza sativa	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	0.51 %
Arundo donax	species	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	0.51 %
Triticeae	tribe	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	0.51 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	0.51 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300009981\|Ga0105133_122876	Not Available	563	Open in IMG/M
3300013296\|Ga0157374_12295954	Not Available	567	Open in IMG/M
3300014486\|Ga0182004_10014027	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae	6309	Open in IMG/M
3300014486\|Ga0182004_10016228	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	5772	Open in IMG/M
3300014486\|Ga0182004_10051868	Not Available	2375	Open in IMG/M
3300014486\|Ga0182004_10179439	Not Available	751	Open in IMG/M
3300015269\|Ga0182113_1048071	Not Available	624	Open in IMG/M
3300015280\|Ga0182100_1028892	Not Available	759	Open in IMG/M
3300015282\|Ga0182124_1022226	Not Available	726	Open in IMG/M
3300015282\|Ga0182124_1058887	Not Available	556	Open in IMG/M
3300015286\|Ga0182176_1053152	Not Available	586	Open in IMG/M
3300015287\|Ga0182171_1024083	Not Available	729	Open in IMG/M
3300015287\|Ga0182171_1044503	Not Available	616	Open in IMG/M
3300015293\|Ga0182103_1059557	Not Available	606	Open in IMG/M
3300015294\|Ga0182126_1018045	Not Available	813	Open in IMG/M
3300015295\|Ga0182175_1020922	Not Available	788	Open in IMG/M
3300015295\|Ga0182175_1037394	Not Available	671	Open in IMG/M
3300015295\|Ga0182175_1039369	Not Available	661	Open in IMG/M
3300015298\|Ga0182106_1045753	Not Available	643	Open in IMG/M
3300015299\|Ga0182107_1054914	Not Available	613	Open in IMG/M
3300015300\|Ga0182108_1019533	Not Available	830	Open in IMG/M
3300015300\|Ga0182108_1025098	Not Available	772	Open in IMG/M
3300015300\|Ga0182108_1026803	Not Available	758	Open in IMG/M
3300015304\|Ga0182112_1057911	Not Available	604	Open in IMG/M
3300015307\|Ga0182144_1032526	Not Available	721	Open in IMG/M
3300015307\|Ga0182144_1039107	Not Available	683	Open in IMG/M
3300015308\|Ga0182142_1114265	Not Available	504	Open in IMG/M
3300015311\|Ga0182182_1061738	Not Available	643	Open in IMG/M
3300015311\|Ga0182182_1092320	Not Available	558	Open in IMG/M
3300015312\|Ga0182168_1014997	Not Available	1071	Open in IMG/M
3300015312\|Ga0182168_1029146	Not Available	876	Open in IMG/M
3300015313\|Ga0182164_1018264	Not Available	1011	Open in IMG/M
3300015314\|Ga0182140_1073425	Not Available	581	Open in IMG/M
3300015317\|Ga0182136_1093001	Not Available	592	Open in IMG/M
3300015320\|Ga0182165_1027964	Not Available	921	Open in IMG/M
3300015320\|Ga0182165_1088249	Not Available	617	Open in IMG/M
3300015321\|Ga0182127_1051938	Not Available	662	Open in IMG/M
3300015321\|Ga0182127_1075492	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	591	Open in IMG/M
3300015321\|Ga0182127_1097181	Not Available	545	Open in IMG/M
3300015322\|Ga0182110_1114647	Not Available	516	Open in IMG/M
3300015323\|Ga0182129_1032736	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	733	Open in IMG/M
3300015323\|Ga0182129_1040184	Not Available	691	Open in IMG/M
3300015323\|Ga0182129_1054779	Not Available	631	Open in IMG/M
3300015324\|Ga0182134_1104769	Not Available	577	Open in IMG/M
3300015327\|Ga0182114_1118297	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	574	Open in IMG/M
3300015328\|Ga0182153_1126735	Not Available	542	Open in IMG/M
3300015329\|Ga0182135_1011214	Not Available	1227	Open in IMG/M
3300015329\|Ga0182135_1071228	Not Available	680	Open in IMG/M
3300015330\|Ga0182152_1021721	Not Available	1015	Open in IMG/M
3300015331\|Ga0182131_1110127	Not Available	580	Open in IMG/M
3300015331\|Ga0182131_1124415	Not Available	552	Open in IMG/M
3300015331\|Ga0182131_1151745	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	508	Open in IMG/M
3300015335\|Ga0182116_1094161	Not Available	664	Open in IMG/M
3300015335\|Ga0182116_1166618	Not Available	520	Open in IMG/M
3300015337\|Ga0182151_1102804	Not Available	612	Open in IMG/M
3300015339\|Ga0182149_1031745	Not Available	960	Open in IMG/M
3300015341\|Ga0182187_1120113	Not Available	606	Open in IMG/M
3300015342\|Ga0182109_1097616	Not Available	686	Open in IMG/M
3300015342\|Ga0182109_1168520	Not Available	560	Open in IMG/M
3300015343\|Ga0182155_1105537	Not Available	664	Open in IMG/M
3300015343\|Ga0182155_1174692	Not Available	553	Open in IMG/M
3300015343\|Ga0182155_1210545	Not Available	515	Open in IMG/M
3300015345\|Ga0182111_1028599	All Organisms → Viruses → Predicted Viral	1102	Open in IMG/M
3300015345\|Ga0182111_1055243	Not Available	877	Open in IMG/M
3300015345\|Ga0182111_1063038	Not Available	837	Open in IMG/M
3300015346\|Ga0182139_1056879	Not Available	870	Open in IMG/M
3300015346\|Ga0182139_1068637	Not Available	814	Open in IMG/M
3300015346\|Ga0182139_1096010	Not Available	720	Open in IMG/M
3300015346\|Ga0182139_1103606	Not Available	699	Open in IMG/M
3300015346\|Ga0182139_1124433	Not Available	654	Open in IMG/M
3300015347\|Ga0182177_1096745	Not Available	720	Open in IMG/M
3300015347\|Ga0182177_1234202	Not Available	514	Open in IMG/M
3300015347\|Ga0182177_1250787	Not Available	500	Open in IMG/M
3300015348\|Ga0182115_1008362	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	2190	Open in IMG/M
3300015349\|Ga0182185_1033924	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum	1263	Open in IMG/M
3300015349\|Ga0182185_1125499	Not Available	752	Open in IMG/M
3300015349\|Ga0182185_1253973	Not Available	536	Open in IMG/M
3300015349\|Ga0182185_1257048	Not Available	532	Open in IMG/M
3300015350\|Ga0182163_1132785	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	769	Open in IMG/M
3300015350\|Ga0182163_1146353	Not Available	733	Open in IMG/M
3300015350\|Ga0182163_1151230	Not Available	721	Open in IMG/M
3300015350\|Ga0182163_1244918	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	562	Open in IMG/M
3300015351\|Ga0182161_1020087	Not Available	1311	Open in IMG/M
3300015351\|Ga0182161_1046431	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Oryzoideae → Oryzeae → Oryzinae → Oryza → Oryza sativa	985	Open in IMG/M
3300015351\|Ga0182161_1054496	Not Available	930	Open in IMG/M
3300015351\|Ga0182161_1081998	Not Available	799	Open in IMG/M
3300015351\|Ga0182161_1108278	Not Available	718	Open in IMG/M
3300015352\|Ga0182169_1192455	Not Available	667	Open in IMG/M
3300015353\|Ga0182179_1096538	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	879	Open in IMG/M
3300015353\|Ga0182179_1240334	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	583	Open in IMG/M
3300015354\|Ga0182167_1062608	Not Available	1306	Open in IMG/M
3300015354\|Ga0182167_1130645	Not Available	926	Open in IMG/M
3300015354\|Ga0182167_1236706	Not Available	661	Open in IMG/M
3300015354\|Ga0182167_1254051	Not Available	633	Open in IMG/M
3300015354\|Ga0182167_1255665	Not Available	631	Open in IMG/M
3300015354\|Ga0182167_1294079	Not Available	578	Open in IMG/M
3300015354\|Ga0182167_1324808	Not Available	542	Open in IMG/M
3300015354\|Ga0182167_1350192	Not Available	516	Open in IMG/M
3300015355\|Ga0182159_1007220	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	2115	Open in IMG/M
3300015355\|Ga0182159_1043909	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	1179	Open in IMG/M
3300015355\|Ga0182159_1044881	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	1170	Open in IMG/M
3300015355\|Ga0182159_1053910	Not Available	1093	Open in IMG/M
3300015355\|Ga0182159_1161493	Not Available	704	Open in IMG/M
3300015355\|Ga0182159_1178845	Not Available	674	Open in IMG/M
3300015355\|Ga0182159_1189654	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	658	Open in IMG/M
3300015355\|Ga0182159_1219103	Not Available	618	Open in IMG/M
3300015355\|Ga0182159_1254881	Not Available	579	Open in IMG/M
3300015355\|Ga0182159_1265964	Not Available	568	Open in IMG/M
3300015361\|Ga0182145_1056239	Not Available	760	Open in IMG/M
3300015361\|Ga0182145_1114027	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	602	Open in IMG/M
3300017404\|Ga0182203_1081580	Not Available	631	Open in IMG/M
3300017404\|Ga0182203_1132454	Not Available	540	Open in IMG/M
3300017407\|Ga0182220_1011249	Not Available	926	Open in IMG/M
3300017407\|Ga0182220_1040252	Not Available	663	Open in IMG/M
3300017409\|Ga0182204_1073400	Not Available	585	Open in IMG/M
3300017410\|Ga0182207_1040211	Not Available	816	Open in IMG/M
3300017410\|Ga0182207_1048319	Not Available	771	Open in IMG/M
3300017410\|Ga0182207_1085183	Not Available	643	Open in IMG/M
3300017411\|Ga0182208_1023628	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	840	Open in IMG/M
3300017412\|Ga0182199_1041115	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	912	Open in IMG/M
3300017412\|Ga0182199_1182947	Not Available	526	Open in IMG/M
3300017413\|Ga0182222_1012752	Not Available	870	Open in IMG/M
3300017413\|Ga0182222_1075838	Not Available	552	Open in IMG/M
3300017414\|Ga0182195_1026558	Not Available	1092	Open in IMG/M
3300017414\|Ga0182195_1059935	Not Available	832	Open in IMG/M
3300017414\|Ga0182195_1112726	Not Available	660	Open in IMG/M
3300017414\|Ga0182195_1129773	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	625	Open in IMG/M
3300017415\|Ga0182202_1118454	Not Available	530	Open in IMG/M
3300017417\|Ga0182230_1063703	Not Available	655	Open in IMG/M
3300017425\|Ga0182224_1035958	Not Available	810	Open in IMG/M
3300017430\|Ga0182192_1084058	Not Available	646	Open in IMG/M
3300017432\|Ga0182196_1101493	Not Available	585	Open in IMG/M
3300017433\|Ga0182206_1040223	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	776	Open in IMG/M
3300017436\|Ga0182209_1001010	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays	2165	Open in IMG/M
3300017436\|Ga0182209_1007465	Not Available	1293	Open in IMG/M
3300017438\|Ga0182191_1083521	Not Available	655	Open in IMG/M
3300017438\|Ga0182191_1138581	Not Available	553	Open in IMG/M
3300017440\|Ga0182214_1151076	Not Available	516	Open in IMG/M
3300017442\|Ga0182221_1088585	Not Available	617	Open in IMG/M
3300017443\|Ga0182193_1071412	Not Available	711	Open in IMG/M
3300017443\|Ga0182193_1101813	Not Available	632	Open in IMG/M
3300017443\|Ga0182193_1154988	Not Available	547	Open in IMG/M
3300017445\|Ga0182198_1008796	Not Available	1469	Open in IMG/M
3300017445\|Ga0182198_1049451	Not Available	851	Open in IMG/M
3300017683\|Ga0182218_1021230	Not Available	909	Open in IMG/M
3300017683\|Ga0182218_1098066	Not Available	579	Open in IMG/M
3300017684\|Ga0182225_1033792	Not Available	789	Open in IMG/M
3300017686\|Ga0182205_1074379	Not Available	666	Open in IMG/M
3300017686\|Ga0182205_1080801	Not Available	648	Open in IMG/M
3300017693\|Ga0182216_1042604	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae	947	Open in IMG/M
3300028049\|Ga0268322_1024721	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	665	Open in IMG/M
3300028056\|Ga0268330_1000839	Not Available	1968	Open in IMG/M
3300028056\|Ga0268330_1023515	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	711	Open in IMG/M
3300028476\|Ga0268329_1003426	Not Available	918	Open in IMG/M
3300032466\|Ga0214503_1280237	Not Available	514	Open in IMG/M
3300032467\|Ga0214488_1048104	Not Available	941	Open in IMG/M
3300032467\|Ga0214488_1083486	Not Available	702	Open in IMG/M
3300032468\|Ga0214482_1048819	Not Available	818	Open in IMG/M
3300032469\|Ga0214491_1116425	Not Available	637	Open in IMG/M
3300032490\|Ga0214495_1080264	Not Available	758	Open in IMG/M
3300032502\|Ga0214490_1041429	All Organisms → cellular organisms → Eukaryota → Viridiplantae	1030	Open in IMG/M
3300032551\|Ga0321339_1081259	Not Available	745	Open in IMG/M
3300032591\|Ga0214484_1028525	Not Available	1141	Open in IMG/M
3300032591\|Ga0214484_1097845	Not Available	605	Open in IMG/M
3300032593\|Ga0321338_1381580	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	503	Open in IMG/M
3300032625\|Ga0214501_1094979	All Organisms → cellular organisms → Eukaryota → Viridiplantae	949	Open in IMG/M
3300032689\|Ga0214497_1041323	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax	1013	Open in IMG/M
3300032689\|Ga0214497_1080008	Not Available	720	Open in IMG/M
3300032697\|Ga0214499_1269711	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	524	Open in IMG/M
3300032698\|Ga0214485_1015889	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → BOP clade → Pooideae → Triticodae → Triticeae	1321	Open in IMG/M
3300032699\|Ga0214494_1004626	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	2005	Open in IMG/M
3300032757\|Ga0314753_1042880	Not Available	822	Open in IMG/M
3300032761\|Ga0314733_1002199	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum	2427	Open in IMG/M
3300032761\|Ga0314733_1004774	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Cenchrinae → Setaria → Setaria italica	1942	Open in IMG/M
3300032761\|Ga0314733_1083586	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	605	Open in IMG/M
3300032789\|Ga0314725_1004579	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Panicum → Panicum hallii	1522	Open in IMG/M
3300032789\|Ga0314725_1023669	Not Available	750	Open in IMG/M
3300032792\|Ga0314744_1094482	Not Available	567	Open in IMG/M
3300032824\|Ga0314735_1103090	Not Available	526	Open in IMG/M
3300032844\|Ga0314743_1044318	Not Available	1037	Open in IMG/M
3300032875\|Ga0314737_1034418	Not Available	878	Open in IMG/M
3300032915\|Ga0314749_1078610	All Organisms → cellular organisms → Eukaryota → Viridiplantae	711	Open in IMG/M
3300032976\|Ga0314752_1051103	All Organisms → cellular organisms → Eukaryota → Viridiplantae	793	Open in IMG/M
3300033525\|Ga0314758_1223609	Not Available	507	Open in IMG/M
3300033526\|Ga0314761_1082046	Not Available	716	Open in IMG/M
3300033535\|Ga0314759_1067903	Not Available	1089	Open in IMG/M
3300033540\|Ga0314764_1020962	Not Available	1051	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Host-Associated	Host-Associated	100.00%

Habitat	Taxonomy	Distribution
Plants	Host-Associated → Plants	100.00%

Habitat	Taxonomy	Distribution
Phyllosphere	Host-Associated → Plants → Phyllosphere	95.94%
Roots	Host-Associated → Plants → Roots	3.05%
Rhizosphere	Host-Associated → Plants → Rhizosphere	0.51%
Unclassified	Host-Associated → Plants → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified	95.94%
Unclassified	Host-Associated → Plants → Roots → Unclassified	3.05%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified	0.51%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Unclassified	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified	95.94%
Unclassified	Host-Associated → Plants → Roots → Unclassified → Unclassified	3.05%
Unclassified	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified	0.51%
Unclassified	Host-Associated → Plants → Unclassified → Unclassified → Unclassified	0.51%

Habitat	Taxonomy	Distribution
Miscanthus Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere	48.22%
Switchgrass Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere	45.69%
Root	Host-Associated → Plants → Roots → Unclassified → Unclassified → Root	3.05%
Phyllosphere	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere	2.03%
Miscanthus Rhizosphere	Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere	0.51%
Switchgrass Associated	Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated	0.51%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300009981	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_208 metaG	Host-Associated	Open in IMG/M
3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Host-Associated	Open in IMG/M
3300014486	Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015280	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015293	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015300	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015311	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015312	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015313	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015317	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015320	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015324	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015327	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015328	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015329	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015330	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015331	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015334	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015335	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015337	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015339	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015340	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015348	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015349	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015350	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015352	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015353	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015354	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017412	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017414	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017432	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017436	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017440	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017445	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017693	Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300028049	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1	Host-Associated	Open in IMG/M
3300028056	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300028476	Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_17JUL2017_LD1	Host-Associated	Open in IMG/M
3300032466	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12SEP2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032467	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032468	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032469	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032490	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032502	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032551	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_31MAY2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032591	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032593	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032625	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032689	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_12JUL2016_LR2 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032697	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_12SEP2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032698	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_31MAY2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032699	Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_12JUL2016_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032757	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032761	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032789	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_05JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032792	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032824	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032844	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_17JUL2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032875	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_26JUN2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032915	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300032976	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_07AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033525	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033526	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033535	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M
3300033540	Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_18SEP2017_LR1 (Metagenome Metatranscriptome)	Host-Associated	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0105133_1228761	3300009981	Switchgrass Associated	YILLYIHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIKSK*
Ga0157374_122959541	3300013296	Miscanthus Rhizosphere	TILYIHCVDLLMWSPIKLDFPFYGFSVIYYDFSKIQPK*
Ga0182004_100140271	3300014486	Root	QKRFILKYTILYIHCVDLLMWSLTKLDFLFYDFSVIYYDFSKII*
Ga0182004_100162286	3300014486	Root	KFVLKCTILYVHYVDLLIWSPTKSDLIFYEFYVIYYNFTNI*
Ga0182004_100518682	3300014486	Root	SYNKNFVLKCTILYVHYVDLLIWSPIKSDLLFYKFYVIYYNFINIQPK*
Ga0182004_100814851	3300014486	Root	VHYVDLLIWSPIKSDLLFYKFYVIYYNFTNIQPK*
Ga0182004_101794392	3300014486	Root	IILYIHYVDLLIRSPTKLNFIFYDFSMIYYDFSKIQRK*
Ga0182004_101935071	3300014486	Root	ILYVHYVDLLIWSPTQLELLFYEFYVIYSNFTNIQPK*
Ga0182113_10480711	3300015269	Miscanthus Phyllosphere	KYTILYVHCVDLLMWSPTKLDFSFYDFSMIYYDFLKIQPK*
Ga0182100_10288921	3300015280	Switchgrass Phyllosphere	MIFFIAVKNVLKHTILYVYYVNLLIWSLTQLNFLFYDFSAIYYDFSK
Ga0182124_10222261	3300015282	Miscanthus Phyllosphere	KHIILYMHCVDLLMWSPIKLNFLFYDFSVIYYDFSKIQPK*
Ga0182124_10588871	3300015282	Miscanthus Phyllosphere	TILYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIQPK*
Ga0182176_10531521	3300015286	Miscanthus Phyllosphere	VHCVDLLMWSPTKLDFSFYDFSVIYYDFSKIQRK*
Ga0182171_10240832	3300015287	Miscanthus Phyllosphere	LKYTILYMQCVDLLIWSSTKLDFLFYDISVIYYDFSNIQPK*
Ga0182171_10445031	3300015287	Miscanthus Phyllosphere	LYIHYVDLLMWSPIKLDFSFYDFSMIYYDFSKIQRK*
Ga0182103_10595571	3300015293	Switchgrass Phyllosphere	TKNILKHTILYIYCVDLFIWSLTKLDFLIYDFFVIYYDFSKIELK*
Ga0182126_10180452	3300015294	Miscanthus Phyllosphere	VYCVDLLMWSPTKLDIRVYDFSVIYYDFSNIQPK*
Ga0182175_10209221	3300015295	Miscanthus Phyllosphere	LKHTILYVHCVDLLMWSPTKLDFSFLDFSMIYYDFSKIQLK*
Ga0182175_10373941	3300015295	Miscanthus Phyllosphere	SQNFVLKHTILYVQCVDLPMWSPTKLDFLFYDFSMIYYDFSKI*
Ga0182175_10393691	3300015295	Miscanthus Phyllosphere	HTILYINCVDLLMWSLTKLDFPFYDFSVIYYDFLKIRSK*
Ga0182106_10457531	3300015298	Miscanthus Phyllosphere	LKHTILYVQCVDLLMWSPTKLDFLFYDFSVIYYNFSKIQQK*
Ga0182107_10549142	3300015299	Miscanthus Phyllosphere	KHTILYVHRVDLLMWSPTKLDFLFYIFFVIYYDFSKIQLK*
Ga0182108_10195332	3300015300	Miscanthus Phyllosphere	TILYVHCVDLLMWSPTKLDFSSYDFSVIYYDFSKIQPK*
Ga0182108_10250981	3300015300	Miscanthus Phyllosphere	NSILYVHCLDLLMWSPTKLDFLFYDFSVIYYDFSKIQPK*
Ga0182108_10268031	3300015300	Miscanthus Phyllosphere	KNFVLKHTILYVHCVDILTWIPTKLDFPFYDFSVIYYDFAKIQPK*
Ga0182112_10579111	3300015304	Miscanthus Phyllosphere	HTILYVHCVDLLMWSPTKLDFLFYDFSMIYYDFSKIQPK*
Ga0182144_10325261	3300015307	Miscanthus Phyllosphere	ILYVHCVDLLMWNPTKLDFLFYDFSVIYYDFSKIHPK*
Ga0182144_10391071	3300015307	Miscanthus Phyllosphere	TVLYIHCVDLLMWSPTKLEFSFYDFSMIYYDFSKIHRK*
Ga0182142_11142651	3300015308	Miscanthus Phyllosphere	ILYVHCVDLLMWSPTKLDFLFYDFPVIYYDFLKIQPK*
Ga0182182_10617381	3300015311	Switchgrass Phyllosphere	VKNVLKHTILYVHCVDLLIWSPTQLDYSFYDFSVIYYDFSKLL*
Ga0182182_10923201	3300015311	Switchgrass Phyllosphere	VHCIDLLMWSQTKLDFSFYDFSVIYYDFSKIQPK*
Ga0182168_10149971	3300015312	Switchgrass Phyllosphere	LKYILLYVHCVDLLMWSPTKLDFLFYDFSMIYYDFSKIKSK*
Ga0182168_10291461	3300015312	Switchgrass Phyllosphere	TILYVHCVDLLIWSLTQLDFPFYDFSVIYYDFSKLL*
Ga0182164_10182641	3300015313	Switchgrass Phyllosphere	LLYIHCVDLLMWSPTKLDFLFFDFSVIYYDFSKIKSK*
Ga0182140_10734251	3300015314	Miscanthus Phyllosphere	LKHTILYVHCVNVLMWSPTKLDFLFCDFSVIYYDFFMI*
Ga0182136_10930011	3300015317	Switchgrass Phyllosphere	KHNILYVHSVDPLMWSPTNLDFPFYDFSVIYYDFLKIQPK*
Ga0182165_10279641	3300015320	Switchgrass Phyllosphere	FFKILLKYTILYVHCVVLLIWSPTKLDFPIYDFSMIYYNFFMIQSK*
Ga0182165_10882491	3300015320	Switchgrass Phyllosphere	IVLKHTILYVHCVDLLIWSLTQFDFLFYDFSVIYYDFSKLI*
Ga0182127_10519381	3300015321	Miscanthus Phyllosphere	VHGIDLLVWSPTQLYFPFYNFFVIYYDVSKILTK*
Ga0182127_10754921	3300015321	Miscanthus Phyllosphere	FVLKHTVLYIHYVDLLMWSPIKLDFSIIYYDFSKIHRK*
Ga0182127_10971811	3300015321	Miscanthus Phyllosphere	VHCVNLLMWSPTKLDFLFYDFFVIYYVFSKIQSK*
Ga0182110_11146472	3300015322	Miscanthus Phyllosphere	HTILYVHYVYLLMWSPTKLDFTFYDFSMIYYDFSKI*
Ga0182129_10327362	3300015323	Miscanthus Phyllosphere	VHYVDLLMWSSTKLDYPFYDFSVIYNDFSKIQPK*
Ga0182129_10401841	3300015323	Miscanthus Phyllosphere	KHTILYIHYVDLLMWSQRKLDFLFYNFAMFYYDFSKI*
Ga0182129_10547791	3300015323	Miscanthus Phyllosphere	HTVLYIHYVDLLMWSPTKLDFLFYDFSVIYYDFSKIQK
Ga0182134_11047691	3300015324	Switchgrass Phyllosphere	KIVLKHTILYVHCVGRLIWSLTQLDFLFYDFSVIYYDFSKLF*
Ga0182114_11182971	3300015327	Switchgrass Phyllosphere	KHISTATVKNILKHTILYVHYVDLLIWSLTQLDFLFYDFSVIYYDFLKLL*
Ga0182153_11267351	3300015328	Switchgrass Phyllosphere	TILYVHCVDLLIWSLTQLDFLFYDFSVIYYDFSKLL*
Ga0182135_10112141	3300015329	Switchgrass Phyllosphere	ILYTHCVDMRMWSLTELDFLFYKFSVIYYDFLKIQPNK*
Ga0182135_10712282	3300015329	Switchgrass Phyllosphere	HTILYVHCVDLLIWSLTQLDFPFYDFFVIYYDFSKLI*
Ga0182152_10217211	3300015330	Switchgrass Phyllosphere	LYVQYVDLLMWSLKKLNFLFYDFSIIYNDFSKIQLDFF*
Ga0182131_11101272	3300015331	Switchgrass Phyllosphere	VLKHTILYIYCVDLLIWILIQLDFPFYDFSVIYYDFLKLL*
Ga0182131_11244151	3300015331	Switchgrass Phyllosphere	LKHTILYVYCVVLLIWSLTKLEFLFYDFSVIYYDFSKLF*
Ga0182131_11517451	3300015331	Switchgrass Phyllosphere	NIPKHTILYVHCVDLLIRSPAQLDFSFYDFSVIYYDFSKLFLGVI*
Ga0182132_10784932	3300015334	Switchgrass Phyllosphere	VKNVLKHTILYVHCVDLLIWSPTELDFLFYDFFVILL*
Ga0182116_10941611	3300015335	Switchgrass Phyllosphere	QNYTILYAHCVDLLMWSPTKVDFSFYDFSVIYYDFLKLLYGVI*
Ga0182116_11666181	3300015335	Switchgrass Phyllosphere	KHNILYVHSVDLLIWSPTQLNFLFYDFFVIYYDFLKLL*
Ga0182151_11028041	3300015337	Switchgrass Phyllosphere	NYTILYAHCVDLLMWSPTKLDFPFYDFSVIYYDFSKI*
Ga0182149_10317451	3300015339	Switchgrass Phyllosphere	TILYIYSVDLLIWSPTQLNFSFYDFFVIYYDFSKLL*
Ga0182149_10937821	3300015339	Switchgrass Phyllosphere	ICSLVDLLMLSPKNLDFSFYDFSISYYDFSKIQSKC*
Ga0182133_10229411	3300015340	Switchgrass Phyllosphere	SYSKNFIQKYIILYVYCVDLLMWSPIKLDFLFYDFLVIYCDF*
Ga0182187_11201132	3300015341	Miscanthus Phyllosphere	VHCIDLLIWSPTKLDFLFYDFSVIYYDFSNIQRI*
Ga0182109_10976161	3300015342	Miscanthus Phyllosphere	KHTVLYIHYVDLLMWSPIKLDFLFYDFSMIYYDFLKIHRK*
Ga0182109_11685202	3300015342	Miscanthus Phyllosphere	VNYVDLLMWSPTKLDFPFYDFSMIYYVFSKIQRK*
Ga0182155_10415512	3300015343	Miscanthus Phyllosphere	FVLKHTVLYIHCVDLLMWSPIKLDFLFYDFSMIYCDF*
Ga0182155_11055371	3300015343	Miscanthus Phyllosphere	YTILYVHYVDLLMWSPTKLNFPFYDFSVIYYGFSKI*
Ga0182155_11746921	3300015343	Miscanthus Phyllosphere	VHCVDLLMWSPTKLDFLFYDFPVIYYDFLKIQPK*
Ga0182155_12105451	3300015343	Miscanthus Phyllosphere	NFVLKHIILYVHYIDLLIWSLAKLDFLFYDFSVIYYNFSKIQPK*
Ga0182111_10285991	3300015345	Miscanthus Phyllosphere	LCTKAYLLYVHCVDLIMWSPTKLDFLLNDFSVIYYNFSKIQRK*
Ga0182111_10552431	3300015345	Miscanthus Phyllosphere	SKNFILKYTILYVHCVDVFMWSPTKLKFPFYDFYVIYYDFSKI*
Ga0182111_10630381	3300015345	Miscanthus Phyllosphere	VHCVDLLMWSPTKLDFTFYDFSVIYYDFSKIQRK*
Ga0182139_10568791	3300015346	Miscanthus Phyllosphere	QQNFVLKHTILYVYCVDLLMWSPTKLDFLFYDFYMIYYDFSKI*
Ga0182139_10686372	3300015346	Miscanthus Phyllosphere	TILYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIQSK*
Ga0182139_10960102	3300015346	Miscanthus Phyllosphere	HTVLYIHYVDLLMWSPTKLDFLFYDFSMIYCDFLKIYRK*
Ga0182139_11036061	3300015346	Miscanthus Phyllosphere	VHYVDLLMWSPTKLDFLFYDFSVIYYDFSKIQRK*
Ga0182139_11244331	3300015346	Miscanthus Phyllosphere	LYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIQRK*
Ga0182177_10967451	3300015347	Miscanthus Phyllosphere	HTILYVHCVDLLMWSPIKLDFPFYDFFVIYYDFLKIQPK*
Ga0182177_12342021	3300015347	Miscanthus Phyllosphere	ILYVHCVDLLMWSPTKLDFPFYDFSVIYYDFSKIKRK*
Ga0182177_12507871	3300015347	Miscanthus Phyllosphere	VKHTILYIHYVDLVMWSPRKIDFPFYDFVFYYDFSKIQPK*
Ga0182115_10083624	3300015348	Switchgrass Phyllosphere	HTILYVHCVDLLIWSLTQLDFIFYDFSVIYYDFLKLLYGVI*
Ga0182185_10339241	3300015349	Switchgrass Phyllosphere	KHTILYVHCVDLLIWSLTQLDFLFYDFFVIYYDFSKLL*
Ga0182185_11254991	3300015349	Switchgrass Phyllosphere	TILYVHCVDLLIWSLPQLDFLFYDFSVIYYDFSKLL*
Ga0182185_12539731	3300015349	Switchgrass Phyllosphere	IILYVYYVDLLIRSPTQFDFPFYEFSVIYYDFSKLL*
Ga0182185_12570481	3300015349	Switchgrass Phyllosphere	KHIILYVHCVDLLIWSPIQLDFLFYDFSVIYYDFLKLL*
Ga0182163_11327851	3300015350	Switchgrass Phyllosphere	LKLQQKNILKHTILYIHCVDLLIWSLTQLDVSFYDFSVIYYDFLKLL*
Ga0182163_11463531	3300015350	Switchgrass Phyllosphere	IKNFVQNYTILYAHCVDLLMWSPTKLDFSFYDFSVVYYDFSKI*
Ga0182163_11512301	3300015350	Switchgrass Phyllosphere	NILKHTILYVHCVDLLIWSLTQLDFLFYNFSVIYYDFSKLI*
Ga0182163_12449182	3300015350	Switchgrass Phyllosphere	MHTILYVHCVYLLIWSLTQLNFLFYNFFVIYYNFSKLL
Ga0182161_10200871	3300015351	Miscanthus Phyllosphere	KHTILYINCVDILTWSPTKFDFPFYDVSMIYYDFSKI*
Ga0182161_10464311	3300015351	Miscanthus Phyllosphere	KNFVIKHTILYVYCGDLLIWSPAKLDFSFYDFSMIYYNFSNI*
Ga0182161_10544961	3300015351	Miscanthus Phyllosphere	KNFVLKHTILYVHCVDLLMWSPTKLDFLFYDFFMIYYDFSKI*
Ga0182161_10819981	3300015351	Miscanthus Phyllosphere	KHTILYIHCGDLLMWSATKLNFLFYDFSVIYYDFSKIQPK*
Ga0182161_11082782	3300015351	Miscanthus Phyllosphere	VLKHTILYVHCVDLLMWSPTKLNLLFYDFSVIYYDFLKIQQK*
Ga0182169_11924551	3300015352	Switchgrass Phyllosphere	HCVDLLIWSPTQLDFSFYDFSLIYYDFSKLLYGII*
Ga0182179_10965381	3300015353	Switchgrass Phyllosphere	TILCVHCVDLLILSPTQLDFSFYDFSVIYYDFSKLL*
Ga0182179_12403341	3300015353	Switchgrass Phyllosphere	HTILYIHCVDLLIWSLTQLNFLFYDFFVIYYDFLKLLYEIIDRF*
Ga0182167_10626082	3300015354	Switchgrass Phyllosphere	LQQKNILKHTILYVHCVDLLILSLTQLDFSFYDFSVIY*
Ga0182167_11306451	3300015354	Switchgrass Phyllosphere	KHIILYIQCVDLLIWSLTQLDFLFYDFSVIYYIFQNCFRR*
Ga0182167_12367061	3300015354	Switchgrass Phyllosphere	HTILYIHCVDLLIWSLTQLNFIFYDFSVIYYDFLKLF*
Ga0182167_12540511	3300015354	Switchgrass Phyllosphere	HTILYVHCLDLLIWSLTQLNFLFYDFSVIHYDFLKLI*
Ga0182167_12556651	3300015354	Switchgrass Phyllosphere	SNNFVLKHTILYLHCVDLLMWSPTKLGFPFYDFFVIYYDFSKFSGNK*
Ga0182167_12940791	3300015354	Switchgrass Phyllosphere	LKHIILYIQCVDLLMWSLTKLKFSFYDFSMIYNNFSKIQ*
Ga0182167_13248081	3300015354	Switchgrass Phyllosphere	KIVLKHTILYVHCVDLLIWSLTQFDFLFYDFSVIYYDFSKLI*
Ga0182167_13501921	3300015354	Switchgrass Phyllosphere	VLKHTILYVHCVALLIWSPTQLDFSFYDFSVIYYDFLKLI*
Ga0182159_10072201	3300015355	Miscanthus Phyllosphere	NFVLKHTILYIHCVDQLMWSPTKLNFLFYDFSVIYYDFTKIQPK*
Ga0182159_10439092	3300015355	Miscanthus Phyllosphere	VHCVDLLMWSPTKLNFLFYDVFVIYYDFSKIQPK*
Ga0182159_10448811	3300015355	Miscanthus Phyllosphere	IVLKYTILYVHCVDLLIWSPTKLDFLFYDFSVIYYDFSKI*
Ga0182159_10539101	3300015355	Miscanthus Phyllosphere	VHCVDLLMWSPTKLDFLFYDFSMIYYDVSKIQQK*
Ga0182159_11614932	3300015355	Miscanthus Phyllosphere	KHTILYVQCVDLLMWSPTKLDFLFYDFFVIYHDFSNIQPK*
Ga0182159_11788451	3300015355	Miscanthus Phyllosphere	ILYVHCVDLLMWSPTKLDFLFYDFSMIYYDFSKI*
Ga0182159_11896542	3300015355	Miscanthus Phyllosphere	FVLKHTILYIHYVDLLMWSPTELDFLFYDFSVIYYDFSKIQPK*
Ga0182159_12191032	3300015355	Miscanthus Phyllosphere	ILYIHCVDLLMSSPTKLDFLFYGFSMIYYDFSKI*
Ga0182159_12548811	3300015355	Miscanthus Phyllosphere	NHTILYFHCVDLLTWSPINLDFSSYGFYVIYYDFLKIQPK*
Ga0182159_12659641	3300015355	Miscanthus Phyllosphere	SKNFVLKHTILYIHCVDLLMWSPTELDFSFYDFSMIYYDFSKIQLK*
Ga0182145_10562391	3300015361	Miscanthus Phyllosphere	SKNFVLKHIILYVHCIDLLMWSPKKLNFLFYDFSVIYYDFFKD*
Ga0182145_10740292	3300015361	Miscanthus Phyllosphere	LYIHCIGLLTWSSTKLDFSFYDFSVIYYDFSKIQLKKIK*
Ga0182145_11140271	3300015361	Miscanthus Phyllosphere	YVHCVDLLMWSPTKLDFPFYDFSVIYYDFSKIQRK*
Ga0182203_10815801	3300017404	Miscanthus Phyllosphere	KHTILYIHCIDLLIWSPTKLDFLFYDFSVIYYDSTKIQPK
Ga0182203_11324541	3300017404	Miscanthus Phyllosphere	YSKKFVLKHTVLYIHYVDLLMWSPTKLDFLFYDFSMIYCDFLKF
Ga0182220_10112491	3300017407	Miscanthus Phyllosphere	TKNFVLKYIILYVHCVDLLMWNPTKLDFLFYDFSVIYYDFSKI
Ga0182220_10402521	3300017407	Miscanthus Phyllosphere	KHTILYVHCVDLLMWSPTKLDFPFYDFSVIYYDFSKIQPK
Ga0182204_10734002	3300017409	Miscanthus Phyllosphere	VVLKHTILYIHYVDLFMWSPTKLDFPFYDFSVIYYDFSKIQSK
Ga0182207_10402111	3300017410	Miscanthus Phyllosphere	LKHTILYVHCVDLLMWSPTKLDLPFYDFSTIYYDFLKIQPK
Ga0182207_10483191	3300017410	Miscanthus Phyllosphere	LKYTILYVHYVDLLMWSPTKLDFLFYDFSVIYYDFSKIWPK
Ga0182207_10851831	3300017410	Miscanthus Phyllosphere	KHTILYIHYVDLLMWSQRKLDFLFYNFAMIYYDFSKF
Ga0182208_10236281	3300017411	Miscanthus Phyllosphere	ILYVHCVDLLMWSPIKLDFLFYDFSVIYYDFSKIQ
Ga0182199_10411151	3300017412	Switchgrass Phyllosphere	HTILYVHCIDLLIWSPTQLDFLFYDFSVIYYDFLKLF
Ga0182199_11829471	3300017412	Switchgrass Phyllosphere	MLFFIAVKNVLKHIILYVHSVDLLIWSPTQLNFSFYDF
Ga0182222_10127521	3300017413	Miscanthus Phyllosphere	KHTILYVHCIDLLMWSPTELDFLFYDFSMIYYDFLKI
Ga0182222_10758381	3300017413	Miscanthus Phyllosphere	KNFVLKHTILYVHCVDLLMWSPIKLDFLFYDFSVIYYDFLKIQPK
Ga0182195_10265581	3300017414	Switchgrass Phyllosphere	HTILYVHCVALLIWSRTQLDFLFYDFSVIYYDFSKLL
Ga0182195_10599351	3300017414	Switchgrass Phyllosphere	SKATAKNILKHTILYFHCVDLLIWSLTQLDFLFYNFFVIYYDFLKLL
Ga0182195_11127261	3300017414	Switchgrass Phyllosphere	ILKHIILYVHCVDLLIWSLTQLNFLFYDFSVIYYDFSKLF
Ga0182195_11297732	3300017414	Switchgrass Phyllosphere	KYILLYVHCVDLLMWSPTKLDFLFYDFFVIYYDFSKIKSK
Ga0182202_11184541	3300017415	Miscanthus Phyllosphere	TILYVHCVDLLMWSPTKLDFPFYDFFVIYYDFSNIQ
Ga0182230_10637032	3300017417	Miscanthus Phyllosphere	TILYVHCVDLIMWSPIKLDLPFYVFSVIYYNFLKIQPK
Ga0182224_10359581	3300017425	Miscanthus Phyllosphere	KIILKYTILYIHCVDLHTWSLTKLDFLFYNFSVIYYDFSKIQLK
Ga0182192_10840581	3300017430	Miscanthus Phyllosphere	YVHCVDLLMWSPTKLDFPFYNFSVIYYDFLKIHQK
Ga0182192_10977402	3300017430	Miscanthus Phyllosphere	LLMWSPTKLDFSFYDFSVIYYNFLKIQRKEIKKKKKPRSL
Ga0182196_11014931	3300017432	Switchgrass Phyllosphere	KKKLKHTILYVHCVDLLIWSLTQLDFSFYDFSVIYYDFSKLLSRVI
Ga0182206_10402231	3300017433	Miscanthus Phyllosphere	TILYVHCVDLLMWSPTKLDFPFYDFSVIYYDFSKIQQK
Ga0182209_10010101	3300017436	Miscanthus Phyllosphere	ILYVHCVDLLMWSPIKLDFPFYDFSVIYYDFSKIQRI
Ga0182209_10074652	3300017436	Miscanthus Phyllosphere	YIHYVDLLMWSPIKLDFSFYDFSMIYYDFKKIHQK
Ga0182191_10110514	3300017438	Miscanthus Phyllosphere	IYLKLQQKNCTKNIILYVHCVDPLMWCPTKLDFLFYDFIVIYYDFSKIQPK
Ga0182191_10835211	3300017438	Miscanthus Phyllosphere	VLKHTVLYIHCVDLLMWSPIKLDFLFYDFSMIYYDFLKIHQK
Ga0182191_11385811	3300017438	Miscanthus Phyllosphere	YIHYVDLLMWSPTKLDFLFYDFSMIYYDFSKIHRK
Ga0182214_11510761	3300017440	Switchgrass Phyllosphere	LLYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSNIKSK
Ga0182221_10885851	3300017442	Miscanthus Phyllosphere	LKNTILYVHCVDLLMWSSTKLDFLFYDFSMIYYDFSKIQPK
Ga0182193_10714121	3300017443	Miscanthus Phyllosphere	LKHITLYVNYVDLLMWSSTKLDFPFYDFSLIFYDFSKIQRK
Ga0182193_11018131	3300017443	Miscanthus Phyllosphere	TTAKKIVLKDIILYVHYVDLVMWSPTKLDFPFYDFFVIYYDFLNIQPK
Ga0182193_11549881	3300017443	Miscanthus Phyllosphere	TILYVHCVDLLMWSPTKLDFLFYDFSVIYYDFSKIQPK
Ga0182198_10087961	3300017445	Switchgrass Phyllosphere	KYTILYVHCVDLLTWSPIKLDFLFYDFSVIYYDFSKIQSK
Ga0182198_10494511	3300017445	Switchgrass Phyllosphere	MYRSKAITKNILKHTILYVHCVNLVIWSLTQLNFLFYNFSVIY
Ga0182218_10212301	3300017683	Miscanthus Phyllosphere	LKHTILYVHCIDLLMWSPTKFDFSFYDFSVIYYDFSKIQPK
Ga0182218_10980662	3300017683	Miscanthus Phyllosphere	KHTILYVCCVDLLMWSLEKLDFLFYDFSVIYYDFSNIQRK
Ga0182225_10337921	3300017684	Miscanthus Phyllosphere	FILKHAILYVHCVDLLMWSLTKLDFSFYDFSVIYYYFSKI
Ga0182205_10345802	3300017686	Miscanthus Phyllosphere	LYVHCVDLLMWSPIQLDFLFSDFSVIYYDFSKIQSK
Ga0182205_10743791	3300017686	Miscanthus Phyllosphere	LKLTILYVYCVDLFMWSPTKLDFPFYNFFMIYNVFSKIHSK
Ga0182205_10808011	3300017686	Miscanthus Phyllosphere	TILYVHYVDLLMWSLTKLDFLFYNFSVIYYDFSKIQLK
Ga0182216_10426041	3300017693	Switchgrass Phyllosphere	DLKVQQKNVLKHTILYVHCVDLLIWSPTQLNFSFYDFSVIYYDFSKLL
Ga0268322_10247212	3300028049	Phyllosphere	KKHTILYVHSVDLLIWSLTQLDFPFYDFSVIYYDFLKLL
Ga0268330_10008391	3300028056	Phyllosphere	TILYTHCVDMRMWSLTELDFLFYKFSVIYYDFLKIQPNK
Ga0268330_10235151	3300028056	Phyllosphere	YIYCVDLLMWSPIKLDFLFYDFSVIYYDFSKIKPK
Ga0268329_10034261	3300028476	Phyllosphere	MFFFIAVKNILKHTILYVHSVDLLIWSSTQLNFLFYNFFVIYYDF
Ga0214503_12802371	3300032466	Switchgrass Phyllosphere	NVLKHTILYIHCVDLLIWSLTQLDFSFYDFSVIYYNFLKLFYEIIDRF
Ga0214488_10481042	3300032467	Switchgrass Phyllosphere	LDLCFFIATKNVLKHTILYVHCIDLLIWSPTQLDFLFYDFSVIYYNFLKLL
Ga0214488_10834861	3300032467	Switchgrass Phyllosphere	LDLYVHCVDLLIWSPTQLNFSFYDFSVFNYDFLKLL
Ga0214482_10488191	3300032468	Switchgrass Phyllosphere	YSKQNILKHTILYVHCVDLLIWSLTQLDFPFYDFSVIYYDFSKLL
Ga0214491_11164251	3300032469	Switchgrass Phyllosphere	NVLKHTILYVHCIDLLIWSPTQLDFLFYDFSVIYYNFLKLL
Ga0214495_10802642	3300032490	Switchgrass Phyllosphere	KNFVLKHSILCVHCIDLLMWSPTKLDFLFYDFSVIYYDFSKLV
Ga0214490_10414291	3300032502	Switchgrass Phyllosphere	NVLKHTILYIHCVDLLIWSLTQLDFSCYDFSVIYYNFLKLFYEIIDRF
Ga0321339_10812592	3300032551	Switchgrass Phyllosphere	LKHTILYVHCVDLLIWSLTQLDFPFYDFSVIYYDFSKLL
Ga0214484_10285253	3300032591	Switchgrass Phyllosphere	YVHCVDLLIWSPTQLSFSFYDFFVINYDFLKLLQRAI
Ga0214484_10978451	3300032591	Switchgrass Phyllosphere	ILYVHSVDLLIWSSTQLNFLFYNFFVIYYDFSKLF
Ga0321338_13815801	3300032593	Switchgrass Phyllosphere	VHCVDLLIWSLTQLDFIFDDFSVIYYDFLKLLYGVI
Ga0214501_10949791	3300032625	Switchgrass Phyllosphere	KNVLKHTILYVHCVDLLIWSLTQLDFSFYDFSVIYYNFLKLFYEIIDRF
Ga0214497_10413231	3300032689	Switchgrass Phyllosphere	KNVLKHTTLYVHRVDLLIWSPTQLDFSFYDFFVIYYNFSKLL
Ga0214497_10800081	3300032689	Switchgrass Phyllosphere	KNILKHTILYVHCVDLLIWSLTQLDFLFYDFSVIYYDFSKLL
Ga0214499_12697111	3300032697	Switchgrass Phyllosphere	KIYKKNILKNTILYVHCVVLLMWSPTKFDFPFYDFSMIYYDFSKLL
Ga0214485_10158891	3300032698	Switchgrass Phyllosphere	HTILYVHCVDLLIWSLTQLDFPFYDFSVIYYDFSKLL
Ga0214494_10046261	3300032699	Switchgrass Phyllosphere	YTLVFFCCSFRSMLFFITVKKVLKHTILYDRCVDLLIWSPTQLNFSFYDFSVIYYDFSKL
Ga0314753_10428801	3300032757	Switchgrass Phyllosphere	SYGKKNILKHTILYVNCVDLLIRSLTQLDFLFSDFSVIYYDF
Ga0314733_10021994	3300032761	Switchgrass Phyllosphere	KLQQKNILKHIILYVHCVDLLIWSLTQLDFSFYDFSMIYYNFSKLFSGVI
Ga0314733_10047741	3300032761	Switchgrass Phyllosphere	IDLKLRQKNILKHTILYVNCVDLLIRSLTQLDFLFSDFSVIYYDF
Ga0314733_10835861	3300032761	Switchgrass Phyllosphere	LKHTILYVHCVDLLIWSSTQLDFLFYDFFMIYYDFSKLLYEVI
Ga0314725_10045791	3300032789	Switchgrass Phyllosphere	FRVMLFFIAVKNVLKHTTLYVHCVDLLIWSPTQLDFLFYDFFVIYYDFSKLL
Ga0314725_10236692	3300032789	Switchgrass Phyllosphere	QQKNILKHTILYVHCVDLLIWSLTQLDFLFYNFSVIYCDFSKLI
Ga0314744_10944821	3300032792	Switchgrass Phyllosphere	KHTILYVHCVDLLIWSLTQFDFLFYDFSVIYYDFSKLI
Ga0314735_11030901	3300032824	Switchgrass Phyllosphere	HTILYVDCVDLLIWSLTQLDFLFYDFSVIYYDFSKLL
Ga0314743_10443181	3300032844	Switchgrass Phyllosphere	TILYVHYVDLIMWSPTKLDFPFFDFSTIYYDFSKIQRK
Ga0314737_10344181	3300032875	Switchgrass Phyllosphere	HTILYVHCIDLLIWSPTQLDFLFYDFSVIYYNFFEITLGVI
Ga0314749_10786102	3300032915	Switchgrass Phyllosphere	LHYLYLLMWSPRKLNFSFYDFSVIYYNFLKLFYEIIDRF
Ga0314752_10511031	3300032976	Switchgrass Phyllosphere	LYIHCVDLLIWSLTQLDFSFYDFSVIYYNFLKLFYEIIDRF
Ga0314758_12236091	3300033525	Switchgrass Phyllosphere	MLFLHSCKKNVLKHTILYVHCIDLFIWSPTQLDFLFYDFSVIYYDFLKLR
Ga0314761_10820462	3300033526	Switchgrass Phyllosphere	ILYVDCVDLLIWSLTQLDFLFYDFSVIYYDFSKLV
Ga0314759_10679031	3300033535	Switchgrass Phyllosphere	LQQKNILKHIILYVHCVDLLIWSLTQLDFSFYDFSMIYYNFSKLFSGVI
Ga0314764_10209621	3300033540	Switchgrass Phyllosphere	KNVLKHTILYVHSVDLLIWSPTQLNFSFYDFSVIYYDFSKLL

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F026461

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences