Metagenome Family F026458

Basic Information
Family ID	F026458
Family Type	Metagenome
Number of Sequences	197
Average Sequence Length	47 residues
Representative Sequence	VDTDEKKKDRFFRGLSYILQEKLYTTNYQTFGAMMNAAIAMEGLQRDS
Number of Associated Samples	69
Number of Associated Scaffolds	197

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	16.41 %
% of genes near scaffold ends (potentially truncated)	47.21 %
% of genes from short scaffolds (< 2000 bps)	98.98 %
Associated GOLD sequencing projects	69
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.42

Most Common Taxonomy
Group	Unclassified (91.371 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere (97.969 % of family members)
Environment Ontology (ENVO)	Unclassified (98.477 % of family members)
Earth Microbiome Project Ontology (EMPO)	Host-associated → Plant → Plant surface (98.477 % of family members)

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 60.53% β-sheet: 0.00% Coil/Unstructured: 39.47%
Feature Viewer

Powered by Feature Viewer

Pfam ID	Name	% Frequency in 197 Family Scaffolds
PF03732	Retrotrans_gag	17.26
PF08284	RVP_2	10.15

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
All Organisms	root	All Organisms	8.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
cellular organisms	root	All Organisms → cellular organisms	8.63 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Eukaryota	superkingdom	All Organisms → cellular organisms → Eukaryota	7.61 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	1.02 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Opisthokonta	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta	5.58 %
Proteobacteria	phylum	All Organisms → cellular organisms → Bacteria → Proteobacteria	1.02 %
Viridiplantae	kingdom	All Organisms → cellular organisms → Eukaryota → Viridiplantae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Metazoa	kingdom	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa	5.58 %
Gammaproteobacteria	class	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria	1.02 %
Streptophyta	phylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Eumetazoa	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa	5.58 %
Enterobacterales	order	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales	1.02 %
Streptophytina	subphylum	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Bilateria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria	5.58 %
Yersiniaceae	family	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae	1.02 %
Embryophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Deuterostomia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia	5.58 %
Serratia	genus	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia	1.02 %
Tracheophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Chordata	phylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Euphyllophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Craniata	subphylum	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Spermatophyta	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Vertebrata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Magnoliopsida	class	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Gnathostomata	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Mesangiospermae	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Teleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Liliopsida	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Euteleostomi	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Petrosaviidae	subclass	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Sarcopterygii	superclass	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
commelinids	clade	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Dipnotetrapodomorpha	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poales	order	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Tetrapoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Amniota	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Sauropsida	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Sauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Archelosauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Archosauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Dinosauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Saurischia	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Theropoda	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Coelurosauria	clade	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Aves	class	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Palaeognathae	superorder	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Tinamiformes	order	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Tinamidae	family	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Tinamus	genus	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	91.37 %
Tinamus guttatus	species	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	5.58 %
Serratia marcescens	species	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	1.02 %
Poaceae	family	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	0.51 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300005718\|Ga0068866_11337422	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	522	Open in IMG/M
3300011119\|Ga0105246_10784460	Not Available	844	Open in IMG/M
3300014745\|Ga0157377_10815112	Not Available	689	Open in IMG/M
3300015267\|Ga0182122_1018885	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	726	Open in IMG/M
3300015267\|Ga0182122_1062199	Not Available	525	Open in IMG/M
3300015268\|Ga0182154_1018042	Not Available	737	Open in IMG/M
3300015268\|Ga0182154_1020409	Not Available	714	Open in IMG/M
3300015268\|Ga0182154_1039035	Not Available	603	Open in IMG/M
3300015268\|Ga0182154_1048653	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	567	Open in IMG/M
3300015269\|Ga0182113_1014330	Not Available	876	Open in IMG/M
3300015269\|Ga0182113_1048084	Not Available	623	Open in IMG/M
3300015269\|Ga0182113_1091702	Not Available	512	Open in IMG/M
3300015274\|Ga0182188_1032673	Not Available	596	Open in IMG/M
3300015275\|Ga0182172_1043373	Not Available	595	Open in IMG/M
3300015275\|Ga0182172_1056009	Not Available	553	Open in IMG/M
3300015275\|Ga0182172_1070942	Not Available	515	Open in IMG/M
3300015275\|Ga0182172_1076867	Not Available	501	Open in IMG/M
3300015276\|Ga0182170_1027940	Not Available	673	Open in IMG/M
3300015276\|Ga0182170_1048170	Not Available	579	Open in IMG/M
3300015276\|Ga0182170_1070837	Not Available	517	Open in IMG/M
3300015277\|Ga0182128_1019704	Not Available	743	Open in IMG/M
3300015277\|Ga0182128_1019858	Not Available	742	Open in IMG/M
3300015277\|Ga0182128_1032990	Not Available	648	Open in IMG/M
3300015277\|Ga0182128_1051780	Not Available	571	Open in IMG/M
3300015277\|Ga0182128_1054545	Not Available	562	Open in IMG/M
3300015277\|Ga0182128_1069626	Not Available	523	Open in IMG/M
3300015279\|Ga0182174_1024113	Not Available	725	Open in IMG/M
3300015282\|Ga0182124_1028904	Not Available	677	Open in IMG/M
3300015282\|Ga0182124_1031893	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	659	Open in IMG/M
3300015282\|Ga0182124_1035127	Not Available	642	Open in IMG/M
3300015282\|Ga0182124_1042513	Not Available	610	Open in IMG/M
3300015282\|Ga0182124_1048303	Not Available	589	Open in IMG/M
3300015283\|Ga0182156_1049798	Not Available	596	Open in IMG/M
3300015283\|Ga0182156_1064997	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	551	Open in IMG/M
3300015283\|Ga0182156_1071866	Not Available	534	Open in IMG/M
3300015285\|Ga0182186_1028233	Not Available	687	Open in IMG/M
3300015285\|Ga0182186_1031693	Not Available	666	Open in IMG/M
3300015286\|Ga0182176_1028325	Not Available	711	Open in IMG/M
3300015287\|Ga0182171_1004038	Not Available	1180	Open in IMG/M
3300015287\|Ga0182171_1017954	Not Available	788	Open in IMG/M
3300015287\|Ga0182171_1028856	Not Available	694	Open in IMG/M
3300015287\|Ga0182171_1032233	Not Available	674	Open in IMG/M
3300015287\|Ga0182171_1065469	Not Available	551	Open in IMG/M
3300015288\|Ga0182173_1026552	Not Available	704	Open in IMG/M
3300015288\|Ga0182173_1054823	Not Available	576	Open in IMG/M
3300015288\|Ga0182173_1063052	Not Available	553	Open in IMG/M
3300015289\|Ga0182138_1014620	Not Available	836	Open in IMG/M
3300015289\|Ga0182138_1062583	Not Available	559	Open in IMG/M
3300015291\|Ga0182125_1024055	Not Available	748	Open in IMG/M
3300015291\|Ga0182125_1054546	Not Available	594	Open in IMG/M
3300015291\|Ga0182125_1058732	Not Available	581	Open in IMG/M
3300015291\|Ga0182125_1083094	Not Available	523	Open in IMG/M
3300015292\|Ga0182141_1056884	All Organisms → cellular organisms → Eukaryota	585	Open in IMG/M
3300015294\|Ga0182126_1032994	Not Available	688	Open in IMG/M
3300015294\|Ga0182126_1033291	Not Available	686	Open in IMG/M
3300015294\|Ga0182126_1040577	Not Available	649	Open in IMG/M
3300015294\|Ga0182126_1079263	Not Available	533	Open in IMG/M
3300015295\|Ga0182175_1032556	Not Available	697	Open in IMG/M
3300015295\|Ga0182175_1034588	Not Available	686	Open in IMG/M
3300015295\|Ga0182175_1070837	Not Available	557	Open in IMG/M
3300015295\|Ga0182175_1083755	Not Available	529	Open in IMG/M
3300015296\|Ga0182157_1035041	Not Available	693	Open in IMG/M
3300015298\|Ga0182106_1022719	Not Available	786	Open in IMG/M
3300015298\|Ga0182106_1042947	Not Available	655	Open in IMG/M
3300015298\|Ga0182106_1050695	Not Available	624	Open in IMG/M
3300015298\|Ga0182106_1076424	Not Available	551	Open in IMG/M
3300015298\|Ga0182106_1086905	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	530	Open in IMG/M
3300015298\|Ga0182106_1096940	Not Available	512	Open in IMG/M
3300015298\|Ga0182106_1100997	Not Available	505	Open in IMG/M
3300015299\|Ga0182107_1015221	Not Available	881	Open in IMG/M
3300015299\|Ga0182107_1015856	Not Available	871	Open in IMG/M
3300015299\|Ga0182107_1023390	Not Available	782	Open in IMG/M
3300015299\|Ga0182107_1045262	Not Available	648	Open in IMG/M
3300015299\|Ga0182107_1080178	Not Available	546	Open in IMG/M
3300015302\|Ga0182143_1039787	Not Available	672	Open in IMG/M
3300015302\|Ga0182143_1082633	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	541	Open in IMG/M
3300015304\|Ga0182112_1013343	Not Available	913	Open in IMG/M
3300015304\|Ga0182112_1028701	Not Available	739	Open in IMG/M
3300015304\|Ga0182112_1059964	Not Available	598	Open in IMG/M
3300015304\|Ga0182112_1065239	Not Available	583	Open in IMG/M
3300015304\|Ga0182112_1094635	Not Available	521	Open in IMG/M
3300015304\|Ga0182112_1102865	Not Available	507	Open in IMG/M
3300015305\|Ga0182158_1039034	Not Available	674	Open in IMG/M
3300015305\|Ga0182158_1091550	Not Available	524	Open in IMG/M
3300015307\|Ga0182144_1039639	Not Available	680	Open in IMG/M
3300015307\|Ga0182144_1102327	Not Available	512	Open in IMG/M
3300015308\|Ga0182142_1071835	Not Available	583	Open in IMG/M
3300015308\|Ga0182142_1087032	Not Available	549	Open in IMG/M
3300015308\|Ga0182142_1117008	Not Available	500	Open in IMG/M
3300015314\|Ga0182140_1040586	Not Available	692	Open in IMG/M
3300015314\|Ga0182140_1101542	Not Available	524	Open in IMG/M
3300015314\|Ga0182140_1113920	Not Available	505	Open in IMG/M
3300015321\|Ga0182127_1058795	Not Available	637	Open in IMG/M
3300015321\|Ga0182127_1073961	Not Available	595	Open in IMG/M
3300015321\|Ga0182127_1112510	Not Available	519	Open in IMG/M
3300015322\|Ga0182110_1019635	Not Available	874	Open in IMG/M
3300015322\|Ga0182110_1109774	Not Available	523	Open in IMG/M
3300015323\|Ga0182129_1039782	Not Available	693	Open in IMG/M
3300015323\|Ga0182129_1102904	Not Available	522	Open in IMG/M
3300015341\|Ga0182187_1014863	Not Available	1201	Open in IMG/M
3300015341\|Ga0182187_1045704	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	842	Open in IMG/M
3300015341\|Ga0182187_1080878	Not Available	695	Open in IMG/M
3300015341\|Ga0182187_1083728	Not Available	686	Open in IMG/M
3300015341\|Ga0182187_1096795	Not Available	653	Open in IMG/M
3300015342\|Ga0182109_1057808	Not Available	827	Open in IMG/M
3300015342\|Ga0182109_1089913	Not Available	707	Open in IMG/M
3300015342\|Ga0182109_1109145	Not Available	659	Open in IMG/M
3300015342\|Ga0182109_1160014	Not Available	572	Open in IMG/M
3300015342\|Ga0182109_1204766	Not Available	519	Open in IMG/M
3300015342\|Ga0182109_1225881	Not Available	500	Open in IMG/M
3300015343\|Ga0182155_1213237	Not Available	513	Open in IMG/M
3300015344\|Ga0182189_1144895	Not Available	599	Open in IMG/M
3300015344\|Ga0182189_1159250	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae	578	Open in IMG/M
3300015345\|Ga0182111_1065663	Not Available	825	Open in IMG/M
3300015345\|Ga0182111_1093891	Not Available	725	Open in IMG/M
3300015345\|Ga0182111_1196378	Not Available	548	Open in IMG/M
3300015345\|Ga0182111_1204841	Not Available	539	Open in IMG/M
3300015346\|Ga0182139_1083779	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	757	Open in IMG/M
3300015346\|Ga0182139_1113767	Not Available	676	Open in IMG/M
3300015347\|Ga0182177_1129658	Not Available	646	Open in IMG/M
3300015347\|Ga0182177_1129822	Not Available	646	Open in IMG/M
3300015347\|Ga0182177_1194782	Not Available	553	Open in IMG/M
3300015347\|Ga0182177_1204418	Not Available	543	Open in IMG/M
3300015347\|Ga0182177_1238274	Not Available	511	Open in IMG/M
3300015351\|Ga0182161_1071993	Not Available	839	Open in IMG/M
3300015351\|Ga0182161_1131111	All Organisms → cellular organisms → Eukaryota	668	Open in IMG/M
3300015351\|Ga0182161_1185764	Not Available	582	Open in IMG/M
3300015351\|Ga0182161_1223167	Not Available	541	Open in IMG/M
3300015351\|Ga0182161_1242158	Not Available	523	Open in IMG/M
3300015355\|Ga0182159_1081020	Not Available	934	Open in IMG/M
3300015355\|Ga0182159_1135039	Not Available	758	Open in IMG/M
3300015355\|Ga0182159_1179560	Not Available	673	Open in IMG/M
3300015355\|Ga0182159_1206247	Not Available	634	Open in IMG/M
3300015361\|Ga0182145_1072902	Not Available	699	Open in IMG/M
3300015361\|Ga0182145_1074304	Not Available	694	Open in IMG/M
3300015361\|Ga0182145_1134051	Not Available	570	Open in IMG/M
3300015361\|Ga0182145_1141080	Not Available	560	Open in IMG/M
3300015361\|Ga0182145_1164564	Not Available	532	Open in IMG/M
3300015361\|Ga0182145_1176832	Not Available	519	Open in IMG/M
3300017404\|Ga0182203_1099208	Not Available	593	Open in IMG/M
3300017407\|Ga0182220_1016214	Not Available	842	Open in IMG/M
3300017407\|Ga0182220_1109997	Not Available	500	Open in IMG/M
3300017409\|Ga0182204_1061069	Not Available	618	Open in IMG/M
3300017410\|Ga0182207_1062799	Not Available	710	Open in IMG/M
3300017410\|Ga0182207_1139499	Not Available	545	Open in IMG/M
3300017410\|Ga0182207_1146155	Not Available	536	Open in IMG/M
3300017411\|Ga0182208_1063691	Not Available	628	Open in IMG/M
3300017411\|Ga0182208_1119673	Not Available	515	Open in IMG/M
3300017413\|Ga0182222_1059965	Not Available	587	Open in IMG/M
3300017415\|Ga0182202_1055509	Not Available	675	Open in IMG/M
3300017415\|Ga0182202_1062214	Not Available	651	Open in IMG/M
3300017415\|Ga0182202_1126297	Not Available	519	Open in IMG/M
3300017417\|Ga0182230_1095165	Not Available	547	Open in IMG/M
3300017420\|Ga0182228_1090962	Not Available	571	Open in IMG/M
3300017420\|Ga0182228_1107114	Not Available	539	Open in IMG/M
3300017424\|Ga0182219_1051938	Not Available	684	Open in IMG/M
3300017424\|Ga0182219_1056046	Not Available	668	Open in IMG/M
3300017424\|Ga0182219_1135338	Not Available	508	Open in IMG/M
3300017425\|Ga0182224_1046745	Not Available	749	Open in IMG/M
3300017425\|Ga0182224_1093933	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	604	Open in IMG/M
3300017425\|Ga0182224_1134521	Not Available	538	Open in IMG/M
3300017425\|Ga0182224_1142006	Not Available	529	Open in IMG/M
3300017427\|Ga0182190_1026499	Not Available	927	Open in IMG/M
3300017427\|Ga0182190_1058077	Not Available	717	Open in IMG/M
3300017427\|Ga0182190_1110940	Not Available	577	Open in IMG/M
3300017427\|Ga0182190_1118176	Not Available	565	Open in IMG/M
3300017427\|Ga0182190_1129752	Not Available	547	Open in IMG/M
3300017430\|Ga0182192_1034056	Not Available	875	Open in IMG/M
3300017430\|Ga0182192_1068128	All Organisms → cellular organisms → Eukaryota	694	Open in IMG/M
3300017430\|Ga0182192_1121762	Not Available	569	Open in IMG/M
3300017430\|Ga0182192_1151781	Not Available	526	Open in IMG/M
3300017433\|Ga0182206_1132200	Not Available	534	Open in IMG/M
3300017438\|Ga0182191_1078370	Not Available	668	Open in IMG/M
3300017438\|Ga0182191_1089587	Not Available	639	Open in IMG/M
3300017442\|Ga0182221_1049408	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	737	Open in IMG/M
3300017442\|Ga0182221_1063007	Not Available	684	Open in IMG/M
3300017442\|Ga0182221_1082389	Not Available	631	Open in IMG/M
3300017443\|Ga0182193_1035004	Not Available	891	Open in IMG/M
3300017443\|Ga0182193_1092116	Not Available	654	Open in IMG/M
3300017443\|Ga0182193_1147641	Not Available	557	Open in IMG/M
3300017682\|Ga0182229_1083986	Not Available	555	Open in IMG/M
3300017683\|Ga0182218_1020690	Not Available	916	Open in IMG/M
3300017683\|Ga0182218_1050190	Not Available	708	Open in IMG/M
3300017683\|Ga0182218_1108619	Not Available	561	Open in IMG/M
3300017683\|Ga0182218_1114506	Not Available	552	Open in IMG/M
3300017683\|Ga0182218_1132121	All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Yersiniaceae → Serratia → Serratia marcescens	527	Open in IMG/M
3300017684\|Ga0182225_1071285	Not Available	626	Open in IMG/M
3300017684\|Ga0182225_1135840	Not Available	512	Open in IMG/M
3300017684\|Ga0182225_1142333	Not Available	505	Open in IMG/M
3300017685\|Ga0182227_1089143	Not Available	589	Open in IMG/M
3300017685\|Ga0182227_1101039	Not Available	562	Open in IMG/M
3300017686\|Ga0182205_1062424	All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Palaeognathae → Tinamiformes → Tinamidae → Tinamus → Tinamus guttatus	704	Open in IMG/M
3300017689\|Ga0182231_1081628	Not Available	617	Open in IMG/M
3300017690\|Ga0182223_1027071	Not Available	762	Open in IMG/M
3300021060\|Ga0182232_1086686	Not Available	508	Open in IMG/M

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
Ga0068866_113374221	3300005718	Miscanthus Rhizosphere	VDTDEKKRDRFYRGLSCSLQKELYTGNYQTFGAMMNAAIAMEGLQQDS*
Ga0105246_107844603	3300011119	Miscanthus Rhizosphere	VDTDGKKKDRFFHGLSSILQEKLYTVNYQTFGALMNAAIAMEGFQWES*
Ga0157377_108151122	3300014745	Miscanthus Rhizosphere	VDTDEKKRDRFYRGLSCSLQKELYTGNYQTLGAMMNAVIAMEGL*
Ga0182122_10188853	3300015267	Miscanthus Phyllosphere	VDTDEKKKDRFFHGLSYILQEKLYTANYQTFGAMMNAAIAMEGL*
Ga0182122_10621992	3300015267	Miscanthus Phyllosphere	VDSDDKKKDRFFHGLAPILQEKLYTANYETFEALMNAAIAMEGFQRES*
Ga0182154_10180421	3300015268	Miscanthus Phyllosphere	VDTDDKKDRFFCGLASILQEKLYTVNYQTFGALMNAAIAMEGFQRES*
Ga0182154_10204092	3300015268	Miscanthus Phyllosphere	VDTDEKKKDRFFHGLSYILQEKLYTKNYQTFGALKNATIAMEGLQWDS*
Ga0182154_10390352	3300015268	Miscanthus Phyllosphere	VDTDDRKRERFFHGLAPLLQEKLYTANYQTFGALMNVAIAIEGF*
Ga0182154_10486532	3300015268	Miscanthus Phyllosphere	VDTDEKKMDRFNRGLSCILQEKLYTGGYQTFGALMNAAIAMEGL*
Ga0182113_10143303	3300015269	Miscanthus Phyllosphere	VDTDDKKKDRFFRGLTLVLQEKLYLGNYQTFGALMNAAIALEGFQRASQADWK
Ga0182113_10480842	3300015269	Miscanthus Phyllosphere	VDTNDKKKDRFFCGLSSILQEKLYTTNYQTFGALKNAAIAMEGFQEES*
Ga0182113_10853861	3300015269	Miscanthus Phyllosphere	VDTDEKKRDHFYHGLSCSLQKELYTGNYETFGAMMNAAIAMEGL*
Ga0182113_10917021	3300015269	Miscanthus Phyllosphere	VGTHVDTDEKKRDRFYRGLSCSLQKELYTGNYQTFGAMMNATIAMEGLRWDS*
Ga0182188_10326731	3300015274	Miscanthus Phyllosphere	VDTDEKKNDHFFCCLSYILQEKLYTANYQTFGTLMNAAIAMEGLQWD
Ga0182172_10433732	3300015275	Miscanthus Phyllosphere	MDEKKRDHFYRGLSFILQKELYTGNYQTFGVMMNAAIAMEGLQRDS*
Ga0182172_10560091	3300015275	Miscanthus Phyllosphere	VDTNEKKKVRFYRGLSYILQEKLYTGNYQTFRAMMNAAITMEGLQRDSQA*
Ga0182172_10709421	3300015275	Miscanthus Phyllosphere	VDTDEKKDRFYRGLSYILQEKLYTGTYQTFRAMMNAAITMEGLQRDSQA*
Ga0182172_10768671	3300015275	Miscanthus Phyllosphere	VDTDEKKKDRFFHGLSYILQEKLYTTKYQTFEALMNTAIAMEG
Ga0182170_10279402	3300015276	Miscanthus Phyllosphere	VDTDEKMDSFNHGLSCILQEKLYIGGYQTFGASMNAAIAMEGIQRDS*
Ga0182170_10481701	3300015276	Miscanthus Phyllosphere	VDTDDRKREHFFRGLAPLLQEKLYMTNYQTFGALMNAAIALEGF*
Ga0182170_10708372	3300015276	Miscanthus Phyllosphere	YNGTHVDTDEKKRDYFYRGLSCSLQKELYTGNYQTFGAMMNASIAMEGLQRDS*
Ga0182128_10197042	3300015277	Miscanthus Phyllosphere	VDTNEKKKDRFFRGLSYILQEKLYTANYQTFEALMNAAIAMEGLQRDS*
Ga0182128_10198581	3300015277	Miscanthus Phyllosphere	MDEKKRDRFFRGLAPPLQEKLYLGNYQTFGALMNAAIALEGFQRAS*
Ga0182128_10329901	3300015277	Miscanthus Phyllosphere	VDTDEKKKDRFFHGLSYILQEKLYTVNYQTFGALMN
Ga0182128_10517801	3300015277	Miscanthus Phyllosphere	HVGTDEKKRDHFYRGLSCILQKELYTGNYQTFGAMMNAAIAMEGLQ*
Ga0182128_10545452	3300015277	Miscanthus Phyllosphere	VDTDEKKRDRFYRDLSCSLQKQLYTENYQTFGAMMNAAIAIEGLRRDS*
Ga0182128_10696261	3300015277	Miscanthus Phyllosphere	HVGTDEKKRDHFYRGLSCILQKELYTGNYQTFGAMMNAAIAIKGLQ*
Ga0182174_10241131	3300015279	Miscanthus Phyllosphere	VDIDEKKRDRFYRGLSCSLQKELYTGNYQTFGAMMNAAITMEGLQ*
Ga0182124_10289042	3300015282	Miscanthus Phyllosphere	QYAGIYVDSDDKKKDCFFRGLAPILQEKLYTANYQTFGALMNAAIAMEGFQRES*
Ga0182124_10318931	3300015282	Miscanthus Phyllosphere	NEKKWDHFYRGLSCSLQNELYSRNYQTFGALMNAAIAMEGLQRDS*
Ga0182124_10351271	3300015282	Miscanthus Phyllosphere	DIDEKMDRFNRGLSCILKEKLYTRDYQTFGALMNAAIAMEGL*
Ga0182124_10425131	3300015282	Miscanthus Phyllosphere	VDTDEKKRDHFYRGLSCSIQKELYTGNYQTFGAMMNAAIAMEGL*
Ga0182124_10483032	3300015282	Miscanthus Phyllosphere	DEKKKDHFYRGLSYILQEKLYTGNYPTFRAMMNAAIAMEGL*
Ga0182156_10497982	3300015283	Miscanthus Phyllosphere	IHVDTDEKKKDRFFRGLSYLLQEKLYMVNYQTFGALMNVVIAMEGLQQDS*
Ga0182156_10649971	3300015283	Miscanthus Phyllosphere	VDTDEKKRDRFYRGLSCSLQKELYTGNYQTFGAMMNDAIAMEGLQQDS*
Ga0182156_10718661	3300015283	Miscanthus Phyllosphere	HVDTDGKKRDRFYRGLSCSLQKELYTGNYQTFGVMMNAAIAMEGLQRDS*
Ga0182186_10282331	3300015285	Miscanthus Phyllosphere	VDTDEKKKDRFYRGLSYILQKKLYTGNYQTFGAKMNAAITLEGLQQES*
Ga0182186_10316932	3300015285	Miscanthus Phyllosphere	VDTDEKKERFFHCLSYILQEKLYTVNYQTFGALMNAAIAMEGFQRES*
Ga0182176_10283251	3300015286	Miscanthus Phyllosphere	VDTDDKMKDRFFRGLSSILQEKLYMVNYQTFRALMNVAIAMEGLQRDS*
Ga0182171_10040381	3300015287	Miscanthus Phyllosphere	MDTNEKKMDRFNRGLSCILQEKLYTGGYQTFGALMGAAIAMEGLQRDS*
Ga0182171_10179541	3300015287	Miscanthus Phyllosphere	VDTDGKKKDCFFRGLSSILQEKLYTANYQTFGALMNATIAMEGF*
Ga0182171_10288561	3300015287	Miscanthus Phyllosphere	EKKKDHFFRSLSYILQEKLYTTNYQTFRAMMNATVTMEGLQRDS*
Ga0182171_10322331	3300015287	Miscanthus Phyllosphere	MDEKKRDHFYRGLSYNLQKELYTRNYQSFRAMMNAAIAMEGLQRDS*
Ga0182171_10654691	3300015287	Miscanthus Phyllosphere	VDTDEKKMDHFNHGLSCILQEKLYTGGYQTFGALMNATIAIEGLQHDSRAE*
Ga0182173_10265522	3300015288	Miscanthus Phyllosphere	VDTDDKKKDRFFRGLSSILQEKLYMVNYQTFGALMNAAIAMEGF*
Ga0182173_10548232	3300015288	Miscanthus Phyllosphere	VDTDEKKRDRFYHGLSCSLQKELYTGNYQTLGAMMNAVIAMEGL*
Ga0182173_10630521	3300015288	Miscanthus Phyllosphere	MDTNEKKMDRFNCGLSCILQEKLYTGGYQTFGALMNAAIAMEGLQHDS*
Ga0182138_10146202	3300015289	Miscanthus Phyllosphere	DTDEKKKDHFYHGLSYILQEKLYTTNYLTFGAMMNAAIAMEGLQRDS*
Ga0182138_10625831	3300015289	Miscanthus Phyllosphere	IHVDTDEKKRDHFYRGLACSMQKELYIGNYQTFGALMNAAITMEGLQRDS*
Ga0182125_10240552	3300015291	Miscanthus Phyllosphere	VDTDKKKKNRFFRGLSYILQEKLYTANYQTFGAMMNAAIAMEGL*
Ga0182125_10451531	3300015291	Miscanthus Phyllosphere	VDTDEKKRDHFYHNLSCNLQKELYTRNYQTFGAMMNA
Ga0182125_10545461	3300015291	Miscanthus Phyllosphere	VDTDEKKKDRFFRGLSFILKEKLYMANYQTFGALMNAAIAMEGLQRDFQ
Ga0182125_10587323	3300015291	Miscanthus Phyllosphere	VDTDDKKKDCFFRGLAPILQEKLYTANYQTFGALMNTIIAIEGF*
Ga0182125_10830941	3300015291	Miscanthus Phyllosphere	DDKKKDRFFRGLAPILQEKLYMANYQTFGALMNAAIAMEGFQRES*
Ga0182141_10568841	3300015292	Miscanthus Phyllosphere	VNTDEKKMDRFNHGLSCILQEKLYTGGYLTFGALMNAAIAVEGLSA*
Ga0182126_10329941	3300015294	Miscanthus Phyllosphere	IYVDTNEKKDRFYRGLSYILQEKLYTGSYQTFRAMMNAAIAMEGL*
Ga0182126_10332911	3300015294	Miscanthus Phyllosphere	VDSDDKKKDHFFRGLAPILQEKLYTMKYQTFGALMNASIAMEGF*
Ga0182126_10405772	3300015294	Miscanthus Phyllosphere	VDTKDKKKDHFFCGLSSILQEKLYTVNYQTFGVMMNTTIAMEGLQRDS*
Ga0182126_10792631	3300015294	Miscanthus Phyllosphere	RFFHGLSYILQEKLYTVNYQTFGALMNVAITMEGLQQDS*
Ga0182175_10325561	3300015295	Miscanthus Phyllosphere	VDTNEKKRDHFYRGLSCILQKELYTGNYQTFGAMMNAAIAIKGLQ
Ga0182175_10345881	3300015295	Miscanthus Phyllosphere	EKKMDPFNRGLSCIMQEKLYTGGYQTFGALMNAAIAIEGLQHDS*
Ga0182175_10708372	3300015295	Miscanthus Phyllosphere	VDTDDKKKDHFFRGLSSILQEKLYTVNYQTFRALMNAAIAMEGF*
Ga0182175_10837551	3300015295	Miscanthus Phyllosphere	VDTDEKKKDRFFRGLSYILQEKLYTTNYQTFGAMMNAAIAMEGLQRDS*
Ga0182157_10350411	3300015296	Miscanthus Phyllosphere	DHFYRGLSCNLQKELYTGNYQTFRAMMNAAIAMEGLQWDS*
Ga0182106_10227191	3300015298	Miscanthus Phyllosphere	HTDEKKRDSFYHGLSCILQNELYTRGYQTFGALMNIAIAMEGLQRDS*
Ga0182106_10429472	3300015298	Miscanthus Phyllosphere	SQVDTDDKKKDSFFHGLTPALQEKLYLGNYQTFGAMMNTAIAIEGFQWASQAD*
Ga0182106_10506953	3300015298	Miscanthus Phyllosphere	VDTDDKKKDRFFRGLSSILQEKLYTVNYQTFGALMNTAIAMEGFQRESQAEW
Ga0182106_10764241	3300015298	Miscanthus Phyllosphere	VDTDDKKKDRFFRDLSSILQEKLYMANYQTFGALMNAAIAMEEFQWES*
Ga0182106_10869051	3300015298	Miscanthus Phyllosphere	VDTDEKKRDRFYRGLSYNLQERLYTRDYQTFRAMMNVAITGEGL*
Ga0182106_10969401	3300015298	Miscanthus Phyllosphere	VDIDEKKRDHFYRGLSCILQKELYTGNYQTFGAMMNAAIA
Ga0182106_11009972	3300015298	Miscanthus Phyllosphere	VDTDEKKKDCFYHSLSYILKEKLYTGNYQTFGAMMNAAIAMEGLQWDF*
Ga0182107_10152213	3300015299	Miscanthus Phyllosphere	VAIDEKKRDRFYHGLSCSLQEKLYTRNYQTFGAMMNAAIAMEGLQRDSQA*
Ga0182107_10158562	3300015299	Miscanthus Phyllosphere	VDSDDKKKDRFFRGLAPILQEKLYMANYQTFGALMNATIAMEGF*
Ga0182107_10233901	3300015299	Miscanthus Phyllosphere	DTDDKKKDRFFHGLSSILQEKLYTTNYQAFGALMNTAIAMEGFQRES*
Ga0182107_10452621	3300015299	Miscanthus Phyllosphere	VDTDDKKKDCFFRGLSSNLQEKLYTVNYQTFGALMNIAIAMEGFQRESQAEWK
Ga0182107_10801782	3300015299	Miscanthus Phyllosphere	VDTDEKKMGHFNRGLSCILQEKLYTEGYQTFGALMNAAIAMEELQRHS*
Ga0182143_10397871	3300015302	Miscanthus Phyllosphere	VDTDEKKKDRFFRGLSYILQEKKYMVNYQTFGALMNAVITMEGL*
Ga0182143_10826332	3300015302	Miscanthus Phyllosphere	VDTDEKKRDRFYRGLSYNLQEKLYIGNYQTFGAMINAAIAIEGLQRDSQAEWK*
Ga0182112_10133432	3300015304	Miscanthus Phyllosphere	VDFDDKKKDCFFRGLALILQEKMYTTNYQTFGALMSVAIAMEGFQRES*
Ga0182112_10287011	3300015304	Miscanthus Phyllosphere	GTHIDTEGKKRDHFYRGLSCSLQKELYTRNYQTFGAMMNAAIAMEGLQRDS*
Ga0182112_10599641	3300015304	Miscanthus Phyllosphere	TDEKMDRFNCGLSCTLQEKLYTGGYQTFGALMNAAIAMERL*
Ga0182112_10652391	3300015304	Miscanthus Phyllosphere	VDTDGKKKDRFFHGLSSILQEKLYTVNYQTFRALMNAAIAMEGFL*
Ga0182112_10946352	3300015304	Miscanthus Phyllosphere	RFYRGLSCSLQKELYNLNYQTFGVMMNVAIAMEGLQRDS*
Ga0182112_11028651	3300015304	Miscanthus Phyllosphere	VYTDEKKDYFFHGLSYILQEKLYTMNYQTFRALMNAAIAMEGLQRDS*
Ga0182158_10390342	3300015305	Miscanthus Phyllosphere	VDTDDKKKDHFFHGLAPLLQEKIYTANYQTFGALMNAAIAMEGFQQES*
Ga0182158_10915501	3300015305	Miscanthus Phyllosphere	GTHVDTDEKKRDRFYHGLSCSRQKELYTRNYQTFGVMMNAAIAMEGLQRDS*
Ga0182144_10396393	3300015307	Miscanthus Phyllosphere	VDTDDKKRDRFFRGLTPALQEKLYLGNYQTFGALINAAIALEGF
Ga0182144_11023271	3300015307	Miscanthus Phyllosphere	DRFNCGLSCILQEKLYTGGYQTFGALMNAAIAMEGLQHDS*
Ga0182142_10718351	3300015308	Miscanthus Phyllosphere	VDIDEKMDRFNRGLSCIFKEKLYTGGYQTFGALMYAVIAMEGL*
Ga0182142_10870321	3300015308	Miscanthus Phyllosphere	KDRFFCGLSYIFQEKLYTANYQTFGALMNAAITMEGLQRDS*
Ga0182142_11170081	3300015308	Miscanthus Phyllosphere	YAGSQVDTDDKKRELFFRGLAPLLQEKLYTANYQTFGALMNAAIAMEGFQRES*
Ga0182140_10405861	3300015314	Miscanthus Phyllosphere	DGLRQQVQHTDEKKRDRFYCGLSCILQKELYTGNYQTFGAMMNAAIAMESLQQDS*
Ga0182140_11015422	3300015314	Miscanthus Phyllosphere	VDTDDKKKDRFFHGLSSILQEKLYTANYQTFGALMNAAIAM
Ga0182140_11139201	3300015314	Miscanthus Phyllosphere	VDTDEKKRDRFYRGLSCSLKEKLYTGNYQTFKAMMNAAIAIEGLQRDSQ
Ga0182127_10587951	3300015321	Miscanthus Phyllosphere	VDTDEKKKDHFYRGLSYILQEKLYTGNYQTLGAKMNAAIAMEGLQRDS*
Ga0182127_10739611	3300015321	Miscanthus Phyllosphere	IHVDTNDKKKDRFFRGLSPILQEKLYTVNYQTFGALMNAVIAMEGFQRES*
Ga0182127_11125101	3300015321	Miscanthus Phyllosphere	VDTDDKKKDRFFHGLSPILQEKLYTANYQTFGALMNAAIALEGFQRES*
Ga0182110_10196351	3300015322	Miscanthus Phyllosphere	VDTDEKKDRFYRGLSYILLEKLYTGNYPTFGAMMNAAIAMEGLQRES*
Ga0182110_11097742	3300015322	Miscanthus Phyllosphere	VDTNDKKKDRFFCGLSSILQEKLYTANYHTFGALMNTAIAMEGF*
Ga0182129_10397821	3300015323	Miscanthus Phyllosphere	VDTDEKKKEHFFHDLSYILQEKLYTANYQTFEALMNAAIAMEGLQRDS*
Ga0182129_11029041	3300015323	Miscanthus Phyllosphere	VDTDDKKKNRFFRGLSSILQEKLYTTNYQTFRALMNAAITME
Ga0182187_10148632	3300015341	Miscanthus Phyllosphere	VDTDDKKKDRFFRGLSSILQEKLYTVNYQTFRALMNAAIAMEGFL*
Ga0182187_10457041	3300015341	Miscanthus Phyllosphere	MDEKKRDHFYRGLSCILQKELYTENYQTFGAMMNAAIAMEGLQRYS*
Ga0182187_10808782	3300015341	Miscanthus Phyllosphere	VDTDKKKKDCFFRGLSYILQEKLYTVNYQTFGAMMNAAIAMEGLQRDS*
Ga0182187_10837282	3300015341	Miscanthus Phyllosphere	VDTDEKKKDRFFHGLSYILHEKLYMANYQTFGALMNAAIAMEGF*
Ga0182187_10967951	3300015341	Miscanthus Phyllosphere	VYTDEKKDHFYRGLSYILQEKLYTGNYLTFGAMMNAAIAMEGLQQNS*
Ga0182109_10578082	3300015342	Miscanthus Phyllosphere	VDTDDRKRECFFRGLAPLLQEKLYTANYQTFGALMNAAIAIEGFQRES*
Ga0182109_10899131	3300015342	Miscanthus Phyllosphere	VDTDEKKKDRFFCGLSYILQEKLYTTNYQTFGALMNATIAMEGLQWDS*
Ga0182109_11091451	3300015342	Miscanthus Phyllosphere	THIDTDEKKRDCFYHGLSCSLQKELYIGNYQTFGAMMNAAIAMEGL*
Ga0182109_11600141	3300015342	Miscanthus Phyllosphere	HVETNEKKMDCFNHGLSCILQEKLYTGGYHTFGALMNAAIAMDGLQRDSQAE*
Ga0182109_12047661	3300015342	Miscanthus Phyllosphere	RRDHFYRGLSCILQKELYTGGYQTFGALMNAAIAMEGL*
Ga0182109_12258811	3300015342	Miscanthus Phyllosphere	DTCEKKRDRFYCGPSCSLSKELYTGNYQTFGAMMNAAIAMESLQQDS*
Ga0182155_12132371	3300015343	Miscanthus Phyllosphere	TDEKKMDRFNHGLSCILQEKLYTGGYQTFGALMNAAIAMEGLQRDS*
Ga0182189_11448951	3300015344	Miscanthus Phyllosphere	MDEKKRDRFYRGLSCSLQEKLYTGNYQIFGAMMNAAIAMEGLQWDS*
Ga0182189_11592502	3300015344	Miscanthus Phyllosphere	VDTDKKKKDRFFHGLSYILQEKLYTVNYQTFGAMMNAAIAMEGLQQDS*
Ga0182111_10656632	3300015345	Miscanthus Phyllosphere	VDINEKKKDRFFCGLSYRLQEKLYTMNYQTFRAMMNAAIAMECL*
Ga0182111_10938912	3300015345	Miscanthus Phyllosphere	VDSDDKKKDCFFRGLAPILQEKLYMANYQTFGALMNAAIAMEGFQRES*
Ga0182111_11963781	3300015345	Miscanthus Phyllosphere	VDTDEKKRDYFYRGLSCSLHKELYTGNYQTFGAMMNAAIAMEGLQHDS*
Ga0182111_12048411	3300015345	Miscanthus Phyllosphere	VDTDKKKDRFFCGLSYILQEKLYTKNYQTFGALKNATIAMEGLQWDS*
Ga0182139_10837791	3300015346	Miscanthus Phyllosphere	VDTDDKKKDRFFRGLSPILQEKLYKANYQTFGAIINAAITMEGL*
Ga0182139_11137672	3300015346	Miscanthus Phyllosphere	VDTDEKKKDRFYHDLSYILQEKLHTTNYQTFRAMMNAAITMEGLQRDS*
Ga0182177_11296582	3300015347	Miscanthus Phyllosphere	VDTDEKKMDHFNHGLSCILQEKLYIGGYQTFGALMNTAIAMEGLQRDS*
Ga0182177_11298221	3300015347	Miscanthus Phyllosphere	VDTDEKKMDHFNHGLSCTLQEKLYTGGYQTFGALMNAIIAMEGL*
Ga0182177_11947821	3300015347	Miscanthus Phyllosphere	YAWTHVDTDEKKRDRFYRGLSWSLQKELYTRNYQTFGAMMNAAIAMEGL*
Ga0182177_12044182	3300015347	Miscanthus Phyllosphere	VGSQVDTDDRKRERFFCGLAPLLQEKLYTANYQTFGALMNAAIAMKGFQ*
Ga0182177_12382741	3300015347	Miscanthus Phyllosphere	VDTDDRKRERFFRGLAPLLQEKLYTANYQTFGALMNAAIAIEGFQ
Ga0182161_10719932	3300015351	Miscanthus Phyllosphere	VETDDKKKDRFFHGLAPLLQEKLYTANYQTFGALMNAAIAIKGF*
Ga0182161_11311112	3300015351	Miscanthus Phyllosphere	VDNDDKKKDHFFRGLSSILQEKLYMANYQTFGALMNAAI
Ga0182161_11857642	3300015351	Miscanthus Phyllosphere	TDEKKRDRFYRGLSCILQKELYTGGYQTFDALMNAAIAMEGL*
Ga0182161_12231671	3300015351	Miscanthus Phyllosphere	KKRDRFYRVLSCSLQKELYTKNYQTFGAMMNAAITIEGLQRDSQGEWKCK*
Ga0182161_12421581	3300015351	Miscanthus Phyllosphere	VDNNEKKKDRFFRGLSYILQKKLYTANYQTFGALMNIAITMEGLQRDS*
Ga0182159_10810201	3300015355	Miscanthus Phyllosphere	SQVDTDDRKREHFFRGLAPLLQEKLYTTNYQTFGALMNAAIAIEGFQRQS*
Ga0182159_11350391	3300015355	Miscanthus Phyllosphere	VDTDEKKKDGFFCGLSYILQEKLYTANYQTFRAMMNTAIAMEGLQRDS*
Ga0182159_11795602	3300015355	Miscanthus Phyllosphere	MDRFNRGLSCILQEKLYTGGYQTFGALMNAAIAMEGLQHDSQAKWK
Ga0182159_12062471	3300015355	Miscanthus Phyllosphere	VDTDEKKKDRFYRGLSYILQEKLYTGTYQTFGAMTNVAIDMEGLQRDSQAEWKRK
Ga0182145_10729021	3300015361	Miscanthus Phyllosphere	VDTDDKKKDRLFRGLTPALQEKLYLGNYQTFGALMNAAIALKGFQR
Ga0182145_10743041	3300015361	Miscanthus Phyllosphere	KRDHFYRGLSCILQKELYIGNYQTFGAMMNAAIAMEGLQRDS*
Ga0182145_11340511	3300015361	Miscanthus Phyllosphere	KRDRFYRGLSYSLQKELYTGNYQTFGAMMNAVIAMEGLQHDS*
Ga0182145_11410801	3300015361	Miscanthus Phyllosphere	QYAGIHVDTDDMKKDHFFRGLSSILQEKLYTANYQTFGALMNATIAMEGFQQES*
Ga0182145_11645641	3300015361	Miscanthus Phyllosphere	VDTDEKKKDRFFCGLSYILQEKLYMANYQTLGALMNATITMEGL*
Ga0182145_11768321	3300015361	Miscanthus Phyllosphere	VDTDEKIDWFNRGLSCILQEKLYTGGYQTFGALMNVAIAMEGLQRDTQVE*
Ga0182203_10992081	3300017404	Miscanthus Phyllosphere	VDTNEKKMDHFNRGLSCILQEKLYTGSYQTFSALMNAAIAMEGLQRDS
Ga0182220_10162142	3300017407	Miscanthus Phyllosphere	VDSDDKKKDRFFCGLAPILQEKLYTANYQTFGALMNAAIAMEGF
Ga0182220_11099971	3300017407	Miscanthus Phyllosphere	VDTDDKKKDCFFRGLTPVLQEKLYLGNYQTFRALMNAAIAL
Ga0182204_10610692	3300017409	Miscanthus Phyllosphere	DNKKKDRFFHGLSSILQEKLYTVNYQTFGALMNAAIAMEGFQWES
Ga0182207_10627991	3300017410	Miscanthus Phyllosphere	VDTDEKKKDRFFCGLSYILQEKLYMANYQTLGALMNATITMEGL
Ga0182207_11394991	3300017410	Miscanthus Phyllosphere	VDTDDKKKDRFFHDLSSILQENLYTANYQTFGALMNAAIAMEGLQRDS
Ga0182207_11461551	3300017410	Miscanthus Phyllosphere	HVDTDEKKRDRFYRVLSCSQQKELYTGNYQTFGAMMNAAIAMEGLQ
Ga0182208_10636911	3300017411	Miscanthus Phyllosphere	VDTDDKKKDHFFRGLSTILWEKLYTANYQTFRALMNATIAMEGFQRESQAE
Ga0182208_11196731	3300017411	Miscanthus Phyllosphere	VIHVDTNDKKKDRFFRGLSPILQEKLYTVNYQTFGALMNAVIAMEGFQRES
Ga0182222_10599652	3300017413	Miscanthus Phyllosphere	VDTDEKKKDRFFRGLSYILQEKLYTANYLTFEALMNADIAMDGLQQDS
Ga0182202_10555091	3300017415	Miscanthus Phyllosphere	IDEKKRDHFYRGLSSILQKELYTWNYQTFGAMMNAAIAMEGLQRDS
Ga0182202_10622141	3300017415	Miscanthus Phyllosphere	RDYFYHGLSCSLQKELYTGNYQTFGAMMNAAITIGLQRDSRA
Ga0182202_11262971	3300017415	Miscanthus Phyllosphere	AGTHVDTDEKKRYSFYHDLSCNLQKELYIGNYQTFGAMMNAAIAMQGLQRDS
Ga0182230_10951651	3300017417	Miscanthus Phyllosphere	VDTNEKKKDRFFHGISYILQEKLYTANCQTFGALMNAAIAMEGLQRDSLAEWKRKR
Ga0182228_10909621	3300017420	Miscanthus Phyllosphere	EKKRGRFYRGLSCSLQKEIYTGNYQTFGAMMNVAITMEGLQQDS
Ga0182228_11071141	3300017420	Miscanthus Phyllosphere	QVDTDDKKKDRLFRGLTPALQEKLYLGNYQTFGAMMNAAIAVEGF
Ga0182219_10519382	3300017424	Miscanthus Phyllosphere	GIHVDTDEKKRGRFYRGLSCSVHKELYTGNYQTFGAMMNVAIAMEGL
Ga0182219_10560461	3300017424	Miscanthus Phyllosphere	DSDDKKKDRFFHGLAPIFQEKLYTANYQTFGALMNAAIAMEYFQRES
Ga0182219_11353381	3300017424	Miscanthus Phyllosphere	VDIDEKKMDHFNRGLSCILQEKLYTGGYQTFGALMNVAIAMEGL
Ga0182224_10467451	3300017425	Miscanthus Phyllosphere	AGIHVDTDDKKKDCFFHSISAIFQEKLYTENYQTFGALMNAAIAMEGFQRES
Ga0182224_10939333	3300017425	Miscanthus Phyllosphere	VDTDEKKKDRFFRGLSYILQEKLYTTNYQTFGAMMNAAIAMEGLQRD
Ga0182224_11345212	3300017425	Miscanthus Phyllosphere	VDTDEKKRDHFYRGLSCILQKELYTGNYQTFGVMMNAAIAMEGLQRDS
Ga0182224_11420061	3300017425	Miscanthus Phyllosphere	KKDHFFRGLSYILQGKMYTANYQTFWALMNAAIAMEGLQRDS
Ga0182190_10264993	3300017427	Miscanthus Phyllosphere	DTDEKKMDRFNSDLSCILQEKLYTGGYQTFGALMNAAIAMEGLQRDS
Ga0182190_10580772	3300017427	Miscanthus Phyllosphere	VDTDEKKERFFHCLSYILQEKLYTVNYQTFGALMNAAIAMEGFQRES
Ga0182190_11109402	3300017427	Miscanthus Phyllosphere	DTNEKNMDHFNRGLLCILQEKLYARGHQTFGALMNAAIAMEGLQRDSG
Ga0182190_11181761	3300017427	Miscanthus Phyllosphere	KKMDRFNRGLSCILQEKLYTGGYQTFGALMNASIAMEGLQRDS
Ga0182190_11297521	3300017427	Miscanthus Phyllosphere	IHVDMDDKKKDHFFCGLAPILQEKLYTANYQTSGALMNATIAMEGYQRDS
Ga0182192_10340562	3300017430	Miscanthus Phyllosphere	VYTDEKKDYFFHGLSYILQEKLYTTKYQTFEALMNTAIAMEGLQWDS
Ga0182192_10681281	3300017430	Miscanthus Phyllosphere	VDTDEKKMDRFNHGLSCILQEKLYTGGYQTFGALMNAAIAMEGLQRDSQAE
Ga0182192_11217621	3300017430	Miscanthus Phyllosphere	VDTDKKKMDHLFHGLSYILQEKLYTTNYQTFGAMMNAAIAMEGL
Ga0182192_11517811	3300017430	Miscanthus Phyllosphere	VDTDEKKERFFHCLSYILQEKLYTVNYQTFGTLMNAAIAMEGF
Ga0182206_11322001	3300017433	Miscanthus Phyllosphere	VDTDDKKKDRFFCGLAPILQEKLYTANYQTFGALMNAAIAMEGF
Ga0182191_10783701	3300017438	Miscanthus Phyllosphere	VDTDDKKKDRFFHGLAPLLQEKLYMANYQTFGALMNAAITMEGFQQESQAE
Ga0182191_10895872	3300017438	Miscanthus Phyllosphere	KKKDRFFRGLSSILQEKLYMVNYQTFGALMNAAIAMEGFQRES
Ga0182221_10494081	3300017442	Miscanthus Phyllosphere	VDTDDKKKDRIFHGLSSILQEKLYTANYQTFGALMNIAIATEGF
Ga0182221_10630071	3300017442	Miscanthus Phyllosphere	VDTDDKKKDCFFRGLSSILQEKLYTANYQTFRALMNAAITMEGFQWES
Ga0182221_10823892	3300017442	Miscanthus Phyllosphere	VDTDEKKKDRFYRGLSYILQEKLYTGNYQTFMAMMNGAIAMEGLQWDF
Ga0182193_10350042	3300017443	Miscanthus Phyllosphere	VDTDDKKKDSFFHGLSSILQEKLYTANYQTFGALMNAAIAMEGFQRESQAE
Ga0182193_10921161	3300017443	Miscanthus Phyllosphere	SDDKKKDRFFHGLAPILQEKLYMTNYQTFGALMNATIAMEGFQWES
Ga0182193_11476412	3300017443	Miscanthus Phyllosphere	VYTDDKKKDRFFRDLSSILQEKLYMVNYQTFRALMNTAIAMEGFQWES
Ga0182229_10839862	3300017682	Miscanthus Phyllosphere	VDTDDKKKDCFFRGLSSILQEKLYTANYQTFGALMNAVIAMEGFQRES
Ga0182218_10206902	3300017683	Miscanthus Phyllosphere	VDIDEKKIDRFYRGLSCSLQEKLYTENYQTFGAMMNAAIAMEGLLQDS
Ga0182218_10501901	3300017683	Miscanthus Phyllosphere	VDSNDKKKDRFFCGLAPILQEKLYTANYQTFGALMNAAIAMEGFQWES
Ga0182218_11086191	3300017683	Miscanthus Phyllosphere	DSDDKKKDRFFRGLTPILQEKLYTANYQTFGALMHTAIAMEGF
Ga0182218_11145061	3300017683	Miscanthus Phyllosphere	VDTNEKKMDHFNRGLSCILQEKLYTGGYQTFGALMNVAIAMEGLQRDTQVE
Ga0182218_11321211	3300017683	Miscanthus Phyllosphere	MDTDEKKMDRFNHGLSCILQEKLYIGGYQTFGALMNAAIAMEGLQRDSQAE
Ga0182225_10712851	3300017684	Miscanthus Phyllosphere	VDTDEKMECFNHGLYCILQEKLYIGGYQTFGALMNAAIAMEGLQRDSQAKWKR
Ga0182225_11358401	3300017684	Miscanthus Phyllosphere	KRDRFYRGLSCSLQKELYTRNYQTFGAMMNAAIAMEGLQWDS
Ga0182225_11423331	3300017684	Miscanthus Phyllosphere	HLAQYARTHVDTNKKKMDRFNRGLSCILQEKLYTKGYQTFGALMNAAIAMEGL
Ga0182227_10891431	3300017685	Miscanthus Phyllosphere	VDTDDSKRERFFCGLAPLIQEKLYTANYQTFGALMNAAIAIEGF
Ga0182227_11010392	3300017685	Miscanthus Phyllosphere	WTHVDTDEKKMDHFNHGISCILQEKLYTGGYQTFGALMNAAIAIEGLQHDS
Ga0182205_10624241	3300017686	Miscanthus Phyllosphere	MDEKKRDHFYRGLSYNLQKELYTRNYQSFRAMMNAAIAMEGLQRDS
Ga0182231_10816281	3300017689	Miscanthus Phyllosphere	MDTNKKKKDRFFRGLSYILQEKLYTVNYQTFGTLMNAAIAMEGL
Ga0182223_10270712	3300017690	Miscanthus Phyllosphere	VDSDEKKKDRFFRGLTPTLQEKLYLGNYQTFGALMNAAIAIEGFQQASQAN
Ga0182232_10866862	3300021060	Phyllosphere	VDTDDKKKDRFFRGLSSILQEKLYTANYQTFGALMNAAIAMEGFQRES

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.42
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.42
Powered by PDBe Molstar

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F026458

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Host-Associated	Open in IMG/M
3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Host-Associated	Open in IMG/M
3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Host-Associated	Open in IMG/M
3300015267	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015268	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015269	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015274	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015275	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015276	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015277	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015279	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015282	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015283	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015285	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015286	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015287	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015288	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015289	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015291	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015292	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015294	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015295	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015296	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015298	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015299	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015302	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015304	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015305	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015307	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015308	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015314	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015321	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015322	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015323	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_31MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015341	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015342	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015343	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015344	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015345	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_09MAY2016_LD1 MG	Host-Associated	Open in IMG/M
3300015346	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300015347	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_01AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300015351	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015355	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12JUL2016_LD1 MG	Host-Associated	Open in IMG/M
3300015361	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_20JUN2016_LD1 MG	Host-Associated	Open in IMG/M
3300017404	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017407	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017409	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017410	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017411	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017413	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017415	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017417	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017420	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017424	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017425	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017427	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017430	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R3_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017433	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_NF_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017438	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017442	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017443	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_22AUG2016_LD1 MG	Host-Associated	Open in IMG/M
3300017682	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017683	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R1_MAIN_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017684	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300017685	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017686	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R4_MAIN_12SEP2016_LD1 MG	Host-Associated	Open in IMG/M
3300017689	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_07NOV2016_LD1 MG	Host-Associated	Open in IMG/M
3300017690	Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_NF_03OCT2016_LD1 MG	Host-Associated	Open in IMG/M
3300021060	Phyllosphere microbial comminities from miscanthus, Michigan, USA - G6R3_NF_07NOV2016_LD2 MG	Host-Associated	Open in IMG/M

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign