| Basic Information | |
|---|---|
| Family ID | F026442 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 198 |
| Average Sequence Length | 47 residues |
| Representative Sequence | MSYADVEIKIIQWAEARKIIPNSTPEVQLLKAMSEMGELADATIK |
| Number of Associated Samples | 136 |
| Number of Associated Scaffolds | 198 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Viruses |
| % of genes with valid RBS motifs | 93.43 % |
| % of genes near scaffold ends (potentially truncated) | 97.98 % |
| % of genes from short scaffolds (< 2000 bps) | 88.89 % |
| Associated GOLD sequencing projects | 121 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.57 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Duplodnaviria (63.636 % of family members) |
| NCBI Taxonomy ID | 2731341 |
| Taxonomy | All Organisms → Viruses → Duplodnaviria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.758 % of family members) |
| Environment Ontology (ENVO) | Unclassified (62.121 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (67.677 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 47.95% β-sheet: 0.00% Coil/Unstructured: 52.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.57 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 198 Family Scaffolds |
|---|---|---|
| PF04404 | ERF | 8.59 |
| PF06378 | DUF1071 | 4.04 |
| PF13392 | HNH_3 | 3.54 |
| PF11753 | DUF3310 | 1.01 |
| PF00145 | DNA_methylase | 1.01 |
| PF05866 | RusA | 1.01 |
| PF07120 | DUF1376 | 1.01 |
| PF05565 | Sipho_Gp157 | 0.51 |
| PF11903 | ParD_like | 0.51 |
| PF02195 | ParBc | 0.51 |
| PF05037 | DUF669 | 0.51 |
| PF13412 | HTH_24 | 0.51 |
| PF13479 | AAA_24 | 0.51 |
| PF09588 | YqaJ | 0.51 |
| PF14549 | P22_Cro | 0.51 |
| PF00149 | Metallophos | 0.51 |
| PF00929 | RNase_T | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 198 Family Scaffolds |
|---|---|---|---|
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 1.01 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 1.01 |
| COG4570 | Holliday junction resolvase RusA (prophage-encoded endonuclease) | Replication, recombination and repair [L] | 1.01 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 83.33 % |
| Unclassified | root | N/A | 16.67 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001419|JGI11705J14877_10178870 | Not Available | 557 | Open in IMG/M |
| 3300001580|Draft_10218124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Tepidimonas → Tepidimonas ignava | 862 | Open in IMG/M |
| 3300002408|B570J29032_109460657 | Not Available | 781 | Open in IMG/M |
| 3300003277|JGI25908J49247_10079571 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300003277|JGI25908J49247_10107755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 667 | Open in IMG/M |
| 3300003394|JGI25907J50239_1012725 | All Organisms → Viruses → Predicted Viral | 1948 | Open in IMG/M |
| 3300004123|Ga0066181_10148499 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 660 | Open in IMG/M |
| 3300004126|Ga0066179_10167453 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300004240|Ga0007787_10231451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 905 | Open in IMG/M |
| 3300004240|Ga0007787_10318272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 771 | Open in IMG/M |
| 3300005832|Ga0074469_10642074 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 836 | Open in IMG/M |
| 3300006030|Ga0075470_10004851 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4168 | Open in IMG/M |
| 3300006128|Ga0007828_1056098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 817 | Open in IMG/M |
| 3300006637|Ga0075461_10199924 | Not Available | 599 | Open in IMG/M |
| 3300006805|Ga0075464_10692544 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 630 | Open in IMG/M |
| 3300006805|Ga0075464_10840033 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300006875|Ga0075473_10023105 | All Organisms → cellular organisms → Bacteria | 2391 | Open in IMG/M |
| 3300006917|Ga0075472_10033511 | All Organisms → cellular organisms → Bacteria | 2397 | Open in IMG/M |
| 3300006917|Ga0075472_10084481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1534 | Open in IMG/M |
| 3300006917|Ga0075472_10535287 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 584 | Open in IMG/M |
| 3300006920|Ga0070748_1268625 | Not Available | 610 | Open in IMG/M |
| 3300006920|Ga0070748_1292373 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 580 | Open in IMG/M |
| 3300007276|Ga0070747_1094837 | All Organisms → Viruses → Predicted Viral | 1104 | Open in IMG/M |
| 3300007542|Ga0099846_1012643 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3333 | Open in IMG/M |
| 3300007624|Ga0102878_1203856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300007972|Ga0105745_1281931 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 540 | Open in IMG/M |
| 3300007973|Ga0105746_1071631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1112 | Open in IMG/M |
| 3300008114|Ga0114347_1244665 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 556 | Open in IMG/M |
| 3300008116|Ga0114350_1126018 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 761 | Open in IMG/M |
| 3300008122|Ga0114359_1169763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 776 | Open in IMG/M |
| 3300008258|Ga0114840_1021159 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1084 | Open in IMG/M |
| 3300008259|Ga0114841_1075965 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1538 | Open in IMG/M |
| 3300008265|Ga0114361_1121662 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1210 | Open in IMG/M |
| 3300008266|Ga0114363_1080050 | All Organisms → Viruses → Predicted Viral | 2237 | Open in IMG/M |
| 3300008267|Ga0114364_1034791 | Not Available | 1933 | Open in IMG/M |
| 3300008267|Ga0114364_1177827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 547 | Open in IMG/M |
| 3300008267|Ga0114364_1187781 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 522 | Open in IMG/M |
| 3300008339|Ga0114878_1103298 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
| 3300009151|Ga0114962_10652168 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 542 | Open in IMG/M |
| 3300009151|Ga0114962_10695268 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300009151|Ga0114962_10737365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300009152|Ga0114980_10194896 | Not Available | 1193 | Open in IMG/M |
| 3300009152|Ga0114980_10386110 | Not Available | 805 | Open in IMG/M |
| 3300009152|Ga0114980_10643542 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 597 | Open in IMG/M |
| 3300009155|Ga0114968_10674594 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 543 | Open in IMG/M |
| 3300009155|Ga0114968_10692386 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 534 | Open in IMG/M |
| 3300009159|Ga0114978_10051967 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2825 | Open in IMG/M |
| 3300009159|Ga0114978_10053230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2784 | Open in IMG/M |
| 3300009159|Ga0114978_10308141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 968 | Open in IMG/M |
| 3300009159|Ga0114978_10362755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 874 | Open in IMG/M |
| 3300009160|Ga0114981_10651686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 558 | Open in IMG/M |
| 3300009164|Ga0114975_10413335 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300009164|Ga0114975_10575360 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 602 | Open in IMG/M |
| 3300009165|Ga0105102_10366148 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300009180|Ga0114979_10007192 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7300 | Open in IMG/M |
| 3300009181|Ga0114969_10455018 | Not Available | 723 | Open in IMG/M |
| 3300009181|Ga0114969_10477747 | Not Available | 701 | Open in IMG/M |
| 3300009182|Ga0114959_10265276 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 867 | Open in IMG/M |
| 3300009183|Ga0114974_10453682 | Not Available | 726 | Open in IMG/M |
| 3300009183|Ga0114974_10484235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 696 | Open in IMG/M |
| 3300009183|Ga0114974_10595141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 610 | Open in IMG/M |
| 3300009183|Ga0114974_10785960 | Not Available | 512 | Open in IMG/M |
| 3300009184|Ga0114976_10301186 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 858 | Open in IMG/M |
| 3300009184|Ga0114976_10339989 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 795 | Open in IMG/M |
| 3300009419|Ga0114982_1092138 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 938 | Open in IMG/M |
| 3300009684|Ga0114958_10485689 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 594 | Open in IMG/M |
| 3300009819|Ga0105087_1018160 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300010158|Ga0114960_10043249 | Not Available | 2720 | Open in IMG/M |
| 3300010158|Ga0114960_10473755 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 604 | Open in IMG/M |
| 3300010160|Ga0114967_10003399 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 13070 | Open in IMG/M |
| 3300010316|Ga0136655_1213436 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 574 | Open in IMG/M |
| 3300011010|Ga0139557_1039210 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 822 | Open in IMG/M |
| 3300012012|Ga0153799_1059587 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 696 | Open in IMG/M |
| 3300012352|Ga0157138_1020229 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1070 | Open in IMG/M |
| 3300012667|Ga0157208_10032641 | Not Available | 699 | Open in IMG/M |
| 3300012779|Ga0138284_1162800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 746 | Open in IMG/M |
| 3300013004|Ga0164293_10607393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 710 | Open in IMG/M |
| 3300013006|Ga0164294_10734696 | Not Available | 666 | Open in IMG/M |
| 3300013014|Ga0164295_10519426 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
| 3300013295|Ga0170791_15328666 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300013372|Ga0177922_10971414 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 677 | Open in IMG/M |
| 3300016745|Ga0182093_1293782 | All Organisms → Viruses | 3374 | Open in IMG/M |
| 3300017707|Ga0181363_1028485 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1062 | Open in IMG/M |
| 3300017716|Ga0181350_1063311 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 961 | Open in IMG/M |
| 3300017722|Ga0181347_1156157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 620 | Open in IMG/M |
| 3300017736|Ga0181365_1058237 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300017754|Ga0181344_1079917 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 959 | Open in IMG/M |
| 3300017754|Ga0181344_1186154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300017754|Ga0181344_1219937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300017761|Ga0181356_1042955 | All Organisms → Viruses → Predicted Viral | 1582 | Open in IMG/M |
| 3300017761|Ga0181356_1045815 | All Organisms → cellular organisms → Bacteria | 1522 | Open in IMG/M |
| 3300017766|Ga0181343_1010310 | All Organisms → cellular organisms → Bacteria | 3019 | Open in IMG/M |
| 3300017766|Ga0181343_1072257 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 996 | Open in IMG/M |
| 3300017766|Ga0181343_1072380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 995 | Open in IMG/M |
| 3300017766|Ga0181343_1168949 | Not Available | 605 | Open in IMG/M |
| 3300017766|Ga0181343_1204823 | Not Available | 540 | Open in IMG/M |
| 3300017777|Ga0181357_1026366 | Not Available | 2304 | Open in IMG/M |
| 3300017778|Ga0181349_1128701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae | 927 | Open in IMG/M |
| 3300017778|Ga0181349_1179049 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 745 | Open in IMG/M |
| 3300017778|Ga0181349_1264938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 568 | Open in IMG/M |
| 3300017780|Ga0181346_1030185 | Not Available | 2249 | Open in IMG/M |
| 3300017780|Ga0181346_1100744 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1122 | Open in IMG/M |
| 3300017780|Ga0181346_1277572 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
| 3300017780|Ga0181346_1292600 | Not Available | 555 | Open in IMG/M |
| 3300017785|Ga0181355_1273122 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
| 3300017785|Ga0181355_1298498 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 605 | Open in IMG/M |
| 3300017785|Ga0181355_1347864 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 546 | Open in IMG/M |
| 3300019784|Ga0181359_1159205 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 766 | Open in IMG/M |
| 3300019784|Ga0181359_1174660 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 715 | Open in IMG/M |
| 3300019784|Ga0181359_1197896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 649 | Open in IMG/M |
| 3300021956|Ga0213922_1125313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 503 | Open in IMG/M |
| 3300021963|Ga0222712_10778791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 530 | Open in IMG/M |
| 3300022190|Ga0181354_1045584 | All Organisms → Viruses → Predicted Viral | 1457 | Open in IMG/M |
| 3300022190|Ga0181354_1063645 | Not Available | 1225 | Open in IMG/M |
| 3300022190|Ga0181354_1159081 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 701 | Open in IMG/M |
| 3300022190|Ga0181354_1198978 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 598 | Open in IMG/M |
| 3300022190|Ga0181354_1202952 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 589 | Open in IMG/M |
| 3300022407|Ga0181351_1021824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2711 | Open in IMG/M |
| 3300022407|Ga0181351_1104213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1091 | Open in IMG/M |
| 3300022407|Ga0181351_1197853 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 675 | Open in IMG/M |
| 3300022746|Ga0228701_1025565 | Not Available | 1737 | Open in IMG/M |
| 3300023174|Ga0214921_10111821 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2001 | Open in IMG/M |
| 3300023179|Ga0214923_10247095 | All Organisms → Viruses → Predicted Viral | 1009 | Open in IMG/M |
| 3300023184|Ga0214919_10378683 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 929 | Open in IMG/M |
| 3300024491|Ga0255203_1043834 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 590 | Open in IMG/M |
| 3300024857|Ga0256339_1071078 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 727 | Open in IMG/M |
| 3300025353|Ga0208255_104504 | Not Available | 1410 | Open in IMG/M |
| 3300025378|Ga0207960_1053193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 545 | Open in IMG/M |
| 3300025585|Ga0208546_1057648 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 914 | Open in IMG/M |
| 3300025630|Ga0208004_1127938 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300025635|Ga0208147_1116911 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 638 | Open in IMG/M |
| 3300025806|Ga0208545_1086435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
| 3300025872|Ga0208783_10064516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1652 | Open in IMG/M |
| 3300025889|Ga0208644_1209296 | All Organisms → cellular organisms → Bacteria | 840 | Open in IMG/M |
| 3300025896|Ga0208916_10419897 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300025896|Ga0208916_10421111 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
| 3300025897|Ga0209425_10260019 | Not Available | 890 | Open in IMG/M |
| 3300027712|Ga0209499_1268118 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
| 3300027721|Ga0209492_1195547 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 695 | Open in IMG/M |
| 3300027732|Ga0209442_1338193 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 508 | Open in IMG/M |
| 3300027734|Ga0209087_1131676 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1024 | Open in IMG/M |
| 3300027736|Ga0209190_1196371 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 835 | Open in IMG/M |
| 3300027736|Ga0209190_1232097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 741 | Open in IMG/M |
| 3300027736|Ga0209190_1272429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 659 | Open in IMG/M |
| 3300027746|Ga0209597_1143799 | Not Available | 1026 | Open in IMG/M |
| 3300027749|Ga0209084_1028912 | All Organisms → cellular organisms → Bacteria | 2870 | Open in IMG/M |
| 3300027754|Ga0209596_1215376 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 810 | Open in IMG/M |
| 3300027759|Ga0209296_1125807 | All Organisms → Viruses → Predicted Viral | 1186 | Open in IMG/M |
| 3300027759|Ga0209296_1257451 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 714 | Open in IMG/M |
| 3300027763|Ga0209088_10103937 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1299 | Open in IMG/M |
| 3300027770|Ga0209086_10239717 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 808 | Open in IMG/M |
| 3300027770|Ga0209086_10319997 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 654 | Open in IMG/M |
| 3300027772|Ga0209768_10278265 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 713 | Open in IMG/M |
| 3300027782|Ga0209500_10000314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 43103 | Open in IMG/M |
| 3300027782|Ga0209500_10050777 | All Organisms → Viruses → Predicted Viral | 2215 | Open in IMG/M |
| 3300027785|Ga0209246_10108813 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1087 | Open in IMG/M |
| 3300027785|Ga0209246_10266514 | Not Available | 661 | Open in IMG/M |
| 3300027785|Ga0209246_10419631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
| 3300027798|Ga0209353_10314380 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 661 | Open in IMG/M |
| 3300027798|Ga0209353_10401696 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 562 | Open in IMG/M |
| 3300027808|Ga0209354_10365762 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 565 | Open in IMG/M |
| 3300027836|Ga0209230_10691334 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 563 | Open in IMG/M |
| 3300027969|Ga0209191_1350470 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300027971|Ga0209401_1140230 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 954 | Open in IMG/M |
| 3300027972|Ga0209079_10020876 | All Organisms → Viruses | 2174 | Open in IMG/M |
| 3300027973|Ga0209298_10008854 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5469 | Open in IMG/M |
| 3300028025|Ga0247723_1058124 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1078 | Open in IMG/M |
| 3300028025|Ga0247723_1108421 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales → Geobacteraceae → unclassified Geobacteraceae → Geobacteraceae bacterium | 692 | Open in IMG/M |
| 3300028025|Ga0247723_1135392 | Not Available | 589 | Open in IMG/M |
| 3300028392|Ga0304729_1202492 | Not Available | 614 | Open in IMG/M |
| 3300028393|Ga0304728_1175429 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 760 | Open in IMG/M |
| 3300029169|Ga0168037_111037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 572 | Open in IMG/M |
| 3300031578|Ga0307376_10376053 | All Organisms → cellular organisms → Bacteria | 938 | Open in IMG/M |
| 3300031758|Ga0315907_10222473 | All Organisms → Viruses → Predicted Viral | 1574 | Open in IMG/M |
| 3300031758|Ga0315907_10518027 | Not Available | 940 | Open in IMG/M |
| 3300031784|Ga0315899_11205313 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 655 | Open in IMG/M |
| 3300031857|Ga0315909_10401645 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 981 | Open in IMG/M |
| 3300031857|Ga0315909_10576028 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 758 | Open in IMG/M |
| 3300031857|Ga0315909_10850590 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 569 | Open in IMG/M |
| 3300031963|Ga0315901_10923741 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 618 | Open in IMG/M |
| 3300032050|Ga0315906_10441995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1118 | Open in IMG/M |
| 3300032050|Ga0315906_10672216 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 837 | Open in IMG/M |
| 3300032053|Ga0315284_12480013 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Curvibacter → unclassified Curvibacter → Curvibacter sp. | 506 | Open in IMG/M |
| 3300032092|Ga0315905_10747934 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 859 | Open in IMG/M |
| 3300032093|Ga0315902_11126238 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 573 | Open in IMG/M |
| 3300032116|Ga0315903_10423021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1077 | Open in IMG/M |
| 3300032116|Ga0315903_11158707 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
| 3300032116|Ga0315903_11174656 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 520 | Open in IMG/M |
| 3300032516|Ga0315273_13027785 | Not Available | 525 | Open in IMG/M |
| 3300033557|Ga0316617_102448527 | Not Available | 541 | Open in IMG/M |
| 3300033995|Ga0335003_0281966 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 754 | Open in IMG/M |
| 3300033996|Ga0334979_0361397 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 811 | Open in IMG/M |
| 3300034062|Ga0334995_0069780 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2772 | Open in IMG/M |
| 3300034064|Ga0335001_0646875 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 553 | Open in IMG/M |
| 3300034066|Ga0335019_0346859 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 920 | Open in IMG/M |
| 3300034103|Ga0335030_0366284 | Not Available | 945 | Open in IMG/M |
| 3300034118|Ga0335053_0411731 | Not Available | 817 | Open in IMG/M |
| 3300034200|Ga0335065_0536104 | Not Available | 694 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.76% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 25.25% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 10.10% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 7.07% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 7.07% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 5.05% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 2.02% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.52% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 1.52% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 1.52% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.01% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.01% |
| Freshwater | Environmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater | 1.01% |
| Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 1.01% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.51% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.51% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater | 0.51% |
| Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.51% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.51% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 0.51% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.51% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.51% |
| Saline Water And Sediment | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Sediment → Saline Water And Sediment | 0.51% |
| Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 0.51% |
| Aquarium Water | Environmental → Aquatic → Aquaculture → Unclassified → Unclassified → Aquarium Water | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.51% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.51% |
| Hydrocarbon Resource Environments | Engineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001419 | Saline surface water microbial communities from Etoliko Lagoon, Greece - halocline water (15 m) | Environmental | Open in IMG/M |
| 3300001580 | Wastewater microbial communities from Syncrude, Ft. McMurray, Alberta - Microbes from Suncor taillings pond 6 2012TP6_6 | Engineered | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300003277 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD | Environmental | Open in IMG/M |
| 3300003394 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300004123 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
| 3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
| 3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
| 3300005832 | Microbial communities from Baker Bay sediment, Columbia River estuary, Washington - S.41_BBB | Environmental | Open in IMG/M |
| 3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006128 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBE16Oct07 | Environmental | Open in IMG/M |
| 3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006875 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA | Environmental | Open in IMG/M |
| 3300006917 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300006920 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_12 | Environmental | Open in IMG/M |
| 3300007276 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 | Environmental | Open in IMG/M |
| 3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
| 3300007624 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-02 | Environmental | Open in IMG/M |
| 3300007972 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460ABC_3.0um | Environmental | Open in IMG/M |
| 3300007973 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1460A_0.2um | Environmental | Open in IMG/M |
| 3300008114 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA | Environmental | Open in IMG/M |
| 3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
| 3300008122 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample HABS-E2014-0124-100-LTR | Environmental | Open in IMG/M |
| 3300008258 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample HABS-E2014-0110-3-NA | Environmental | Open in IMG/M |
| 3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
| 3300008265 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0126-100-LTR | Environmental | Open in IMG/M |
| 3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
| 3300008267 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-100-LTR | Environmental | Open in IMG/M |
| 3300008339 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Sept 29, 2014 all contigs | Environmental | Open in IMG/M |
| 3300009151 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009155 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009160 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_MF_MetaG | Environmental | Open in IMG/M |
| 3300009164 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG | Environmental | Open in IMG/M |
| 3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009181 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009182 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
| 3300009184 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300009684 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG | Environmental | Open in IMG/M |
| 3300009819 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 | Environmental | Open in IMG/M |
| 3300010158 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG | Environmental | Open in IMG/M |
| 3300010160 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG | Environmental | Open in IMG/M |
| 3300010316 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.8_DNA | Environmental | Open in IMG/M |
| 3300011010 | Freshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
| 3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
| 3300012779 | Freshwater microbial communities from Lake Simoncouche, Canada - S_130206_E_mt (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013006 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES005 metaG | Environmental | Open in IMG/M |
| 3300013014 | Oligotrophic lake water microbial communities from Sparkling Lake, Wisconsin, USA - GEODES006 metaG | Environmental | Open in IMG/M |
| 3300013295 | northern Canada Lakes metatranscriptome co-assembly | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300016745 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041411BS metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017707 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MLB.S.N | Environmental | Open in IMG/M |
| 3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
| 3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017736 | Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N | Environmental | Open in IMG/M |
| 3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
| 3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
| 3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
| 3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
| 3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
| 3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300017785 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.D.N | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300021956 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 29-17 MG | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
| 3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300022746 | Freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17_Aug_MG | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300023179 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1510 | Environmental | Open in IMG/M |
| 3300023184 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503 | Environmental | Open in IMG/M |
| 3300024491 | Freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Colum_RepB_8h | Environmental | Open in IMG/M |
| 3300024857 | Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Colum_RepA_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300025353 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH06Jun08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025378 | Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH29May08 (SPAdes) | Environmental | Open in IMG/M |
| 3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025635 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_0.3_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025872 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300025896 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025897 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes) | Environmental | Open in IMG/M |
| 3300027712 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130208_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027732 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027736 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140205_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027746 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140625_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027749 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027770 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027772 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027785 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027798 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027808 | Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM15.DD (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027969 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130626_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027971 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027972 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028392 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_131016_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300028393 | Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG (v2) | Environmental | Open in IMG/M |
| 3300029169 | Aquariaum water viral communities from Chicago, USA - Oceanarium - OC1 | Environmental | Open in IMG/M |
| 3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
| 3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
| 3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
| 3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
| 3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
| 3300032116 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA119 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033557 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D2_B | Environmental | Open in IMG/M |
| 3300033995 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23May2014-rr0056 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034064 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME14Nov2013-rr0054 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034103 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Sep2002-rr0119 | Environmental | Open in IMG/M |
| 3300034118 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Aug2017-rr0165 | Environmental | Open in IMG/M |
| 3300034200 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2013-rr0190 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11705J14877_101788703 | 3300001419 | Saline Water And Sediment | MSYADIEMKIVQWSESRKIIKHSTAEAQLLKAVSEMGELADA |
| Draft_102181241 | 3300001580 | Hydrocarbon Resource Environments | MSWTELEMKVIRWAEDRRIIPNATPTSQLLKAMSEMGELA |
| B570J29032_1094606572 | 3300002408 | Freshwater | MPSYAEIEMKVVQWAEARQIIPNSTPATQLLKAMSELGELA |
| JGI25908J49247_100795711 | 3300003277 | Freshwater Lake | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIKKDREAI |
| JGI25908J49247_101077553 | 3300003277 | Freshwater Lake | MATYADLEMDIVRWAEARKIIPNSHPQTQLLKAMSEIGELAD |
| JGI25907J50239_10127251 | 3300003394 | Freshwater Lake | MATYAILELDIIRWAEARKIIPNSHPQTQLLKAMSEIGELAD |
| Ga0066181_101484993 | 3300004123 | Freshwater Lake | MSYANVEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKNDKEAI |
| Ga0066179_101674532 | 3300004126 | Freshwater Lake | MSYANIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADA |
| Ga0007787_102314514 | 3300004240 | Freshwater Lake | MSYAAVEIKIIQWAEARKIIPNSTPDVQLLKAMSEMGELADATIKNDREAIVDA |
| Ga0007787_103182724 | 3300004240 | Freshwater Lake | MSYAAIEMKIIQWSEARRIIPNSTPDVQLLKAVSEIGELADATIKDDKEAIVDAVGDVMVCLI |
| Ga0074469_106420741 | 3300005832 | Sediment (Intertidal) | MSYAAVEIKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKHDKEAVID |
| Ga0075470_100048511 | 3300006030 | Aqueous | MEYRYLELEIIRWAEARKIIPNSTPQAQYLKAVSEMGELADAINKRDLDA |
| Ga0007828_10560981 | 3300006128 | Freshwater | MSYADIELEIVRWAEARKIIPNSTPDTQLLKAMSELGELADATIKKDRD |
| Ga0075461_101999243 | 3300006637 | Aqueous | MSYANIEMKIVQWAEARRIIQNSTAEAQLLKAVSEMGELADATI |
| Ga0075464_106925441 | 3300006805 | Aqueous | MSYADVEIKIIQWAEARKIIPNSTPEVQLLKAMSEMGELADAT |
| Ga0075464_108400333 | 3300006805 | Aqueous | MSYADVEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIK* |
| Ga0075473_100231051 | 3300006875 | Aqueous | MEYRYLELEIIRWAEARKIIPNSTPQAQYLKAVSEMGELADAINKRDLDATKDA |
| Ga0075472_100335115 | 3300006917 | Aqueous | MEYRYLELEIIRWAEARKIIPNSTPQAQYLKAVSEMGELADAINKRDLDATKDAV |
| Ga0075472_100844815 | 3300006917 | Aqueous | MEYRFLELEIIRWAEARKIIPNSTPQAQYLKAVSEMGELADAINKRDLDATKDAV |
| Ga0075472_105352871 | 3300006917 | Aqueous | MSYANVEMRIIQWAEARKIIPNSTPEVQLLKAMSEMGELADATIKKDKEAIVD |
| Ga0070748_12686251 | 3300006920 | Aqueous | MSTYAELEMKIVQWAEARKIIPNSTPSTQLLKAMSELGELAD |
| Ga0070748_12923732 | 3300006920 | Aqueous | MKGNGMSYAAVEIKIIQWSEARKIIPNSTPEVQLLKAMS |
| Ga0070747_10948371 | 3300007276 | Aqueous | MSYANVEMRIVQWSTARRIIQNSTAEAQLLKAVSEMGE |
| Ga0099846_10126439 | 3300007542 | Aqueous | MSFADIELKIVRWSEARRIIPNSTPETQLLKAMSEFGELADA |
| Ga0102878_12038562 | 3300007624 | Estuarine | MSYANIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKNDED |
| Ga0105745_12819312 | 3300007972 | Estuary Water | MSYADVEIKIIQWAEARKIIPNSTPEVQLLKAMSEMGELADATIK |
| Ga0105746_10716315 | 3300007973 | Estuary Water | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIK |
| Ga0114347_12446651 | 3300008114 | Freshwater, Plankton | MSYANIEMKIIQWSEARKIIPNSNPESQLLKAVSEMG |
| Ga0114350_11260183 | 3300008116 | Freshwater, Plankton | MSYANVEIKIIQWAEQRRIIPNSNPESQLLKAVSEMGELADATIKHDKEAVI |
| Ga0114359_11697633 | 3300008122 | Freshwater, Plankton | MKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKNDED |
| Ga0114840_10211594 | 3300008258 | Freshwater, Plankton | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEMGELA |
| Ga0114841_10759655 | 3300008259 | Freshwater, Plankton | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEMGE |
| Ga0114361_11216624 | 3300008265 | Freshwater, Plankton | MSYANVEIKIIQWAEQRRIIPNSTPDVQLLKAMSEMGELADATI |
| Ga0114363_10800505 | 3300008266 | Freshwater, Plankton | MSYADVEIKIIQWSEARKIIPNSNPESQLLKAVSEIGELADATIKKDPD* |
| Ga0114364_10347917 | 3300008267 | Freshwater, Plankton | MATYAALESEIVRWSEQRRIIPNSTPHAQLLKALSEMGELADA |
| Ga0114364_11778271 | 3300008267 | Freshwater, Plankton | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEIGELADATIKRDKEAI |
| Ga0114364_11877813 | 3300008267 | Freshwater, Plankton | MSYAAIEMKIIQWSEARKIIPNSTPDVQLLKAVSEIGELADATIKGDKEAIVDAVGDV |
| Ga0114878_11032985 | 3300008339 | Freshwater Lake | MSYADVEIKIIQWSEARKIIPNSNPESQLLKAVSEIGELADATIKKD |
| Ga0114962_106521683 | 3300009151 | Freshwater Lake | MSYANVELDIIRWAEARCIIPNSTPSTQLLKLVSELGELSDATIKNDREQIID |
| Ga0114962_106952681 | 3300009151 | Freshwater Lake | MSYAEIEIDILRWSEARKIIPNSTPEIQLLKAVSEIGELCD |
| Ga0114962_107373653 | 3300009151 | Freshwater Lake | MTTYAMVEMDIVRWAEARKIVPNSTPETQLLKAVSEIGELADATIKDNREDIVD |
| Ga0114980_101948961 | 3300009152 | Freshwater Lake | MATYAILELDIIRWAEARKIIPNSHPQTQLLKAMSEIGELADATIKNDQDGIA |
| Ga0114980_103861101 | 3300009152 | Freshwater Lake | MATYADLEMSIVRWAEQRQIIPNSHPQTQLLKAMSEIGELADATIKNDQDGIADG |
| Ga0114980_106435421 | 3300009152 | Freshwater Lake | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIKKDKEAIL |
| Ga0114968_106745943 | 3300009155 | Freshwater Lake | MSYADVEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELAD |
| Ga0114968_106923863 | 3300009155 | Freshwater Lake | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGEL |
| Ga0114978_100519671 | 3300009159 | Freshwater Lake | VSYAEIEIDILRWSEARKIIPNSTPEIQLLKAVSEIGELCDATIKNDRENI |
| Ga0114978_100532301 | 3300009159 | Freshwater Lake | MSYAEIEIDIIRWSEARKIIPNSTPEIQLLKAVSEIGELCDATIKNDRENI |
| Ga0114978_103081411 | 3300009159 | Freshwater Lake | MSYADIEIRIIQWAEARKIIPNSNPESQLLKAVSEI |
| Ga0114978_103627554 | 3300009159 | Freshwater Lake | MSYANVEMKIIQWAEARKIIPNSTPEVQLLKAMSEMG |
| Ga0114981_106516863 | 3300009160 | Freshwater Lake | MSYADIEIRIIQWAEARKIIPNSNPESQLLKAVSEIGELAD |
| Ga0114975_104133351 | 3300009164 | Freshwater Lake | MTTYANIEMQIIQWAEARRIIPNSTPSTQLLKAVSEMGELADATIKNN |
| Ga0114975_105753602 | 3300009164 | Freshwater Lake | MSYANIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKDDED |
| Ga0105102_103661482 | 3300009165 | Freshwater Sediment | MSYANIEMKIIQWAEARLIIPNAKPYTQLMKAVSEMGELCDV* |
| Ga0114979_100071921 | 3300009180 | Freshwater Lake | MAIKGKNMSYDQIEMDILRWSEARKIIPNSTPETQLLKAMSEMGELADATIKKD |
| Ga0114969_104550181 | 3300009181 | Freshwater Lake | MNTHEKIIQWAKDRKIIPNSSTRVQCLKAVSEIGELADELIKHDVEAIKDA |
| Ga0114969_104777471 | 3300009181 | Freshwater Lake | MATYADVEMSILRWAEARKIIPNSNPQTQLLKAMSEIGELADATIKNDQDGIA |
| Ga0114959_102652763 | 3300009182 | Freshwater Lake | MSYAMVELDIIRWAEARKIIPNSTPATQLLKAMSEIGELADATIKQDKFGIVDGVGDVMVCLVNYCVLQDIDLVSCMK |
| Ga0114974_104536823 | 3300009183 | Freshwater Lake | MATYADLELDIIRWAEARKIIPNSHPQTQLLKAMSEIGELADATIK |
| Ga0114974_104842351 | 3300009183 | Freshwater Lake | MTEIEIIRWAEARKIIPNSTPGTQLLKAMSEMGELADATIKDNREDIVDS |
| Ga0114974_105951411 | 3300009183 | Freshwater Lake | MSYAAIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELA |
| Ga0114974_107859602 | 3300009183 | Freshwater Lake | MATYAILELDIIRWAEARKIIPNSHPQTQLLKAMSEIGELADATIK |
| Ga0114976_103011863 | 3300009184 | Freshwater Lake | MSYANIEMKIIQWSEARKIIPNSSPEVQLLKAMSEMGELADATIK |
| Ga0114976_103399891 | 3300009184 | Freshwater Lake | MSYAAVEIRIIQWAEARKIIPNSTPEVQLLKAISEM |
| Ga0114982_10921384 | 3300009419 | Deep Subsurface | MSYANIEMKIIQWSEARKIIPNSNPESQLLKAVSEMGELADATIKHDKEAVID |
| Ga0114958_104856892 | 3300009684 | Freshwater Lake | MSYSDVELQILRWSEARKIIPNSTPEVQLLKAVSEIGELCDATIK |
| Ga0105087_10181604 | 3300009819 | Groundwater Sand | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIG |
| Ga0114960_100432491 | 3300010158 | Freshwater Lake | VSYAEIEIDILRWSEARKIIPNSTPEVQLLKAVSEIGELCDATIKNDRENIA |
| Ga0114960_104737553 | 3300010158 | Freshwater Lake | MATYQMLELDIIHWAEARQIIPNAEPHTQLLKAVSEMGELADATIKNDMVEIEDGVGDVM |
| Ga0114967_1000339930 | 3300010160 | Freshwater Lake | MTTYADVEMDIVRWAEARKIIPNSNSQTQLLKAVSEMGELADATI |
| Ga0136655_12134361 | 3300010316 | Freshwater To Marine Saline Gradient | MSFADVELKIVRWSEARRIIPNSTPETQLLKAMSEFGELADAT |
| Ga0139557_10392103 | 3300011010 | Freshwater | MSYANIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKNDEDAIVDSV |
| Ga0153799_10595871 | 3300012012 | Freshwater | MSYANVEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKRDKEAIVDSVG |
| Ga0157138_10202293 | 3300012352 | Freshwater | MSYAEVELQIIRWAEQRRIIPNSTPEVQLLKAMSEMGELADATIKND |
| Ga0157208_100326411 | 3300012667 | Freshwater | MSFADIEMKVIQWSEARKIYPNGKPVSQLLKAMAELGELADAE |
| Ga0138284_11628003 | 3300012779 | Freshwater Lake | MSYAAVEMKIIQWAEARKIIPNITPEVQLLKAVSEMGELADATIKKDK |
| Ga0164293_106073933 | 3300013004 | Freshwater | MSYANIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKNDEDAIVD |
| Ga0164294_107346961 | 3300013006 | Freshwater | MATYADLEMNIVRWAEARKIIPNSHPQTQLLKAMSEIGELADATIKNDQDGIADGVG |
| Ga0164295_105194264 | 3300013014 | Freshwater | MSYADVELQIIRWSEARKIIPNSTAETQLLKAVSEIG |
| Ga0170791_153286661 | 3300013295 | Freshwater | MSYADVEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELA |
| Ga0177922_109714141 | 3300013372 | Freshwater | MSYASIEMKIIQWSEARKIIPNSTPEIQLLKAMSEMGELADATIKNDEDAIVDSV |
| Ga0182093_12937825 | 3300016745 | Salt Marsh | MSSYAEIEMKILQWAEARKIIPNSTPAIQLLKAMSEMGELADATIK |
| Ga0181363_10284854 | 3300017707 | Freshwater Lake | MSYANVEMKIIQWAEARRIIPNSTPETQLLKAVSEMGELADATIKND |
| Ga0181350_10633114 | 3300017716 | Freshwater Lake | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIKKDR |
| Ga0181347_11561573 | 3300017722 | Freshwater Lake | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEMG |
| Ga0181365_10582373 | 3300017736 | Freshwater Lake | MSYAEVELQIIRWAEQRRIIPNSTPEVQLLKAMSEMGELADATIK |
| Ga0181344_10799174 | 3300017754 | Freshwater Lake | MSYANVEMRIIQWAEARKIIPNSTPDVQLLKAMSELG |
| Ga0181344_11861541 | 3300017754 | Freshwater Lake | MSYADIEIRIIQWAEARKIIPNSNPESQLLKAVSEIGE |
| Ga0181344_12199371 | 3300017754 | Freshwater Lake | MTYANIEMKIIQWAEARKIIPHSTPETQLLKAVSEMGELAD |
| Ga0181356_10429551 | 3300017761 | Freshwater Lake | MVTYADLEMDIVRWAEARKIIPNSHPQTQLLKAMSEIGE |
| Ga0181356_10458156 | 3300017761 | Freshwater Lake | MSYADIEIRIIQWAEARKIIPNSNPESQLLKAVSEIGELA |
| Ga0181343_10103107 | 3300017766 | Freshwater Lake | MEAIKGQVSYREVELAIIRWAEARKIIPNATPSSQLLKLV |
| Ga0181343_10722571 | 3300017766 | Freshwater Lake | MSYANIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKN |
| Ga0181343_10723801 | 3300017766 | Freshwater Lake | MSYAAVEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKN |
| Ga0181343_11689493 | 3300017766 | Freshwater Lake | MAMSYANIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADAT |
| Ga0181343_12048233 | 3300017766 | Freshwater Lake | MATYQALEADIIRWAEARRIVPNSTPQVQLLKAVSELGELADATIKGEK |
| Ga0181357_10263661 | 3300017777 | Freshwater Lake | MATYAILELDIIRWAEARKIIPNSHPQTQLLKAMSEIGELADATIKNDQDGIADG |
| Ga0181349_11287011 | 3300017778 | Freshwater Lake | MTTYADLEMSIVRWAEARKIIPNSHPQTQLLKAMSEIGELADATIKNDQDGIAD |
| Ga0181349_11790494 | 3300017778 | Freshwater Lake | MSYAAIEMKIIQWSEARKIIPNSTPDVQLLKAMSEMGELADATIKNDKEAIV |
| Ga0181349_12649381 | 3300017778 | Freshwater Lake | MSYAAVEIKIIQWAEARKIIPNSTPDVQLLKAMSEMGELADATIKNDREAIVDAV |
| Ga0181346_10301851 | 3300017780 | Freshwater Lake | MATYAILELDIIRWAEARKIIPNSHPQTQLLKAMSEI |
| Ga0181346_11007441 | 3300017780 | Freshwater Lake | MSYANIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKHDK |
| Ga0181346_12775721 | 3300017780 | Freshwater Lake | MSYADIEIRIIQWAEARKIIPNSNPESQLLKAVSEIGELADAT |
| Ga0181346_12926001 | 3300017780 | Freshwater Lake | MATYADLEVDIVRWAEARKIIPNSHPQTQLLKAMSEIGELADAT |
| Ga0181355_12731223 | 3300017785 | Freshwater Lake | MSYAAIEIKILQWSEARKIIPNSNPESQLHKAVSEIG |
| Ga0181355_12984982 | 3300017785 | Freshwater Lake | MKGNGMSYAAVEIKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKNDED |
| Ga0181355_13478643 | 3300017785 | Freshwater Lake | MSYAAIEMKIIQWAEARKIIPNSTPEVQLLKAMSEMGELADATIKNDKE |
| Ga0181359_11592053 | 3300019784 | Freshwater Lake | MSSYARIEMLIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKHDN |
| Ga0181359_11746601 | 3300019784 | Freshwater Lake | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEMGELADAIPLFS |
| Ga0181359_11978963 | 3300019784 | Freshwater Lake | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIKKDREAIVDSV |
| Ga0213922_11253131 | 3300021956 | Freshwater | MSYANIEMKILQWSEARKIIPNSTPETQLLKAMSELGELADATIKND |
| Ga0222712_107787912 | 3300021963 | Estuarine Water | MSSYAHIEMLIIQWAEARKIIPNSTPEIQLLKAMSEMGELADATIKNDEDAIVDSVS |
| Ga0181354_10455841 | 3300022190 | Freshwater Lake | MATYAILELDIIRWAEARKIIPNSHPQTQLLKAMSEIGELADATIKNDQDGIV |
| Ga0181354_10636454 | 3300022190 | Freshwater Lake | MATYAILELDIIRWAEARKIIPNSHPQTQLLKAMSEIGELADATIKNDQDGIADGVGDVMVCL |
| Ga0181354_11590814 | 3300022190 | Freshwater Lake | MSYAAIEMKIIQWSEARRIIPNSTPDVQLLKAVSEIGELADATIKDDKEAIVDAVGDVM |
| Ga0181354_11989781 | 3300022190 | Freshwater Lake | MSYANVEMRIIQWAEARRIIPNSTPDVQLLKAMSEMGELADATIKNDKE |
| Ga0181354_12029524 | 3300022190 | Freshwater Lake | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGE |
| Ga0181351_10218249 | 3300022407 | Freshwater Lake | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEI |
| Ga0181351_11042131 | 3300022407 | Freshwater Lake | MSYADVEMQIIQWAEARRIIPNSSPETQLLKAMSELGELADATIKRS |
| Ga0181351_11978533 | 3300022407 | Freshwater Lake | MKGNGMSYAAVEIKIIQWSEARKIIPNSTPETQLLKAMSELGELADATIK |
| Ga0228701_10255651 | 3300022746 | Freshwater | MSYAEVEMKIVQWSEKRKIIPNSTALAQARKAKEEINELIEALECGDHVA |
| Ga0214921_101118217 | 3300023174 | Freshwater | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIKKDKEA |
| Ga0214923_102470954 | 3300023179 | Freshwater | MSYADIEIRIIQRAEARKIIPNSNPESQLLKAVSEIGELADATIKKDKEAK |
| Ga0214919_103786833 | 3300023184 | Freshwater | MTTYADVEMDIVRWAEARKIIPNSNSQTQLLKAVSEMGELADATIKQDGPGIVDGVGDVMVC |
| Ga0255203_10438344 | 3300024491 | Freshwater | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADAT |
| Ga0256339_10710781 | 3300024857 | Freshwater | MTTYAALESDIIRWAEARKIIPHATPQSQLLKAFSEMGELADATQKNNRDEIID |
| Ga0208255_1045043 | 3300025353 | Freshwater | MTTYADIEMKIVQWAEARKIIPNSTPATQLLKAVSEMGELADATIKNHEDEIIDAV |
| Ga0207960_10531932 | 3300025378 | Freshwater | MTTYADIEMKIVQWAEARKIIPNSTPATQLLKAVSEM |
| Ga0208546_10576481 | 3300025585 | Aqueous | MSYANVEIKIIQWSEARKIIPNSTPEVQLLKAMSELGELADATIKKDKEAVI |
| Ga0208004_11279381 | 3300025630 | Aqueous | MSYADVEMKIVQWSTARRILQHSTAEAQLLKAVSEMGELADATIKN |
| Ga0208147_11169111 | 3300025635 | Aqueous | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEMGELADATIKKDKEAIVDS |
| Ga0208545_10864353 | 3300025806 | Aqueous | MSYANVEMRIVQWSEKRRIIQNSTAEAQLLKAVSEMGELADATIKNDKD |
| Ga0208783_100645161 | 3300025872 | Aqueous | MEYRFLELEIIRWAEARKIIPNSTPQAQYLKAVSEMGELADAINKRDLDATKDA |
| Ga0208644_12092961 | 3300025889 | Aqueous | MSYADVEMKIVQWSTARRILQHSTAEAQLLKAVSEMGELADATIKNDEEGIVDAVGDV |
| Ga0208916_104198971 | 3300025896 | Aqueous | MSSYARIEMLIIQWSEARKIIPNSTPEVQLLKAMSEMGEL |
| Ga0208916_104211111 | 3300025896 | Aqueous | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIKKDKEAILDS |
| Ga0209425_102600194 | 3300025897 | Pelagic Marine | MSSYANVEMRIVQWSEARRIIQNSTAEAQLLKAVSEMGELADATIKNNRDEIID |
| Ga0209499_12681183 | 3300027712 | Freshwater Lake | MSYSDVELQILRWSEARKIIPNSTPEVQLLKAVSEIG |
| Ga0209492_11955473 | 3300027721 | Freshwater Sediment | MSYANIEMKILHWSEARKIIPNSTPETQLLKAMSEMGELADATIKKDQE |
| Ga0209442_13381932 | 3300027732 | Freshwater Lake | MSSYARIEMLIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKHDKEAVIDAV |
| Ga0209087_11316764 | 3300027734 | Freshwater Lake | MSYANIEMKIIQWSEARKIIPNSSPEVQLLKAMSEMGELADATIKGDEDAIV |
| Ga0209190_11963714 | 3300027736 | Freshwater Lake | MSYAAVEIKIIQWAEARKIIPNSTPEVQLLKAISEMGE |
| Ga0209190_12320971 | 3300027736 | Freshwater Lake | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIKKDKEAILDSV |
| Ga0209190_12724294 | 3300027736 | Freshwater Lake | MSYAAVEMKIIQWAEARKIIPNSTPEVQLLKAISEMG |
| Ga0209597_11437991 | 3300027746 | Freshwater Lake | MTTYADLEMSIVRWAEARKIIPNSDPQTQLLKAVSELGELADATIKKQPGKITDGVGDVMVCL |
| Ga0209084_10289121 | 3300027749 | Freshwater Lake | MTTYADLEIKIIHWAEARKIIPNSTPATQLLKAVSEMGELSDATIKNHEDEIIDAVGDVMVCLVVY |
| Ga0209596_12153761 | 3300027754 | Freshwater Lake | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIKK |
| Ga0209296_11258071 | 3300027759 | Freshwater Lake | MATYADLELDIIRWAEARKIIPNSHPQTQLLKAMSEIGELADATIKNDQDGIA |
| Ga0209296_12574513 | 3300027759 | Freshwater Lake | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIKKDKEAILD |
| Ga0209088_101039371 | 3300027763 | Freshwater Lake | MSYAAVEIKIIQWAEARKIIPNSTPEVQLLKAVSEMGEL |
| Ga0209086_102397173 | 3300027770 | Freshwater Lake | MNLSYREIELLVIRWAEARRIIPNATPESQLLKAFSEMGELADAQNHNDMD |
| Ga0209086_103199971 | 3300027770 | Freshwater Lake | MSYAAIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELAD |
| Ga0209768_102782654 | 3300027772 | Freshwater Lake | MSYAAIEMKIIQWSEDRKIIPNSTPEVQLLKAMSEIGELADATIKKDQEAVIDSVGDV |
| Ga0209500_100003141 | 3300027782 | Freshwater Lake | MSYAEIEIDIIRWSEARKIIPNSTPEIQLLKAVSEI |
| Ga0209500_100507771 | 3300027782 | Freshwater Lake | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEIGELADATIKKDREAIVDSVGDVMV |
| Ga0209246_101088135 | 3300027785 | Freshwater Lake | MSYAAIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKNDK |
| Ga0209246_102665143 | 3300027785 | Freshwater Lake | MTTYADLEMSIVRWAEARKIIPNSHPQTQLLKAMSEIGELADATIKNDQDGIADG |
| Ga0209246_104196313 | 3300027785 | Freshwater Lake | MSYADIEIRIIQWAEARKIIPNSNPESQLLKAVSE |
| Ga0209353_103143803 | 3300027798 | Freshwater Lake | MSYASIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKNDE |
| Ga0209353_104016961 | 3300027798 | Freshwater Lake | MSYASIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKN |
| Ga0209354_103657621 | 3300027808 | Freshwater Lake | MSYAAIEMRIIQWSEARKIIPNSTAEVQLLKAMSEIGELAD |
| Ga0209230_106913343 | 3300027836 | Freshwater And Sediment | MSYAAVEMKILQWSEARKIIPNSNPESQLLKAVSEIGELADATIKKDKEG |
| Ga0209191_13504703 | 3300027969 | Freshwater Lake | MTTYANIEMQIIQWAEARRIIPNSTPSTQLLKAVSEMGEL |
| Ga0209401_11402304 | 3300027971 | Freshwater Lake | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEIGELADATIKKDKEAI |
| Ga0209079_100208761 | 3300027972 | Freshwater Sediment | MSTYAELEMKIVQWAEARKIIPNSTPATQLLKAVSELGELAD |
| Ga0209298_100088541 | 3300027973 | Freshwater Lake | MATYAILELDIIRWAEARKIIPNSHPQTQLLKAMSEIGELADATIKNDQDGIADGVGD |
| Ga0247723_10581241 | 3300028025 | Deep Subsurface Sediment | VSYAAVEMKIIGWAEQRRIIPNSTPETQLLKAMSELGELADATIK |
| Ga0247723_11084211 | 3300028025 | Deep Subsurface Sediment | MSYAEIELKVIRWAEDRRIIPNATPTSQLLKAVSEMGE |
| Ga0247723_11353922 | 3300028025 | Deep Subsurface Sediment | MKILQWSEARKIIPNSTPETQLLKAMSELGELADATIKKDQEAVID |
| Ga0304729_12024921 | 3300028392 | Freshwater Lake | MTTYADVEMDIVRWAEARKIIPNSNSQTQLLKAVSEMGELADA |
| Ga0304728_11754291 | 3300028393 | Freshwater Lake | VSYAEIEIDIIRWSEARKIIPNSTPEIQLLKAVSEIGELCDAT |
| Ga0168037_1110372 | 3300029169 | Aquarium Water | MSYAAVEMKIIQWSEARKIIPNSTPEVQLLKAMSELDRDWE |
| Ga0307376_103760531 | 3300031578 | Soil | MSYADVEMKIVQWSEARKIIQNSTAEAQLLKAVSEMGELADA |
| Ga0315907_102224735 | 3300031758 | Freshwater | MSYASIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKHD |
| Ga0315907_105180274 | 3300031758 | Freshwater | MSYANIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKHD |
| Ga0315899_112053131 | 3300031784 | Freshwater | MSYASIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADA |
| Ga0315909_104016454 | 3300031857 | Freshwater | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEMGELADATI |
| Ga0315909_105760282 | 3300031857 | Freshwater | MSSYAHIEMLIIQWSEARKIIPNSNPESQLLKAVSEMGELADATIK |
| Ga0315909_108505904 | 3300031857 | Freshwater | MSYAAIEMKIIQWSEARKIIPNSTPDVQLLKAVSEIGELADA |
| Ga0315901_109237411 | 3300031963 | Freshwater | MSYAAIEMKIIQWSEARKIIPNSTAEVQLLKAMSEM |
| Ga0315906_104419951 | 3300032050 | Freshwater | MSYANIEMKIIQWSEARKIIPNSNPESQLLKAVSEIGELADATIKKD |
| Ga0315906_106722161 | 3300032050 | Freshwater | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEMGELADATIKKDKEA |
| Ga0315284_124800131 | 3300032053 | Sediment | MSYAETEMKVIQWAEARCIIPNSNSQTQLLKTMSELGELTD |
| Ga0315905_107479341 | 3300032092 | Freshwater | MSYANIEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKNDE |
| Ga0315902_111262381 | 3300032093 | Freshwater | MSYAAVEIKIIQWAEARKIIPNSTPDVQLLKAMSEMGELAD |
| Ga0315903_104230214 | 3300032116 | Freshwater | MSYANIEMKIIQWSEARKIIPNSNPESQLLKAVSEM |
| Ga0315903_111587072 | 3300032116 | Freshwater | MSYAAVEMKIIQWSEARKIIPNSTPEVQLLKAMSEMGELADATIKNDEDAI |
| Ga0315903_111746561 | 3300032116 | Freshwater | MSYADVEMKIIQWSEARKIIPNSTPETQLLKAVSELGELADATIKE |
| Ga0315273_130277852 | 3300032516 | Sediment | MTTQEKIIQWAKDRKIIPNSSTRIQCLKAVSEIGELADA |
| Ga0316617_1024485271 | 3300033557 | Soil | MSYAQTEMKIIQWAEARKIIQNQQPATALLKAASEFGELCDAEAKGDI |
| Ga0335003_0281966_608_754 | 3300033995 | Freshwater | MTYAAVEMKIIQWAEQRKIIPNSTPEVQLLKAVSEMGELADATIKHDKE |
| Ga0334979_0361397_684_809 | 3300033996 | Freshwater | MSYADIEIRIIQWAEARKIIPNSNPESQLLKAVSEIGELADA |
| Ga0334995_0069780_1_108 | 3300034062 | Freshwater | MSYADIEIKIIQWAEARKIIPNSNPESQLLKAVSEI |
| Ga0335001_0646875_3_128 | 3300034064 | Freshwater | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEMGELADA |
| Ga0335019_0346859_766_918 | 3300034066 | Freshwater | MSYAAIEIKILQWSEARKIIPNSNPESQLLKAVSEMGELADATIKKDKEAI |
| Ga0335030_0366284_2_154 | 3300034103 | Freshwater | MHALRMYTFREAELHVIRWAEARGIIPHAQPASQLLKLVSEVGELCDAEGK |
| Ga0335053_0411731_1_147 | 3300034118 | Freshwater | MDFHDYENLIVGWAEDRKIIPNSTAVAQCLKAVSEMGELADAVNKQDRD |
| Ga0335065_0536104_1_138 | 3300034200 | Freshwater | MTSYAEIEMNIVHWAEARKIIPNSTPATQLLKALSELGELADATIK |
| ⦗Top⦘ |