Basic Information | |
---|---|
Family ID | F026430 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 198 |
Average Sequence Length | 49 residues |
Representative Sequence | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGEKDAPRDE |
Number of Associated Samples | 154 |
Number of Associated Scaffolds | 198 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 86.80 % |
% of genes near scaffold ends (potentially truncated) | 20.20 % |
% of genes from short scaffolds (< 2000 bps) | 80.30 % |
Associated GOLD sequencing projects | 143 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.44 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (96.970 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (14.141 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.788 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (32.323 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.05% β-sheet: 0.00% Coil/Unstructured: 53.95% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 198 Family Scaffolds |
---|---|---|
PF01425 | Amidase | 52.02 |
PF00496 | SBP_bac_5 | 33.33 |
PF00528 | BPD_transp_1 | 1.52 |
PF12911 | OppC_N | 0.51 |
PF00158 | Sigma54_activat | 0.51 |
PF07589 | PEP-CTERM | 0.51 |
COG ID | Name | Functional Category | % Frequency in 198 Family Scaffolds |
---|---|---|---|
COG0154 | Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit or related amidase | Translation, ribosomal structure and biogenesis [J] | 52.02 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 96.97 % |
Unclassified | root | N/A | 3.03 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2199352025|deepsgr__Contig_59676 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3143 | Open in IMG/M |
3300000550|F24TB_10582675 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 936 | Open in IMG/M |
3300000597|AF_2010_repII_A1DRAFT_10099256 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
3300000956|JGI10216J12902_104454638 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 987 | Open in IMG/M |
3300002121|C687J26615_10004914 | All Organisms → cellular organisms → Bacteria | 2976 | Open in IMG/M |
3300002122|C687J26623_10125205 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
3300002124|C687J26631_10131150 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
3300002243|C687J29039_10038050 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
3300004009|Ga0055437_10006479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2290 | Open in IMG/M |
3300004019|Ga0055439_10044838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1180 | Open in IMG/M |
3300004019|Ga0055439_10100500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 857 | Open in IMG/M |
3300004024|Ga0055436_10103126 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
3300004281|Ga0066397_10135937 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 550 | Open in IMG/M |
3300004479|Ga0062595_100381926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 999 | Open in IMG/M |
3300004633|Ga0066395_10004205 | All Organisms → cellular organisms → Bacteria | 4993 | Open in IMG/M |
3300004633|Ga0066395_10240427 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 966 | Open in IMG/M |
3300004633|Ga0066395_10767812 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 577 | Open in IMG/M |
3300004778|Ga0062383_10331781 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
3300005166|Ga0066674_10108300 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1294 | Open in IMG/M |
3300005172|Ga0066683_10331483 | All Organisms → cellular organisms → Bacteria | 945 | Open in IMG/M |
3300005186|Ga0066676_10087097 | All Organisms → cellular organisms → Bacteria | 1867 | Open in IMG/M |
3300005332|Ga0066388_100585794 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1740 | Open in IMG/M |
3300005332|Ga0066388_102548871 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 930 | Open in IMG/M |
3300005332|Ga0066388_108113520 | Not Available | 525 | Open in IMG/M |
3300005363|Ga0008090_15009592 | All Organisms → cellular organisms → Bacteria | 807 | Open in IMG/M |
3300005445|Ga0070708_100345772 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
3300005445|Ga0070708_100387023 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1319 | Open in IMG/M |
3300005446|Ga0066686_10853005 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
3300005459|Ga0068867_101833692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 571 | Open in IMG/M |
3300005467|Ga0070706_100238513 | All Organisms → cellular organisms → Bacteria | 1698 | Open in IMG/M |
3300005518|Ga0070699_102022774 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300005553|Ga0066695_10077704 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
3300005713|Ga0066905_100083908 | All Organisms → cellular organisms → Bacteria | 2104 | Open in IMG/M |
3300005713|Ga0066905_100330044 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1210 | Open in IMG/M |
3300005764|Ga0066903_104633327 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
3300005829|Ga0074479_10522580 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 595 | Open in IMG/M |
3300005829|Ga0074479_10727968 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 847 | Open in IMG/M |
3300005829|Ga0074479_10846646 | All Organisms → cellular organisms → Bacteria | 3526 | Open in IMG/M |
3300005833|Ga0074472_10932664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1805 | Open in IMG/M |
3300006034|Ga0066656_10887959 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 571 | Open in IMG/M |
3300006163|Ga0070715_10162728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1104 | Open in IMG/M |
3300007258|Ga0099793_10246725 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 861 | Open in IMG/M |
3300009012|Ga0066710_100611500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1654 | Open in IMG/M |
3300009038|Ga0099829_10204000 | All Organisms → cellular organisms → Bacteria | 1601 | Open in IMG/M |
3300009038|Ga0099829_10984876 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 699 | Open in IMG/M |
3300009090|Ga0099827_10966919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 738 | Open in IMG/M |
3300009792|Ga0126374_10029929 | All Organisms → cellular organisms → Bacteria | 2536 | Open in IMG/M |
3300009792|Ga0126374_10178437 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1320 | Open in IMG/M |
3300009792|Ga0126374_10358064 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1003 | Open in IMG/M |
3300009792|Ga0126374_11836697 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300010043|Ga0126380_10071868 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
3300010046|Ga0126384_10309069 | All Organisms → cellular organisms → Bacteria | 1303 | Open in IMG/M |
3300010047|Ga0126382_10283908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1233 | Open in IMG/M |
3300010047|Ga0126382_12514426 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300010048|Ga0126373_10195870 | Not Available | 1955 | Open in IMG/M |
3300010304|Ga0134088_10650560 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
3300010358|Ga0126370_10329693 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1224 | Open in IMG/M |
3300010359|Ga0126376_10977755 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
3300010359|Ga0126376_13075888 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 516 | Open in IMG/M |
3300010360|Ga0126372_10053515 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2752 | Open in IMG/M |
3300010361|Ga0126378_10697920 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
3300010361|Ga0126378_12029611 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
3300010366|Ga0126379_10185292 | All Organisms → cellular organisms → Bacteria | 1984 | Open in IMG/M |
3300010376|Ga0126381_100323584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2121 | Open in IMG/M |
3300010391|Ga0136847_10202960 | Not Available | 507 | Open in IMG/M |
3300010391|Ga0136847_10454498 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
3300010391|Ga0136847_10537798 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
3300010391|Ga0136847_10993415 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2449 | Open in IMG/M |
3300010397|Ga0134124_11837286 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 640 | Open in IMG/M |
3300010398|Ga0126383_11002512 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
3300010398|Ga0126383_11571913 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 747 | Open in IMG/M |
3300010403|Ga0134123_11930095 | All Organisms → cellular organisms → Bacteria | 647 | Open in IMG/M |
3300011414|Ga0137442_1084850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 679 | Open in IMG/M |
3300011419|Ga0137446_1073597 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
3300011419|Ga0137446_1114222 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 648 | Open in IMG/M |
3300011436|Ga0137458_1196632 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
3300012040|Ga0137461_1181113 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 621 | Open in IMG/M |
3300012174|Ga0137338_1129287 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
3300012179|Ga0137334_1100103 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 654 | Open in IMG/M |
3300012199|Ga0137383_10052789 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2908 | Open in IMG/M |
3300012202|Ga0137363_10022852 | All Organisms → cellular organisms → Bacteria | 4219 | Open in IMG/M |
3300012203|Ga0137399_10009190 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5809 | Open in IMG/M |
3300012204|Ga0137374_10000175 | All Organisms → cellular organisms → Bacteria | 57100 | Open in IMG/M |
3300012204|Ga0137374_10051293 | All Organisms → cellular organisms → Bacteria | 4245 | Open in IMG/M |
3300012206|Ga0137380_10222730 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1705 | Open in IMG/M |
3300012226|Ga0137447_1125728 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 520 | Open in IMG/M |
3300012357|Ga0137384_10127354 | All Organisms → cellular organisms → Bacteria | 2131 | Open in IMG/M |
3300012532|Ga0137373_10065550 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3305 | Open in IMG/M |
3300012685|Ga0137397_10247282 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
3300012918|Ga0137396_10011867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Deinococcus-Thermus → Deinococci → Thermales → Thermaceae → Marinithermus → Marinithermus hydrothermalis | 5364 | Open in IMG/M |
3300012922|Ga0137394_10398628 | All Organisms → cellular organisms → Bacteria | 1173 | Open in IMG/M |
3300012922|Ga0137394_11038249 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 680 | Open in IMG/M |
3300012923|Ga0137359_10584195 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 981 | Open in IMG/M |
3300012925|Ga0137419_10318734 | All Organisms → cellular organisms → Bacteria | 1194 | Open in IMG/M |
3300012925|Ga0137419_10717963 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 812 | Open in IMG/M |
3300012927|Ga0137416_10048476 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2962 | Open in IMG/M |
3300012929|Ga0137404_10354888 | All Organisms → cellular organisms → Bacteria | 1284 | Open in IMG/M |
3300012929|Ga0137404_10518368 | All Organisms → cellular organisms → Bacteria | 1065 | Open in IMG/M |
3300012930|Ga0137407_10144052 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
3300012931|Ga0153915_11480422 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 794 | Open in IMG/M |
3300012931|Ga0153915_11582049 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 767 | Open in IMG/M |
3300012931|Ga0153915_12633522 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 588 | Open in IMG/M |
3300012948|Ga0126375_10262594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1177 | Open in IMG/M |
3300012964|Ga0153916_10020998 | All Organisms → cellular organisms → Bacteria | 5520 | Open in IMG/M |
3300012971|Ga0126369_10379110 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1446 | Open in IMG/M |
3300012971|Ga0126369_11449567 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
3300014324|Ga0075352_1049358 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 988 | Open in IMG/M |
3300014324|Ga0075352_1131952 | All Organisms → cellular organisms → Bacteria | 686 | Open in IMG/M |
3300014873|Ga0180066_1016241 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1329 | Open in IMG/M |
3300014881|Ga0180094_1039472 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.BinA052 | 983 | Open in IMG/M |
3300014884|Ga0180104_1015051 | All Organisms → cellular organisms → Bacteria | 1854 | Open in IMG/M |
3300014885|Ga0180063_1005959 | All Organisms → cellular organisms → Bacteria | 3244 | Open in IMG/M |
3300015252|Ga0180075_1011278 | All Organisms → cellular organisms → Bacteria | 1116 | Open in IMG/M |
3300015256|Ga0180073_1023479 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1152 | Open in IMG/M |
3300015358|Ga0134089_10069155 | All Organisms → cellular organisms → Bacteria | 1315 | Open in IMG/M |
3300015371|Ga0132258_11961105 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1474 | Open in IMG/M |
3300015372|Ga0132256_100464827 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1373 | Open in IMG/M |
3300017659|Ga0134083_10316026 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
3300018031|Ga0184634_10307495 | All Organisms → cellular organisms → Bacteria | 727 | Open in IMG/M |
3300018058|Ga0187766_10472161 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 841 | Open in IMG/M |
3300018063|Ga0184637_10025667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3552 | Open in IMG/M |
3300018077|Ga0184633_10014752 | All Organisms → cellular organisms → Bacteria | 3783 | Open in IMG/M |
3300018078|Ga0184612_10108732 | All Organisms → cellular organisms → Bacteria | 1452 | Open in IMG/M |
3300018079|Ga0184627_10174355 | All Organisms → cellular organisms → Bacteria | 1139 | Open in IMG/M |
3300018082|Ga0184639_10007930 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5028 | Open in IMG/M |
3300018482|Ga0066669_11230761 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 676 | Open in IMG/M |
3300020068|Ga0184649_1100060 | All Organisms → cellular organisms → Bacteria | 1447 | Open in IMG/M |
3300021063|Ga0206227_1008059 | All Organisms → cellular organisms → Bacteria | 1512 | Open in IMG/M |
3300021086|Ga0179596_10566786 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 576 | Open in IMG/M |
3300021090|Ga0210377_10099599 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1943 | Open in IMG/M |
3300021090|Ga0210377_10529722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 675 | Open in IMG/M |
3300021560|Ga0126371_10769533 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300021560|Ga0126371_10841532 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1063 | Open in IMG/M |
3300021560|Ga0126371_11177130 | All Organisms → cellular organisms → Bacteria | 904 | Open in IMG/M |
3300024330|Ga0137417_1001098 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300025001|Ga0209618_1012911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1400 | Open in IMG/M |
3300025155|Ga0209320_10057714 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1830 | Open in IMG/M |
3300025159|Ga0209619_10108390 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1651 | Open in IMG/M |
3300025160|Ga0209109_10023553 | All Organisms → cellular organisms → Bacteria | 3319 | Open in IMG/M |
3300025160|Ga0209109_10498251 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 554 | Open in IMG/M |
3300025164|Ga0209521_10392260 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 759 | Open in IMG/M |
3300025289|Ga0209002_10042922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3174 | Open in IMG/M |
3300025318|Ga0209519_10188830 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1215 | Open in IMG/M |
3300025324|Ga0209640_10472336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1026 | Open in IMG/M |
3300025558|Ga0210139_1039021 | All Organisms → cellular organisms → Bacteria | 948 | Open in IMG/M |
3300025560|Ga0210108_1043717 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
3300025569|Ga0210073_1112967 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300025905|Ga0207685_10039472 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1752 | Open in IMG/M |
3300026310|Ga0209239_1246725 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300026377|Ga0257171_1016172 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1245 | Open in IMG/M |
3300026498|Ga0257156_1050863 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
3300027527|Ga0209684_1004114 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2470 | Open in IMG/M |
3300027646|Ga0209466_1072080 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
(restricted) 3300027799|Ga0233416_10240050 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 622 | Open in IMG/M |
3300027815|Ga0209726_10065041 | All Organisms → cellular organisms → Bacteria | 2408 | Open in IMG/M |
3300027843|Ga0209798_10165781 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1102 | Open in IMG/M |
3300027846|Ga0209180_10541514 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 649 | Open in IMG/M |
3300027874|Ga0209465_10004193 | All Organisms → cellular organisms → Bacteria | 6273 | Open in IMG/M |
3300028047|Ga0209526_10171597 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1512 | Open in IMG/M |
3300028536|Ga0137415_10403537 | All Organisms → cellular organisms → Bacteria | 1171 | Open in IMG/M |
3300031545|Ga0318541_10571388 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
3300031719|Ga0306917_10010797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5251 | Open in IMG/M |
3300031720|Ga0307469_11234815 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
3300031744|Ga0306918_10125464 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1866 | Open in IMG/M |
3300031832|Ga0318499_10095446 | All Organisms → cellular organisms → Bacteria | 1147 | Open in IMG/M |
3300031834|Ga0315290_10066518 | All Organisms → cellular organisms → Bacteria | 2968 | Open in IMG/M |
3300031834|Ga0315290_10164831 | All Organisms → cellular organisms → Bacteria | 1913 | Open in IMG/M |
3300031834|Ga0315290_10751409 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.BinA052 | 837 | Open in IMG/M |
3300031834|Ga0315290_11094075 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300031965|Ga0326597_10003275 | All Organisms → cellular organisms → Bacteria | 23496 | Open in IMG/M |
3300031965|Ga0326597_10301760 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
3300031965|Ga0326597_10782151 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 992 | Open in IMG/M |
3300031965|Ga0326597_11093683 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 796 | Open in IMG/M |
3300031965|Ga0326597_11217584 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 742 | Open in IMG/M |
3300031997|Ga0315278_11517946 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
3300032163|Ga0315281_10063865 | All Organisms → cellular organisms → Bacteria | 4401 | Open in IMG/M |
3300032163|Ga0315281_10159688 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
3300032163|Ga0315281_11293865 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 723 | Open in IMG/M |
3300032164|Ga0315283_11273924 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 764 | Open in IMG/M |
3300032177|Ga0315276_10395486 | All Organisms → cellular organisms → Bacteria | 1480 | Open in IMG/M |
3300032180|Ga0307471_102303554 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 679 | Open in IMG/M |
3300032205|Ga0307472_100771216 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 874 | Open in IMG/M |
3300032205|Ga0307472_102685117 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
3300032205|Ga0307472_102744749 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300032256|Ga0315271_10189757 | Not Available | 1639 | Open in IMG/M |
3300032401|Ga0315275_11727192 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 666 | Open in IMG/M |
3300032516|Ga0315273_10575190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → unclassified Firmicutes sensu stricto → Firmicutes bacterium ADurb.BinA052 | 1498 | Open in IMG/M |
3300033233|Ga0334722_10716574 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 710 | Open in IMG/M |
3300033290|Ga0318519_10191852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1162 | Open in IMG/M |
3300033407|Ga0214472_10531048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1088 | Open in IMG/M |
3300033433|Ga0326726_10520761 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1139 | Open in IMG/M |
3300033806|Ga0314865_054604 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1029 | Open in IMG/M |
3300033807|Ga0314866_017640 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300033814|Ga0364930_0020464 | All Organisms → cellular organisms → Bacteria | 2213 | Open in IMG/M |
3300034090|Ga0326723_0568073 | Not Available | 524 | Open in IMG/M |
3300034125|Ga0370484_0035451 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1202 | Open in IMG/M |
3300034178|Ga0364934_0026498 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 2114 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 14.14% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 12.63% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 7.58% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.07% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.57% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.55% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.54% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.03% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.03% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.53% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.53% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.53% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.53% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 2.02% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 2.02% |
Sediment (Intertidal) | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment (Intertidal) | 2.02% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.52% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.52% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.01% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.01% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.01% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.01% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.01% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 1.01% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.51% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.51% |
Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.51% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.51% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.51% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.51% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.51% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.51% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.51% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.51% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
3300000597 | Forest soil microbial communities from Amazon forest - 2010 replicate II A1 | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
3300002122 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_2 | Environmental | Open in IMG/M |
3300002124 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_3 | Environmental | Open in IMG/M |
3300002243 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 | Environmental | Open in IMG/M |
3300004009 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 | Environmental | Open in IMG/M |
3300004019 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 | Environmental | Open in IMG/M |
3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
3300004281 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio | Environmental | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005829 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.190_CBC | Environmental | Open in IMG/M |
3300005833 | Microbial communities from Cathlamet Bay sediment, Columbia River estuary, Oregon - S.174_CBK | Environmental | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300011419 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT357_2 | Environmental | Open in IMG/M |
3300011436 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT642_2 | Environmental | Open in IMG/M |
3300012040 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT746_2 | Environmental | Open in IMG/M |
3300012174 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT366_2 | Environmental | Open in IMG/M |
3300012179 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT262_2 | Environmental | Open in IMG/M |
3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012964 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 4 metaG | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300014324 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleA_D1 | Environmental | Open in IMG/M |
3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
3300014881 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_1Da | Environmental | Open in IMG/M |
3300014884 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT730_16_1Da | Environmental | Open in IMG/M |
3300014885 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLIBT47_16_10D | Environmental | Open in IMG/M |
3300015252 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT399_16_10D | Environmental | Open in IMG/M |
3300015256 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT333_16_10D | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300020068 | Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300021063 | Subsurface sediment microbial communities from Mancos shale, Colorado, United States - Mancos D4 | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021090 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_b1 redo | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025001 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 3 (SPAdes) | Environmental | Open in IMG/M |
3300025155 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 4 | Environmental | Open in IMG/M |
3300025159 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 3 | Environmental | Open in IMG/M |
3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
3300025289 | Soil microbial communities from Rifle, Colorado, USA - sediment 16ft 2 | Environmental | Open in IMG/M |
3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
3300025558 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025560 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025569 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
3300026498 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-49-A | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
3300027815 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032256 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_top | Environmental | Open in IMG/M |
3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
3300033233 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottom | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
3300033806 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_50_20 | Environmental | Open in IMG/M |
3300033807 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - MAQ_100_10 | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
3300034125 | Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_tus_01_15 | Environmental | Open in IMG/M |
3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
deepsgr_00736340 | 2199352025 | Soil | MTEKRQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA |
F24TB_105826752 | 3300000550 | Soil | MTEKRQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA* |
AF_2010_repII_A1DRAFT_100992562 | 3300000597 | Forest Soil | MTEQRPSQAEVANMAGVIERLAGELALAEEPACFIVALEGEEDAAPDA* |
JGI10216J12902_1044546382 | 3300000956 | Soil | MTEKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPRRA* |
C687J26615_100049141 | 3300002121 | Soil | MEESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVDAPRDE* |
C687J26623_101252051 | 3300002122 | Soil | MEASRQQQVELANMAGIIERLAGELALGEEPGRFIAALEGLGEVEDEAPRDE* |
C687J26631_101311502 | 3300002124 | Soil | MPESRQQQVELANMAGIIERMAGELALGEEPARFIAALEGLGEDEVDAPRDE* |
C687J29039_100380502 | 3300002243 | Soil | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGPGEDTVEAPRGE* |
Ga0055437_100064793 | 3300004009 | Natural And Restored Wetlands | MAQPGQQQAELANMAGIIERLAGDLALGEEPARFIAALEAEEDTRTDD* |
Ga0055439_100448382 | 3300004019 | Natural And Restored Wetlands | MESRQQQVDLAGMASIIERLAGELALGEEPARFITALEGLGQDEREAPGDE* |
Ga0055439_101005002 | 3300004019 | Natural And Restored Wetlands | MAASRRQEQAELANMAGIIERLAGELALGEEPARFVAALEGEEDAPRDE* |
Ga0055436_101031262 | 3300004024 | Natural And Restored Wetlands | MAQPGQQQAELANMAGIIERLAGDLALGEEPARFIAALEAE |
Ga0066397_101359371 | 3300004281 | Tropical Forest Soil | MTEQRPSQAEVASMAGVIERLAGELALAEEPACFIVALEGEEDATSDG* |
Ga0062595_1003819262 | 3300004479 | Soil | MTEKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA* |
Ga0066395_100042055 | 3300004633 | Tropical Forest Soil | MTEQRSPQAEVASMAGVIERLAGELALAEEPACFIVALEGEEDAAPDA* |
Ga0066395_102404272 | 3300004633 | Tropical Forest Soil | MAERPQQQAELAGVAGAIERLAGDLALAEEPSRFIAALERESDATPEA* |
Ga0066395_107678122 | 3300004633 | Tropical Forest Soil | MAEQRRQQAEVAGMAGVIERLAGELALAEEPSCFTVALEGEDDAAPDA* |
Ga0062383_103317811 | 3300004778 | Wetland Sediment | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVEAPQNE* |
Ga0066674_101083001 | 3300005166 | Soil | MAQPGEQRAEPAKVAGVIERLAGELALGEEPACFIAVLESEEGTPRNE* |
Ga0066683_103314832 | 3300005172 | Soil | MAQPGEQRAEPAKVAGVIERLAGELALGEEPACFIAVLESEEGAPRNE* |
Ga0066676_100870972 | 3300005186 | Soil | MTDKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDE |
Ga0066388_1005857941 | 3300005332 | Tropical Forest Soil | MTEQRPQQAEVAGMAGVIERLAGELALAEEPSCFTVALEGEDDAAPDA* |
Ga0066388_1025488711 | 3300005332 | Tropical Forest Soil | MAEQRPQQAEVAGMAGVIERLAGELALAEEPACFIVALEGEEDAAPDA* |
Ga0066388_1081135202 | 3300005332 | Tropical Forest Soil | MAEQRPQQAEVAGMAGVIERLAGELALSEEPSCFTVALESEDDAAPDA* |
Ga0008090_150095922 | 3300005363 | Tropical Rainforest Soil | MTEQRPSQAEVANMAGVIELLAGELALAEEPACFIVALEGEEDAAPDA* |
Ga0070708_1003457723 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MAEIDGRLAELGRMAGIIERLAGELALAEEPAGFIAALEAEEEATVDE* |
Ga0070708_1003870232 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDKQQHQAERASMLGVIERLAGELALAEEPARFIAALEGEAEARPRA* |
Ga0066686_108530052 | 3300005446 | Soil | MTDKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRV* |
Ga0068867_1018336922 | 3300005459 | Miscanthus Rhizosphere | MTEKQQQPAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA* |
Ga0070706_1002385132 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDKQQHQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA* |
Ga0070699_1020227741 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MTQTGERRSEPAKVAGVIERLAGELALGEEPARFIAVLEGEEATPRDE* |
Ga0066695_100777042 | 3300005553 | Soil | MTDKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA* |
Ga0066905_1000839083 | 3300005713 | Tropical Forest Soil | MTEQRPQRAEVAGMAGVIERLAGELALAEEPSCFTVALEGEDDAAPDA* |
Ga0066905_1003300441 | 3300005713 | Tropical Forest Soil | EDPMTEQRPSQAEVANMAGVIERLAGELALAEEPACFIVALEGEEDAAPDA* |
Ga0066903_1046333272 | 3300005764 | Tropical Forest Soil | MTEQRPPQAEVASMAGVIERLAGELALAEEPACFIVALEGEEDAAPDV* |
Ga0074479_105225801 | 3300005829 | Sediment (Intertidal) | MAGIIERLAGELALGEEPARFIAALEDLGLGLGEDEDEDDVEAPRDE* |
Ga0074479_107279682 | 3300005829 | Sediment (Intertidal) | MAESGQQRAELANMAGIIERLAGDLALGEEPARFAAALEAEADARPDE* |
Ga0074479_108466462 | 3300005829 | Sediment (Intertidal) | MSETRQQQAELAGLAGVIERLAGELSLAEEPARFVAALEGEESAPPHA* |
Ga0074472_109326642 | 3300005833 | Sediment (Intertidal) | MVESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVEAPRDE* |
Ga0066656_108879591 | 3300006034 | Soil | TDKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA* |
Ga0070715_101627282 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGVDEAPPRA* |
Ga0099791_100922401 | 3300007255 | Vadose Zone Soil | MTQLGEQRAEPAKIAGVIGRLAGELALGEEPACFI |
Ga0099793_102467252 | 3300007258 | Vadose Zone Soil | MTQLGEQRAEPAKMAGGIGRLAGELALGEEPACFIAVLEGEEGTPRDE* |
Ga0066710_1006115002 | 3300009012 | Grasslands Soil | MAQPGEQRAEPAKVAGVIERLAGELALGEEPACFIAVLESEEATPRDE |
Ga0099829_102040001 | 3300009038 | Vadose Zone Soil | MTQLGEQRAEPAKMAGVIGRLTGELALGEEPACFIAVLESEEGTPRDE* |
Ga0099829_109848762 | 3300009038 | Vadose Zone Soil | MTQLGEQRAEPAKMAGVIGRLAGELALGEEPACFIAVLESEEGTPRDE* |
Ga0099827_109669192 | 3300009090 | Vadose Zone Soil | MSEKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGGDEAPSDA* |
Ga0126374_100299293 | 3300009792 | Tropical Forest Soil | MTERRPQQAEVAGMAGVIERLAGELALAEEPSCFTVALEGEDDAAPDA* |
Ga0126374_101784371 | 3300009792 | Tropical Forest Soil | PQAEVASMAGVIERLAGELALAEEPACFIVALEGEEDAAPDV* |
Ga0126374_103580641 | 3300009792 | Tropical Forest Soil | MAEQRPQQAEVAGMAGVIERLAGELALAEEPSCFTVALEGEDDAAPDA* |
Ga0126374_118366971 | 3300009792 | Tropical Forest Soil | MAQPWEQQAQLAGLIGAIERLAADLALGEEPARFTAALEGEEEAPEDA* |
Ga0126380_100718682 | 3300010043 | Tropical Forest Soil | MTEQRPQQAEVAGMAGVIERLAGELALAEEPACFIVALEGEEDATSDG* |
Ga0126384_103090691 | 3300010046 | Tropical Forest Soil | MTEQRPPQAEVASMAGVIERLGGELALAEEPACFIVALEGEEDAAPDA* |
Ga0126382_102839082 | 3300010047 | Tropical Forest Soil | MAERAQQQAELAGVAGAIERLAGDLALAEEPSRFIAALERESDATPEA* |
Ga0126382_125144262 | 3300010047 | Tropical Forest Soil | MTGQRPQQAEVAGMAGVIERLAGELALAEEPSCFTVALEGEDDAAPDA* |
Ga0126373_101958701 | 3300010048 | Tropical Forest Soil | MAEQRPQQAEVAGMAGLIERLAGELALAEEPSCFTVALEGEDDAAPDA* |
Ga0134088_106505602 | 3300010304 | Grasslands Soil | MTDKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEA |
Ga0126370_103296932 | 3300010358 | Tropical Forest Soil | MAEQRPQQAEVAGLAGVIERLAGELALAEEPSCFIVALEGEEDAAPDA* |
Ga0126376_109777552 | 3300010359 | Tropical Forest Soil | MAEQRPQQAEVAGMAGVIQRLAGELALAEEPACFMVVLEGGEDAAPDA* |
Ga0126376_130758881 | 3300010359 | Tropical Forest Soil | QAEVAGMAGVIERLAGELALAEEPACFIVALEGEEDATSDG* |
Ga0126372_100535153 | 3300010360 | Tropical Forest Soil | MAEQRPQQAEVAGMAGVIERLAGELALSEEPSCFTVALESEADAAPDA* |
Ga0126378_106979202 | 3300010361 | Tropical Forest Soil | MAEQRPQQAEVAGMAGVIERLAGELALAEEPACFMVVLEGGEDAAPDA* |
Ga0126378_120296111 | 3300010361 | Tropical Forest Soil | MTEQRSPQAEVASMAGVIERLAGELALAEEPACFIVALEGEE |
Ga0126379_101852921 | 3300010366 | Tropical Forest Soil | MTEQRPPQAEVASMAGVIERLAGELALAEEPACFMVVLEGGEDAAPD |
Ga0126381_1003235843 | 3300010376 | Tropical Forest Soil | MTEQRSPQAEVASMAGVIERLAGELALAEEPACFIVALEGEEDAAP |
Ga0136847_102029602 | 3300010391 | Freshwater Sediment | MTESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGLGEDEAEVEAPRDE* |
Ga0136847_104544982 | 3300010391 | Freshwater Sediment | MAESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGLGLGLGEDEDEDEDEVEAPR |
Ga0136847_105377982 | 3300010391 | Freshwater Sediment | MTESPQHQVELANMAGIIERLAGELALGEEPARFIAALEEVGEDELEAPRDE* |
Ga0136847_109934153 | 3300010391 | Freshwater Sediment | MTESRLHQVELASMAGIIERLAGELALDEEPARFIAALEGLGLGEDEAEVEAPPDE* |
Ga0134124_118372861 | 3300010397 | Terrestrial Soil | EKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA* |
Ga0126383_110025122 | 3300010398 | Tropical Forest Soil | MAEQRPQQAEVAGMAGVIERLAGELALAEEPACFIVVLEGGEDAAPDA* |
Ga0126383_115719132 | 3300010398 | Tropical Forest Soil | EKEDPMTERRPQQAEVAGMAGVIERLAGELALAEEPSCFTVALEGEDDAAPDA* |
Ga0134123_119300953 | 3300010403 | Terrestrial Soil | MTEKQQQQAERASMLAVIERLAGELALAEEPARFIAALEGEDEAPPRA* |
Ga0137442_10848502 | 3300011414 | Soil | MTESRQHQVELANMASIIERLAGELALGEEPARFIAALEGEVEAPRDE* |
Ga0137446_10735971 | 3300011419 | Soil | MTESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVEAPRDE* |
Ga0137446_11142222 | 3300011419 | Soil | IERLAGELALGEEPARFIAALEGVGLGEDEAEVEASGDE* |
Ga0137458_11966322 | 3300011436 | Soil | MTETRQQQAELASLAGVIERLAGELALAEEPARFIAALEGE |
Ga0137461_11811131 | 3300012040 | Soil | MTESRQDQVELANMAGIIERLAGELALGEEPARFIAALEGVDLGFGG* |
Ga0137338_11292872 | 3300012174 | Soil | MTESREQQVELANMAGIIERLAGELALGEEPARFIAALEGLVEGLGEDEVEAPRDE* |
Ga0137334_11001032 | 3300012179 | Soil | MTESRQDQVELANMAGIIERLAGELALGEEPARFIAALEGLGEHEDEDEVEAPRDE* |
Ga0137383_100527894 | 3300012199 | Vadose Zone Soil | MTQLGEQRAEPAKMAGVIGRLAGELALGEEPACFIAVLEGEEGTPRDE* |
Ga0137363_100228524 | 3300012202 | Vadose Zone Soil | MSEKRQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPSDA* |
Ga0137399_100091902 | 3300012203 | Vadose Zone Soil | MTQLGEQRAEPAKMAGVIGRLAGELALGEEPACFIAVLEGEEATPRDE* |
Ga0137374_100001756 | 3300012204 | Vadose Zone Soil | MTQPGQQRVELAEMAGIIERLAGELALGEEPARFVAVLEGEEDTPRDE* |
Ga0137374_100512934 | 3300012204 | Vadose Zone Soil | MTEERQQAERASMLGVIERLAGELALAEEPARFIAALEGEEEASSDA* |
Ga0137380_102227302 | 3300012206 | Vadose Zone Soil | MSERAQAQAERAGMLGVIERLAGELALAEEPARFIAALEGEEEAPSDA* |
Ga0137447_11257282 | 3300012226 | Soil | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVEVEAPGDE* |
Ga0137384_101273542 | 3300012357 | Vadose Zone Soil | MSERAQAQAERAGMLGVIERLAGELALAEEPARFIAALESEEEVPSDA* |
Ga0137373_100655504 | 3300012532 | Vadose Zone Soil | MTEKRQQAERASMLGVIERLAGELALAEEPARFIAALEGEEEASSDA* |
Ga0137397_102472822 | 3300012685 | Vadose Zone Soil | MPDTRQQQAEMASLAGVIERLAGELALAEEPARFIAALEAEEDTSPDA* |
Ga0137396_100118676 | 3300012918 | Vadose Zone Soil | MTQTGERRAEPAKMAGVIGRLAGELALGEEPACFIAVLESEEGTPRDE* |
Ga0137394_103986283 | 3300012922 | Vadose Zone Soil | MPDTRQQQAEMASLAGVIERLAGELALAEEPARFIAALEAEEDTPPDA* |
Ga0137394_110382492 | 3300012922 | Vadose Zone Soil | MAQPGEQRAEPAKVPGVIERLAGEIELGEEPARFIAVLEGEGGAPRDE* |
Ga0137359_105841952 | 3300012923 | Vadose Zone Soil | MTQTGEQRAESAKMAGVIGRLAGELALGEEPACFIAVLEGEEGTPRDE* |
Ga0137419_103187342 | 3300012925 | Vadose Zone Soil | MTQLGEQRAEPAKMAGVIARLAGELALGEEPACFIAVLESE |
Ga0137419_107179631 | 3300012925 | Vadose Zone Soil | MAQSGEQRAEPAKVAGVIERLAGELALGEEPACFIAVLESEEGTPRDE* |
Ga0137416_100484764 | 3300012927 | Vadose Zone Soil | MTQLGEQRAEPTKMAGVIGRLAGELALGEEPACFIAVLEGEEGTPRDE* |
Ga0137404_103548882 | 3300012929 | Vadose Zone Soil | MSERAQQQAERASMLGVIERLAGELALAEEPARFIAALEGEEEAPSDA* |
Ga0137404_105183682 | 3300012929 | Vadose Zone Soil | MSEQRQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA* |
Ga0137407_101440522 | 3300012930 | Vadose Zone Soil | MSEQRQQQAERASMLGVIERLAGELALAEEPARFIAALEGEGEAPSDA* |
Ga0153915_114804222 | 3300012931 | Freshwater Wetlands | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVEAPRDE* |
Ga0153915_115820492 | 3300012931 | Freshwater Wetlands | MAESREQQVELANMAGIIERLAGELALAEEPARFIAALEGRGEDEVEAPRDE* |
Ga0153915_126335221 | 3300012931 | Freshwater Wetlands | IIERLAGELALGEEPARFIAALEGLGEDEVEAPRDE* |
Ga0126375_102625942 | 3300012948 | Tropical Forest Soil | MTEQRPSQAEVASIAGVIERLAGELALAEEPACFIVALEGEEDATSDG* |
Ga0153916_100209985 | 3300012964 | Freshwater Wetlands | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGEKDAPRDE* |
Ga0126369_103791101 | 3300012971 | Tropical Forest Soil | MTEQRPQQAEVAGMAGVIERLAGELALTEEPSCFTVALEGEDDAAPDA* |
Ga0126369_114495671 | 3300012971 | Tropical Forest Soil | EEREVPMAERPQQQAELAGVAGAIERLAGDLALAEEPSRFIAALERESDATPEA* |
Ga0075352_10493582 | 3300014324 | Natural And Restored Wetlands | EQAELANMAGIIERLAGELALGEEPARFVAALEGEEDAPRDE* |
Ga0075352_11319522 | 3300014324 | Natural And Restored Wetlands | MAESGQQRAELANMAGIIERLAGELALGEEPARFIAALEGLGEDEGEDVDEV |
Ga0180066_10162412 | 3300014873 | Soil | NMAGIIERLAGELALGEEPARFIAALEGLGLGEDEAEVEAPGDE* |
Ga0180094_10394722 | 3300014881 | Soil | MTQPKENQVELANMAGIIERLAGELALGEEPARFIAALEGEEQVPRDE* |
Ga0180104_10150513 | 3300014884 | Soil | EREGIMTESRQHQVELANMAGIIERLAGEIALGEEPARFIAALEGLGEDEVEAPRDE* |
Ga0180063_10059592 | 3300014885 | Soil | MTESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVEAPGDE* |
Ga0180075_10112782 | 3300015252 | Soil | MTESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGEGEDEAPRDE* |
Ga0180073_10234792 | 3300015256 | Soil | MTESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGLPEAEVDDEEEAPRDE* |
Ga0134089_100691552 | 3300015358 | Grasslands Soil | MTDKQQQQAERVSMMGAIERLAGELALAEEPARFIAALEGEDEAPPRV* |
Ga0132258_119611052 | 3300015371 | Arabidopsis Rhizosphere | MTEKQQRQAERANMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA* |
Ga0132256_1004648272 | 3300015372 | Arabidopsis Rhizosphere | MTEKRQQQAERASMLGVIEGLAGELALAEEPARFIAALEGEDEAPPRA* |
Ga0134083_103160262 | 3300017659 | Grasslands Soil | MTDKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRV |
Ga0184634_103074952 | 3300018031 | Groundwater Sediment | MAESRQNQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVEALRDE |
Ga0187766_104721612 | 3300018058 | Tropical Peatland | VTDPTKPRADLAHMAGIIERLAGELALGEEPARFVAALEGEEDSPADD |
Ga0184637_100256674 | 3300018063 | Groundwater Sediment | MAGIIERLEGELALGKEPARFIAALEGLGEDEVEAPGDE |
Ga0184633_100147523 | 3300018077 | Groundwater Sediment | MTDSRQHQVELANMAGIIQRLAGELALGEEPARFIAALEGLGLGEDEAEVEAPRDE |
Ga0184612_101087322 | 3300018078 | Groundwater Sediment | MTQPRENQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVEAPGDE |
Ga0184627_101743552 | 3300018079 | Groundwater Sediment | MTESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGLGEAEG |
Ga0184639_100079305 | 3300018082 | Groundwater Sediment | HQVELANMAGIIERLEGELALGEEPARFIAALEGLGLGEDEAEVEAPRDE |
Ga0066669_112307611 | 3300018482 | Grasslands Soil | MTQLGEQRAEPTKMAGVIGRLAGELALGEEPACFIAVLEGVEGTPRDE |
Ga0184649_11000602 | 3300020068 | Groundwater Sediment | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEIEAPRDE |
Ga0206227_10080592 | 3300021063 | Deep Subsurface Sediment | MTESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGLGEDEDEVEAPRDE |
Ga0179596_105667862 | 3300021086 | Vadose Zone Soil | MTQLGEQRAEPAKMAGVIGRLTGELALGEEPACFIAVLESEEGTPRDE |
Ga0210377_100995992 | 3300021090 | Groundwater Sediment | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGPGEDEVEALRDE |
Ga0210377_105297222 | 3300021090 | Groundwater Sediment | MTESGQHQVELANMAGIIERLAGELALGEEPARFIAALEGLGLGEDEDEVEAPRDE |
Ga0126371_107695332 | 3300021560 | Tropical Forest Soil | MTEQRSPQAEVASMAGVIERLAGELALAEEPACFIVALEGEEDAAPDA |
Ga0126371_108415321 | 3300021560 | Tropical Forest Soil | MTERRPQQAEVAGMAGVIERLAGELALAEEPSCFTVALEGEDDAAPDA |
Ga0126371_111771302 | 3300021560 | Tropical Forest Soil | MAEQRPQQAEVAGMAGVIERLAGELALAEEPACFMVVLEGGEDAAPDA |
Ga0137417_10010981 | 3300024330 | Vadose Zone Soil | MTQLGEQRAEPTKMAGVIGRLAGELALGEEPACFIAVLEGEEGTPRDE |
Ga0209618_10129112 | 3300025001 | Soil | MEESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGPGEDTVEAPRGE |
Ga0209320_100577142 | 3300025155 | Soil | MPESRQQQVELANMAGIIERMAGELALGEEPARFIAALEGLGEDEDEAPRDE |
Ga0209619_101083902 | 3300025159 | Soil | ESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEDEAPRDE |
Ga0209109_100235532 | 3300025160 | Soil | MEESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEDEAPRDE |
Ga0209109_104982512 | 3300025160 | Soil | MTESRQHQVELANMAGLIERLAGELALGEEPARFIAALEGEEEEGPRDE |
Ga0209521_103922602 | 3300025164 | Soil | MEESRQQQVELANMAGIIERMAGELALGEEPARFIAALEGLGEDEDEAPRDE |
Ga0209002_100429221 | 3300025289 | Soil | VELANMAGIIERLAGELALGEEPARFIAALEGLGEDEDEAPRDE |
Ga0209519_101888302 | 3300025318 | Soil | MEESRQQQVELANMAGIIERMAGELALGEEPARFIAALEGLGEDEVDAPRDE |
Ga0209640_104723362 | 3300025324 | Soil | MTQPREHRVELANMAGIIERLAGELALGEEPARFIAALEGEEDAPRDE |
Ga0210139_10390212 | 3300025558 | Natural And Restored Wetlands | MAASRRQEQAELANMAGIIERLAGELALGEEPARFVAALEGEEDAPRDE |
Ga0210108_10437171 | 3300025560 | Natural And Restored Wetlands | MAQPGQQQAELANMAGIIERLAGDLALGEEPARFIAALEAEEDTR |
Ga0210073_11129672 | 3300025569 | Natural And Restored Wetlands | MAQPGQQQAELANMAGIIERLAGDLALGEEPARFIAALEAEEDTRTDD |
Ga0207685_100394722 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEKQQQQAERASMLGVIERLAGELALAEEPARFIAALEGVDEAPPRA |
Ga0209239_12467252 | 3300026310 | Grasslands Soil | MTQLGEQRAEPTKMAGVIGRLAGELALGEEPACFIAVLESEEGTPRDE |
Ga0257171_10161721 | 3300026377 | Soil | MSEQRQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPSDA |
Ga0257156_10508631 | 3300026498 | Soil | MTQTGERRSEPAKVAGVIGRLAGELALSEEPACFIAVLES |
Ga0209684_10041144 | 3300027527 | Tropical Forest Soil | EQRPSQAEVANMAGVIERLAGELALAEEPACFIVALEGEEDAAPDA |
Ga0209466_10720802 | 3300027646 | Tropical Forest Soil | MTEQRPSQAEVASMAGVIERLAGELALAEEPACFIVALEGEEDATSDG |
(restricted) Ga0233416_102400501 | 3300027799 | Sediment | MTGPTEQQAALASMAGIIERLAGELALAEEPARFIAALEEAGADETDGPRNG |
Ga0209726_100650412 | 3300027815 | Groundwater | MTESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGEEEEEPRDE |
Ga0209798_101657812 | 3300027843 | Wetland Sediment | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVEAPQNE |
Ga0209180_105415142 | 3300027846 | Vadose Zone Soil | MTQVGEQRAEPAKMAGVIGRLTGELALGEEPACFIAVLESEEGTPRDE |
Ga0209465_100041936 | 3300027874 | Tropical Forest Soil | MAEQRRQQAEVAGMAGVIERLAGELALAEEPSCFTLALEGEDDAAPD |
Ga0209526_101715972 | 3300028047 | Forest Soil | MTDTRQQQAEVASLVGVTERLAGELALAEEPARFIAALEAKEDAPPDA |
Ga0137415_104035371 | 3300028536 | Vadose Zone Soil | MTQLGEQRAEPAKMAGVIGRLAGELALGEEPACFIAVLESEEGTPRDE |
Ga0318541_105713881 | 3300031545 | Soil | MTEQRPSQAEVANMAGVIERLAGELALAEEPACFIVALEGEEDAAHDA |
Ga0306917_100107976 | 3300031719 | Soil | TEQRPSQAEVANMAGVIERLAGELALAEEPACFIVALEGEEDAAPDA |
Ga0307469_112348152 | 3300031720 | Hardwood Forest Soil | MTEEQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA |
Ga0306918_101254643 | 3300031744 | Soil | GREKEDPMPEQRPSQAEVANMAGVIERLAGELALAEEPACFIVALEGEEDAAPDA |
Ga0318499_100954461 | 3300031832 | Soil | MTEQRPSQAEVANMAGVIERLAGELALAEEPACFIVALE |
Ga0315290_100665184 | 3300031834 | Sediment | MTETRQQQAELAGLAGVIERLAGELSLAEEPARFIAALEGEESAPPNA |
Ga0315290_101648312 | 3300031834 | Sediment | MTESRQHQVELANMASIIERLAGELALGEEPARFIAALEGLGLGEDEVEVEAPRDE |
Ga0315290_107514091 | 3300031834 | Sediment | ASIIERLAGELALGEEPARFIAALEGLGLGEDEEEDEAEAPRDE |
Ga0315290_110940752 | 3300031834 | Sediment | MAESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEDEAPRGE |
Ga0326597_1000327513 | 3300031965 | Soil | MAESRQQQVELASMAGIIERLAGELGLGEEPACFIAALESEEDAPRDE |
Ga0326597_103017603 | 3300031965 | Soil | MTQPREHQVELANMAGIIERLAGELGLGEEPARFIAALEGLGEEDAPRDE |
Ga0326597_107821512 | 3300031965 | Soil | MEESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEDEAARDE |
Ga0326597_110936832 | 3300031965 | Soil | MIQPREHQVELANMAGIIERLAGELGLGEEPARFIAALEGLGEDEDEAPRDE |
Ga0326597_112175842 | 3300031965 | Soil | MAESRQQQVELANMAGIIERLAGELALGEEPGRFIAALEGLGEVEDEAPRDE |
Ga0315278_115179462 | 3300031997 | Sediment | MAESRQHQVELANMAGIIERLAGELALGEEPARFIAVLEGLGEDEDEAEAPRDE |
Ga0315281_100638652 | 3300032163 | Sediment | MKESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGVGLGEDEAEVEAPRDE |
Ga0315281_101596882 | 3300032163 | Sediment | MTQPRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEVGAPLDE |
Ga0315281_112938651 | 3300032163 | Sediment | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEDEAPRDD |
Ga0315283_112739242 | 3300032164 | Sediment | MTESRQDQVELANMASIIERLAGELALGEEPARFIAALEGLGLGEDEDEDEAEAPRDE |
Ga0315276_103954862 | 3300032177 | Sediment | MTESRQDQVELANMASIIERLAGELALGEEPARFIAALEGLGLGEDEEEDEAEAPRDE |
Ga0307471_1023035541 | 3300032180 | Hardwood Forest Soil | EREVPMTEEQQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPRA |
Ga0307472_1007712161 | 3300032205 | Hardwood Forest Soil | HQAERASMLGVIERLAGELALAEEPARFIAALEGEAEAPPRA |
Ga0307472_1026851172 | 3300032205 | Hardwood Forest Soil | MTEKRQQQAERASMLGVIERLAGELALAEEPARFIAALEGEDEAPPR |
Ga0307472_1027447492 | 3300032205 | Hardwood Forest Soil | MTEKQQQQAERASMLGVIERLAGELALAEEPARFITALEGEAEAPPRA |
Ga0315271_101897571 | 3300032256 | Sediment | REREVPMTETRQQQAELAGLAGVIERLAGELSLAEEPARFIAALEGEESAPPNA |
Ga0315275_117271922 | 3300032401 | Sediment | MTESRQHQVELANMASIIERLAGELALGEEPARFIAALEGLGLGEDEEEDEAEAPRDE |
Ga0315273_105751901 | 3300032516 | Sediment | QVELANMASIIERLGGELALGEEPARFIAALEGLGLGEDEEEDEAEAPRDE |
Ga0334722_107165742 | 3300033233 | Sediment | MTESRQHQVELANMAGIIERLAGELALGEEPARFIAALEDLGLGEDEAEVEAPRDE |
Ga0318519_101918522 | 3300033290 | Soil | MTEQRPSHAEVANMAGVIERLAGELALAEEPACFIVALEGEEDAAPDA |
Ga0214472_105310482 | 3300033407 | Soil | MEESRQPQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEDEAPRDE |
Ga0326726_105207612 | 3300033433 | Peat Soil | MAESRQQQVELANMAGIIERLAGELALGEEPARFIAALEGLGEDEEEAPQDE |
Ga0314865_054604_789_911 | 3300033806 | Peatland | VDLAHLAGIIERLAGELALGEEPARFVAALEGEEDAPGDD |
Ga0314866_017640_757_903 | 3300033807 | Peatland | MTERPQQQAELAGLAGAIERLAGDLALAEEPARFIVALEREGDATPEA |
Ga0364930_0020464_611_781 | 3300033814 | Sediment | MTESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGLGLGEDEAEVEAPGDE |
Ga0326723_0568073_181_339 | 3300034090 | Peat Soil | MAESREPQVELANMAGIIERLAGELALAEEPARFIAALEGLGEDEVEAPRDE |
Ga0370484_0035451_902_1072 | 3300034125 | Untreated Peat Soil | MTESRQHQVELANMAGIIERLAGELALGEEPARFIAALEGLGLGEDEDEVEAPRDE |
Ga0364934_0026498_1341_1511 | 3300034178 | Sediment | MTESRQHQVELANMAGIIERLAGELGLGEEPARFIAALEGLGLGEDEAEVEAPGDE |
⦗Top⦘ |