| Basic Information | |
|---|---|
| Family ID | F026350 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 198 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILAS |
| Number of Associated Samples | 163 |
| Number of Associated Scaffolds | 198 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 100.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.49 % |
| % of genes from short scaffolds (< 2000 bps) | 90.91 % |
| Associated GOLD sequencing projects | 156 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (92.424 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (26.263 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.778 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (44.949 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 38.89% β-sheet: 0.00% Coil/Unstructured: 61.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 198 Family Scaffolds |
|---|---|---|
| PF14031 | D-ser_dehydrat | 68.18 |
| PF13561 | adh_short_C2 | 17.68 |
| PF00106 | adh_short | 1.52 |
| PF04199 | Cyclase | 1.01 |
| PF11139 | SfLAP | 1.01 |
| PF02782 | FGGY_C | 0.51 |
| PF01557 | FAA_hydrolase | 0.51 |
| PF00324 | AA_permease | 0.51 |
| PF13466 | STAS_2 | 0.51 |
| PF14486 | DUF4432 | 0.51 |
| PF00296 | Bac_luciferase | 0.51 |
| PF08445 | FR47 | 0.51 |
| PF07582 | Obsolete Pfam Family | 0.51 |
| PF13602 | ADH_zinc_N_2 | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 198 Family Scaffolds |
|---|---|---|---|
| COG1878 | Kynurenine formamidase | Amino acid transport and metabolism [E] | 1.01 |
| COG0531 | Serine transporter YbeC, amino acid:H+ symporter family | Amino acid transport and metabolism [E] | 0.51 |
| COG0833 | Amino acid permease | Amino acid transport and metabolism [E] | 0.51 |
| COG1113 | L-asparagine transporter or related permease | Amino acid transport and metabolism [E] | 0.51 |
| COG1115 | Na+/alanine symporter | Amino acid transport and metabolism [E] | 0.51 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 92.93 % |
| Unclassified | root | N/A | 7.07 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352025|deepsgr__Contig_97210 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101277745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 625 | Open in IMG/M |
| 3300004063|Ga0055483_10011421 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2391 | Open in IMG/M |
| 3300004091|Ga0062387_101479598 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 544 | Open in IMG/M |
| 3300004092|Ga0062389_103125866 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 620 | Open in IMG/M |
| 3300004092|Ga0062389_103213042 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300004479|Ga0062595_101234153 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 667 | Open in IMG/M |
| 3300005169|Ga0066810_10058429 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 772 | Open in IMG/M |
| 3300005332|Ga0066388_101585732 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300005332|Ga0066388_102979570 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300005332|Ga0066388_103779377 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 773 | Open in IMG/M |
| 3300005332|Ga0066388_105799805 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005363|Ga0008090_15877708 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300005436|Ga0070713_100532199 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1111 | Open in IMG/M |
| 3300005437|Ga0070710_10255766 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1127 | Open in IMG/M |
| 3300005440|Ga0070705_101454693 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 573 | Open in IMG/M |
| 3300005451|Ga0066681_10445746 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300005455|Ga0070663_100462076 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300005458|Ga0070681_11572409 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 583 | Open in IMG/M |
| 3300005468|Ga0070707_101303694 | All Organisms → cellular organisms → Bacteria | 692 | Open in IMG/M |
| 3300005471|Ga0070698_100671455 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 978 | Open in IMG/M |
| 3300005518|Ga0070699_100924927 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 799 | Open in IMG/M |
| 3300005530|Ga0070679_100515110 | All Organisms → cellular organisms → Bacteria | 1140 | Open in IMG/M |
| 3300005610|Ga0070763_10737894 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300005764|Ga0066903_103922682 | All Organisms → cellular organisms → Bacteria | 798 | Open in IMG/M |
| 3300005842|Ga0068858_100947176 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 843 | Open in IMG/M |
| 3300005844|Ga0068862_101875305 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300006175|Ga0070712_100009098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Rhodospirillaceae → Dongia → unclassified Dongia → Dongia sp. URHE0060 | 6254 | Open in IMG/M |
| 3300006176|Ga0070765_102122806 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 525 | Open in IMG/M |
| 3300006176|Ga0070765_102204310 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300006577|Ga0074050_10001812 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1166 | Open in IMG/M |
| 3300006806|Ga0079220_10740254 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300006852|Ga0075433_11528397 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 576 | Open in IMG/M |
| 3300006854|Ga0075425_101197210 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300006904|Ga0075424_100991043 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 896 | Open in IMG/M |
| 3300006954|Ga0079219_10456650 | All Organisms → cellular organisms → Bacteria | 874 | Open in IMG/M |
| 3300009012|Ga0066710_103606249 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300009093|Ga0105240_11139002 | All Organisms → cellular organisms → Bacteria | 829 | Open in IMG/M |
| 3300009148|Ga0105243_10191873 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300009522|Ga0116218_1390846 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 621 | Open in IMG/M |
| 3300009545|Ga0105237_11587882 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 661 | Open in IMG/M |
| 3300009553|Ga0105249_11064035 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 879 | Open in IMG/M |
| 3300009792|Ga0126374_10277004 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300010047|Ga0126382_10845431 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 785 | Open in IMG/M |
| 3300010047|Ga0126382_11420855 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300010047|Ga0126382_12036343 | All Organisms → cellular organisms → Archaea | 547 | Open in IMG/M |
| 3300010048|Ga0126373_10117453 | All Organisms → cellular organisms → Bacteria | 2483 | Open in IMG/M |
| 3300010048|Ga0126373_13017045 | Not Available | 525 | Open in IMG/M |
| 3300010325|Ga0134064_10197225 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300010358|Ga0126370_10243119 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1390 | Open in IMG/M |
| 3300010359|Ga0126376_10089191 | All Organisms → cellular organisms → Bacteria | 2318 | Open in IMG/M |
| 3300010359|Ga0126376_11167955 | All Organisms → cellular organisms → Bacteria | 782 | Open in IMG/M |
| 3300010359|Ga0126376_12425994 | Not Available | 571 | Open in IMG/M |
| 3300010360|Ga0126372_11801088 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 655 | Open in IMG/M |
| 3300010361|Ga0126378_11479399 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 770 | Open in IMG/M |
| 3300010362|Ga0126377_11459996 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300010366|Ga0126379_12124890 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 663 | Open in IMG/M |
| 3300010376|Ga0126381_100490979 | Not Available | 1730 | Open in IMG/M |
| 3300010376|Ga0126381_100666303 | Not Available | 1486 | Open in IMG/M |
| 3300010376|Ga0126381_103159843 | Not Available | 652 | Open in IMG/M |
| 3300010403|Ga0134123_12292248 | Not Available | 603 | Open in IMG/M |
| 3300010867|Ga0126347_1529040 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1239 | Open in IMG/M |
| 3300010880|Ga0126350_10226426 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 634 | Open in IMG/M |
| 3300010880|Ga0126350_11332083 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 821 | Open in IMG/M |
| 3300012189|Ga0137388_10206707 | All Organisms → cellular organisms → Bacteria | 1771 | Open in IMG/M |
| 3300012201|Ga0137365_10008456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 8198 | Open in IMG/M |
| 3300012209|Ga0137379_10410877 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1263 | Open in IMG/M |
| 3300012349|Ga0137387_10799994 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300012960|Ga0164301_11184215 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 613 | Open in IMG/M |
| 3300012984|Ga0164309_11894111 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 511 | Open in IMG/M |
| 3300014166|Ga0134079_10754445 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 502 | Open in IMG/M |
| 3300016341|Ga0182035_10508048 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1030 | Open in IMG/M |
| 3300016341|Ga0182035_10982059 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 748 | Open in IMG/M |
| 3300017924|Ga0187820_1157655 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 687 | Open in IMG/M |
| 3300017943|Ga0187819_10174702 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1274 | Open in IMG/M |
| 3300017959|Ga0187779_10696138 | All Organisms → cellular organisms → Bacteria | 687 | Open in IMG/M |
| 3300017966|Ga0187776_10486457 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 842 | Open in IMG/M |
| 3300017974|Ga0187777_10651906 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 744 | Open in IMG/M |
| 3300018001|Ga0187815_10017135 | All Organisms → cellular organisms → Bacteria | 3135 | Open in IMG/M |
| 3300018001|Ga0187815_10213086 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 818 | Open in IMG/M |
| 3300018060|Ga0187765_11080264 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 555 | Open in IMG/M |
| 3300018431|Ga0066655_10961138 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 588 | Open in IMG/M |
| 3300019890|Ga0193728_1027492 | All Organisms → cellular organisms → Bacteria | 2835 | Open in IMG/M |
| 3300020002|Ga0193730_1070402 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 996 | Open in IMG/M |
| 3300020080|Ga0206350_10076236 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 986 | Open in IMG/M |
| 3300020140|Ga0179590_1046599 | Not Available | 1109 | Open in IMG/M |
| 3300020199|Ga0179592_10088347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1423 | Open in IMG/M |
| 3300020580|Ga0210403_10405628 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1113 | Open in IMG/M |
| 3300020580|Ga0210403_10869007 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300020581|Ga0210399_10287523 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1372 | Open in IMG/M |
| 3300020583|Ga0210401_11017039 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 687 | Open in IMG/M |
| 3300021168|Ga0210406_10955632 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 641 | Open in IMG/M |
| 3300021171|Ga0210405_10420711 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1051 | Open in IMG/M |
| 3300021171|Ga0210405_10637314 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 828 | Open in IMG/M |
| 3300021180|Ga0210396_11517575 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 550 | Open in IMG/M |
| 3300021402|Ga0210385_11425911 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 529 | Open in IMG/M |
| 3300021445|Ga0182009_10478092 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300021478|Ga0210402_10641361 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 983 | Open in IMG/M |
| 3300021478|Ga0210402_11129017 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 711 | Open in IMG/M |
| 3300021560|Ga0126371_11548728 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300021560|Ga0126371_12266980 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 656 | Open in IMG/M |
| 3300025504|Ga0208356_1008885 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300025898|Ga0207692_10992125 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 554 | Open in IMG/M |
| 3300025906|Ga0207699_11290737 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 540 | Open in IMG/M |
| 3300025910|Ga0207684_10955954 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300025912|Ga0207707_10149780 | All Organisms → cellular organisms → Bacteria | 2040 | Open in IMG/M |
| 3300025912|Ga0207707_10671377 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 872 | Open in IMG/M |
| 3300025915|Ga0207693_10180079 | Not Available | 1663 | Open in IMG/M |
| 3300025915|Ga0207693_10796162 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 729 | Open in IMG/M |
| 3300025915|Ga0207693_11081991 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 610 | Open in IMG/M |
| 3300025916|Ga0207663_11595692 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 525 | Open in IMG/M |
| 3300025917|Ga0207660_11700722 | Not Available | 507 | Open in IMG/M |
| 3300025922|Ga0207646_10098620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2618 | Open in IMG/M |
| 3300025924|Ga0207694_11816240 | Not Available | 512 | Open in IMG/M |
| 3300026035|Ga0207703_11007186 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 799 | Open in IMG/M |
| 3300026078|Ga0207702_11282156 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 727 | Open in IMG/M |
| 3300026088|Ga0207641_12405245 | Not Available | 526 | Open in IMG/M |
| 3300026217|Ga0209871_1026970 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1074 | Open in IMG/M |
| 3300027063|Ga0207762_1032259 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 796 | Open in IMG/M |
| 3300027502|Ga0209622_1064822 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 666 | Open in IMG/M |
| 3300027671|Ga0209588_1282531 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 502 | Open in IMG/M |
| 3300027854|Ga0209517_10041631 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3615 | Open in IMG/M |
| 3300027855|Ga0209693_10491856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 587 | Open in IMG/M |
| 3300027909|Ga0209382_10812906 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
| 3300028138|Ga0247684_1089096 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 514 | Open in IMG/M |
| 3300029943|Ga0311340_11322334 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 573 | Open in IMG/M |
| 3300030007|Ga0311338_11736079 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 565 | Open in IMG/M |
| 3300030013|Ga0302178_10174856 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1048 | Open in IMG/M |
| 3300030524|Ga0311357_11269186 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 634 | Open in IMG/M |
| 3300030580|Ga0311355_10866193 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 823 | Open in IMG/M |
| 3300031236|Ga0302324_101072987 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1086 | Open in IMG/M |
| 3300031543|Ga0318516_10426713 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 763 | Open in IMG/M |
| 3300031543|Ga0318516_10484864 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 710 | Open in IMG/M |
| 3300031543|Ga0318516_10641619 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 605 | Open in IMG/M |
| 3300031572|Ga0318515_10495368 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 652 | Open in IMG/M |
| 3300031573|Ga0310915_10264546 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1211 | Open in IMG/M |
| 3300031680|Ga0318574_10350069 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 861 | Open in IMG/M |
| 3300031715|Ga0307476_11392018 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 510 | Open in IMG/M |
| 3300031716|Ga0310813_11449534 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 638 | Open in IMG/M |
| 3300031718|Ga0307474_10582926 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 881 | Open in IMG/M |
| 3300031719|Ga0306917_11321985 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 557 | Open in IMG/M |
| 3300031723|Ga0318493_10494286 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 676 | Open in IMG/M |
| 3300031724|Ga0318500_10110251 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1261 | Open in IMG/M |
| 3300031736|Ga0318501_10522834 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 648 | Open in IMG/M |
| 3300031740|Ga0307468_101143693 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 697 | Open in IMG/M |
| 3300031744|Ga0306918_11124472 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 608 | Open in IMG/M |
| 3300031744|Ga0306918_11503041 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 515 | Open in IMG/M |
| 3300031764|Ga0318535_10507726 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 536 | Open in IMG/M |
| 3300031765|Ga0318554_10165416 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1257 | Open in IMG/M |
| 3300031768|Ga0318509_10527705 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 659 | Open in IMG/M |
| 3300031768|Ga0318509_10802828 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 520 | Open in IMG/M |
| 3300031769|Ga0318526_10026480 | All Organisms → cellular organisms → Bacteria | 2080 | Open in IMG/M |
| 3300031777|Ga0318543_10177423 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 942 | Open in IMG/M |
| 3300031781|Ga0318547_10175592 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1271 | Open in IMG/M |
| 3300031781|Ga0318547_11049016 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 510 | Open in IMG/M |
| 3300031796|Ga0318576_10494591 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 577 | Open in IMG/M |
| 3300031805|Ga0318497_10855593 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 510 | Open in IMG/M |
| 3300031819|Ga0318568_10936699 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 535 | Open in IMG/M |
| 3300031821|Ga0318567_10497861 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 692 | Open in IMG/M |
| 3300031846|Ga0318512_10201441 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 974 | Open in IMG/M |
| 3300031846|Ga0318512_10385655 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 703 | Open in IMG/M |
| 3300031879|Ga0306919_10906084 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 676 | Open in IMG/M |
| 3300031879|Ga0306919_11174138 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 584 | Open in IMG/M |
| 3300031890|Ga0306925_11353026 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 705 | Open in IMG/M |
| 3300031890|Ga0306925_11644264 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 622 | Open in IMG/M |
| 3300031890|Ga0306925_12232683 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 508 | Open in IMG/M |
| 3300031897|Ga0318520_10151449 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1345 | Open in IMG/M |
| 3300031938|Ga0308175_101107968 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 878 | Open in IMG/M |
| 3300031941|Ga0310912_10917742 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 674 | Open in IMG/M |
| 3300031946|Ga0310910_10076281 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2432 | Open in IMG/M |
| 3300031947|Ga0310909_10093371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2407 | Open in IMG/M |
| 3300031954|Ga0306926_11718435 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300032001|Ga0306922_11638451 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 639 | Open in IMG/M |
| 3300032001|Ga0306922_12208771 | Not Available | 530 | Open in IMG/M |
| 3300032009|Ga0318563_10541047 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 629 | Open in IMG/M |
| 3300032043|Ga0318556_10525907 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 618 | Open in IMG/M |
| 3300032044|Ga0318558_10653403 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 526 | Open in IMG/M |
| 3300032052|Ga0318506_10529940 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 522 | Open in IMG/M |
| 3300032054|Ga0318570_10329055 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 695 | Open in IMG/M |
| 3300032054|Ga0318570_10350198 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 672 | Open in IMG/M |
| 3300032064|Ga0318510_10306433 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 663 | Open in IMG/M |
| 3300032066|Ga0318514_10743536 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 522 | Open in IMG/M |
| 3300032068|Ga0318553_10708637 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 526 | Open in IMG/M |
| 3300032089|Ga0318525_10036839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2402 | Open in IMG/M |
| 3300032090|Ga0318518_10402399 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 702 | Open in IMG/M |
| 3300032174|Ga0307470_11642287 | Not Available | 539 | Open in IMG/M |
| 3300032180|Ga0307471_100674639 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1197 | Open in IMG/M |
| 3300032261|Ga0306920_100159101 | All Organisms → cellular organisms → Bacteria | 3367 | Open in IMG/M |
| 3300032261|Ga0306920_102775418 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 667 | Open in IMG/M |
| 3300032770|Ga0335085_10693638 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300032770|Ga0335085_10735091 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1093 | Open in IMG/M |
| 3300032828|Ga0335080_10484358 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 1315 | Open in IMG/M |
| 3300032829|Ga0335070_10346209 | Not Available | 1431 | Open in IMG/M |
| 3300032892|Ga0335081_10185290 | All Organisms → cellular organisms → Bacteria | 2907 | Open in IMG/M |
| 3300032893|Ga0335069_11410720 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 753 | Open in IMG/M |
| 3300032954|Ga0335083_10172240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia bannensis | 2014 | Open in IMG/M |
| 3300033289|Ga0310914_10194466 | All Organisms → cellular organisms → Bacteria | 1809 | Open in IMG/M |
| 3300033290|Ga0318519_10954437 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium 13_2_20CM_2_61_4 | 531 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 26.26% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.60% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.58% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 7.58% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 3.54% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.03% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.53% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.53% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.02% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.02% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.02% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.02% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.02% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.52% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.52% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.52% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.01% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.01% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.01% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.01% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.01% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.51% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.51% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.51% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.51% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.51% |
| Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352025 | Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOIL | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004063 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_CattailNLB_D2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006577 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026217 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027063 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 37 (SPAdes) | Environmental | Open in IMG/M |
| 3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031796 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032043 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f24 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032052 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19 | Environmental | Open in IMG/M |
| 3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032068 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f21 | Environmental | Open in IMG/M |
| 3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032829 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.3 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deepsgr_01474960 | 2199352025 | Soil | VAVEDRSTSQGTVKTELRENAVGLPGMLMQGNRDDR |
| JGIcombinedJ26739_1012777452 | 3300002245 | Forest Soil | VAVGAGQSSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVGF |
| Ga0055483_100114213 | 3300004063 | Natural And Restored Wetlands | VTVETGQSSKGSVRTELRENAVGLPGMLMQGIATIGPSFAIL |
| Ga0062387_1014795982 | 3300004091 | Bog Forest Soil | MAVEAGKPSTGSIKTDLRENAVGLPGILMQGIATIGPSFAILASFVF |
| Ga0062389_1031258662 | 3300004092 | Bog Forest Soil | MALKAGQSSTGTVKTELRENAVSLPGILMQGIATIGPSFAILASFVFIVGF |
| Ga0062389_1032130422 | 3300004092 | Bog Forest Soil | VAVEAGQSGTGKGTVPSELRENAVGLPGILMQGIATIGPSFAILASFVFIVGYAGIV |
| Ga0062595_1012341531 | 3300004479 | Soil | MAVEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILASFVFIV |
| Ga0066810_100584292 | 3300005169 | Soil | MAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFA |
| Ga0066388_1015857321 | 3300005332 | Tropical Forest Soil | VGVIPAKGAVESEPRTGFKTDLQEGAVGLPGMLMQGIATIAPAFAILA |
| Ga0066388_1029795702 | 3300005332 | Tropical Forest Soil | VAVDDRTSGTGTIKTELRENAVGLPGMLMQGIATIAPAFAI |
| Ga0066388_1037793771 | 3300005332 | Tropical Forest Soil | VAVEAGQSSEGTVRTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVS |
| Ga0066388_1057998052 | 3300005332 | Tropical Forest Soil | VAVEDRRTSEGTVKTELRENAVGLPGMLMQGIATIAPAFAILASFVFIV |
| Ga0008090_158777082 | 3300005363 | Tropical Rainforest Soil | VAVEAGQSSEGTIRTELRENAVGLPGMLMQGIATIAPSFAILATFVFIVTYAGV |
| Ga0070713_1005321993 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILA |
| Ga0070710_102557661 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVEAGKTSTGSVRTELRENAVGLPGILMQGIATIGPSFAILASF |
| Ga0070705_1014546931 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILASFVFIVSFA |
| Ga0066681_104457461 | 3300005451 | Soil | VAVEDRWTSQGTVKTELRENAVGLPGMLMQGIATIAPAFA |
| Ga0070663_1004620762 | 3300005455 | Corn Rhizosphere | VATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIV |
| Ga0070681_115724091 | 3300005458 | Corn Rhizosphere | VAVEAGQTGTGSVRTELRENAVGLPGILMQGIATIGPSFAILASFVFIV |
| Ga0070707_1013036941 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MRNDRKGWTVAIETGRTGEGTVRTELRENAVGLPGMLMQGIATIAPSFAILAS |
| Ga0070698_1006714551 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVEAGQSSTGTVKTDLRENAVGLPGILMQGIATIGPSFAILASFVFIV |
| Ga0070699_1009249271 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVEAGQSSTGTVKTDLRENAVGLPGILMQGIATIGPSFAILASFVF |
| Ga0070679_1005151101 | 3300005530 | Corn Rhizosphere | VATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAILAT |
| Ga0070763_107378942 | 3300005610 | Soil | VAVEAGQSSQSSKGTVPTELRENAVGLPGMLMQGIATIGPSFAILASFVFI |
| Ga0066903_1039226822 | 3300005764 | Tropical Forest Soil | VAIENQMSSEGTVKTELRENAVGLPGMLMQGIATIAPSFAI |
| Ga0068858_1009471762 | 3300005842 | Switchgrass Rhizosphere | VAVEAGQTGTGSVRTELRENAVGLPGILMQGIATIGPSFAILA |
| Ga0068862_1018753052 | 3300005844 | Switchgrass Rhizosphere | VAGAVKNNGRRGAVAVEADQSGRGTIGTDLRENAVGLPGMLMQGIATIAP |
| Ga0070712_1000090981 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVEAGQSSEGTVRTELRENAVGLPGMLMQGIATIAPSFAILA |
| Ga0070765_1021228062 | 3300006176 | Soil | MAVEAGQSSTGTVKTELRENAVGLPGILMQGIATIGPSFAI |
| Ga0070765_1022043102 | 3300006176 | Soil | VAVEAGQSSQSSKGTVPTELRENAVGLPGMLMQGIATIGPSFAILA |
| Ga0074050_100018122 | 3300006577 | Soil | MAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAIL |
| Ga0079220_107402541 | 3300006806 | Agricultural Soil | VAVEDRKTSQGTIQTGLQENAVGLPGILMQGIATIAPSFAILASFVFIVSFASV |
| Ga0075433_115283971 | 3300006852 | Populus Rhizosphere | VSVEAGKTSTGSVRTELRENAVGLPGILMQGIATIGPSF |
| Ga0075425_1011972102 | 3300006854 | Populus Rhizosphere | VAVEIGKTGGTVKTELRENAVGLPGMLMQGIATIAPAFAILASF |
| Ga0075424_1009910432 | 3300006904 | Populus Rhizosphere | VAIEAGQTSKGSVKTELRENAVGLPGMLMQGIATIGPSFA |
| Ga0079219_104566501 | 3300006954 | Agricultural Soil | MAVEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILASFVFIVG |
| Ga0066710_1036062491 | 3300009012 | Grasslands Soil | MVTEPVTGGVRTELRESAVGLPGMLMQGIATIAPACAILAICVFIVG |
| Ga0105240_111390022 | 3300009093 | Corn Rhizosphere | VAIEDRTSGAGTIKTELRENAVGLPGMLMQGIATIAP |
| Ga0105243_101918731 | 3300009148 | Miscanthus Rhizosphere | MAVEAGKPSTGSVKTELRENALGLPGMLMQGIATIGPSFAILASFVFIVSFAGL |
| Ga0116218_13908462 | 3300009522 | Peatlands Soil | VAVEDLKPTQGTIKTGLQENAIGLPGILMQGIATIAPSF |
| Ga0105237_115878822 | 3300009545 | Corn Rhizosphere | VAVEDLKPSQGTVKTGLRENAVGLPGMLMQGIATIAP |
| Ga0105249_110640352 | 3300009553 | Switchgrass Rhizosphere | MAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIV |
| Ga0126374_102770043 | 3300009792 | Tropical Forest Soil | VAIETGRGEGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVT |
| Ga0126382_108454311 | 3300010047 | Tropical Forest Soil | VALEADQTAQGTIRTELQENAVGIPGILMQGIATI |
| Ga0126382_114208552 | 3300010047 | Tropical Forest Soil | VAIENQMSSEGTVKTELRENAVGLPGMLMQGIATIA |
| Ga0126382_120363432 | 3300010047 | Tropical Forest Soil | VAVETGKTGAGTVKTELRENAVGLPGMLMQGIATIARAFAILASFVF |
| Ga0126373_101174531 | 3300010048 | Tropical Forest Soil | MGRRLTVAVEDLSAGQGTVKTELRETAVGRPGMLMQGIATIAPSFAILAS |
| Ga0126373_130170451 | 3300010048 | Tropical Forest Soil | VAVEAGKSGVGSVKTELRENAVGLPGMLMQGIATIAP |
| Ga0134064_101972252 | 3300010325 | Grasslands Soil | VAIDDRTSGAGTIKTELRENAVGLPGMLMQGIATIAPAFAILA |
| Ga0126370_102431191 | 3300010358 | Tropical Forest Soil | VAVEAGEASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFVFIVTYAGV |
| Ga0126376_100891914 | 3300010359 | Tropical Forest Soil | VAGRRLTVAVEAGQTSTGSVRTELRENAVGLPGILMQGIATIGPSFAILA |
| Ga0126376_111679551 | 3300010359 | Tropical Forest Soil | VAVDDRTSGAGTIKTELRENAVGLPGMLMQGIATIAPSFAILASFVF |
| Ga0126376_124259941 | 3300010359 | Tropical Forest Soil | VAIEAGKSGVGSVKTELRENAVGLPGMLMQGIATIAPS |
| Ga0126372_118010881 | 3300010360 | Tropical Forest Soil | VAVEDLSTGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFI |
| Ga0126378_114793991 | 3300010361 | Tropical Forest Soil | VALEAGQTAQGTIRTELQENAVGIPGILMQGIATIAPSFAILASFVFIVTYA |
| Ga0126377_114599961 | 3300010362 | Tropical Forest Soil | VAVDDRTSGTGTIKTELRENAVGLPGMLMQGIATIAPSFA |
| Ga0126379_121248901 | 3300010366 | Tropical Forest Soil | MLHGSRSCFRWVTGRRLTVAVEADKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFA |
| Ga0126381_1004909791 | 3300010376 | Tropical Forest Soil | MLCIGGSCFRLVTGRRLTVAVEAGQSSEGTVRTELRENAVGLPGMLMQGIATIAPS |
| Ga0126381_1006663031 | 3300010376 | Tropical Forest Soil | MGRRLTVAVEDLSAGQGTVKTELRENAVGLPGMLMQGIATIAPSFAI |
| Ga0126381_1031598431 | 3300010376 | Tropical Forest Soil | VAIEAGKSGVGSVKTELRENAVGLPGMLMQGIATIAPSFAI |
| Ga0134123_122922482 | 3300010403 | Terrestrial Soil | VATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAI |
| Ga0126347_15290402 | 3300010867 | Boreal Forest Soil | VAVEAGQSGTTKGTVASELQANAVGLPGILMQGIATIGPSF |
| Ga0126350_102264261 | 3300010880 | Boreal Forest Soil | VAVEADQSGTSKGTVASELQANAVGLPGILMQGIATIGPSFAILAS |
| Ga0126350_113320831 | 3300010880 | Boreal Forest Soil | VAVEAGESSKGTVASELQANAVGLPGILMQGIATIGPSFAILASFV |
| Ga0137388_102067071 | 3300012189 | Vadose Zone Soil | VAVEAGQSKEGTVGTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVGFAG |
| Ga0137365_100084561 | 3300012201 | Vadose Zone Soil | VAVEDRSTSQGTVKTELRENAVGLPGMLMQGIATIAPAFAILA |
| Ga0137379_104108771 | 3300012209 | Vadose Zone Soil | VAVEELKPSQGTVKTGLKENAVGLPGMLMQGIATIAPS |
| Ga0137387_107999941 | 3300012349 | Vadose Zone Soil | VAVEDRSTSQGTVKTELRENAVGLPGMLMQGIATIAPAYAILASF |
| Ga0164301_111842151 | 3300012960 | Soil | VAVEDLKTSQGTVKTGLQENAVGLPGMLMQGIATIA |
| Ga0164309_118941111 | 3300012984 | Soil | VAVEDLKTSQGTVKTGLRENAVGLPGMLMQGIATIAPSFAILASFVFIVSFASVV |
| Ga0134079_107544451 | 3300014166 | Grasslands Soil | VAVEDLKTSQGTVKTGLRENAVGLPGMLMQGIATIAPSFAILASF |
| Ga0182035_105080481 | 3300016341 | Soil | VAVEADKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVGFA |
| Ga0182035_109820591 | 3300016341 | Soil | VAVEDLKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILAS |
| Ga0187820_11576551 | 3300017924 | Freshwater Sediment | VAVEDLEPSSKTIKTGLQENAIGLPGILMQGIATIAPSFAILASFVFIVT |
| Ga0187819_101747021 | 3300017943 | Freshwater Sediment | MAVEDLKSSPGTVKTGLQENAIGIPGILMQGIATIAPSFAILAS |
| Ga0187779_106961381 | 3300017959 | Tropical Peatland | VASVDAGSNQGTIKTELRENAVGLPGMLMQGIATIAPSFA |
| Ga0187776_104864572 | 3300017966 | Tropical Peatland | MAVEDLKGSPGTVKTGLQENAIGIPGILMQGIATIAPSFAILAS |
| Ga0187777_106519061 | 3300017974 | Tropical Peatland | MAVEDLKSSTGTVKTGLQENAIGIPGILMQGIATIAPS |
| Ga0187815_100171355 | 3300018001 | Freshwater Sediment | MAVEDLKSSPGTVKTGLQENAIGLPGILMQGIATIAPSFAI |
| Ga0187815_102130862 | 3300018001 | Freshwater Sediment | VAVEDLKSSPGTVKTGLQENAIGLPGILMQGIATIAPSFAI |
| Ga0187765_110802641 | 3300018060 | Tropical Peatland | VAVEDVKPSQGTIGTELRENAIGIPGILMQGIATIAPSFAILASFVFIVSFA |
| Ga0066655_109611381 | 3300018431 | Grasslands Soil | MAVEAGKPSTGSVKTELREHAVGLPGMLMQGIATMGPSFAILAS |
| Ga0193728_10274924 | 3300019890 | Soil | VAVEAGQSSKGTVASELRENAVGLPGILMQGIATIGPSFAILA |
| Ga0193730_10704021 | 3300020002 | Soil | VAVESGQASKGSVKTDLRENAVGLPGMLMQGIATIAPSFAILASFVFIVTYAG |
| Ga0206350_100762362 | 3300020080 | Corn, Switchgrass And Miscanthus Rhizosphere | MAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVSFAG |
| Ga0179590_10465991 | 3300020140 | Vadose Zone Soil | MAVEAGQSGTGTVKTELRENAVGLPGILMQGIATI |
| Ga0179592_100883471 | 3300020199 | Vadose Zone Soil | MAVEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILAS |
| Ga0210403_104056281 | 3300020580 | Soil | VAVEDLKPSSTTIKTGLQENAIGLPGILMQGIATIA |
| Ga0210403_108690072 | 3300020580 | Soil | VATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAILA |
| Ga0210399_102875231 | 3300020581 | Soil | VAVEDLKPSTGTVKTGLKENAIGIPGILMQGIATIAPSFAILAS |
| Ga0210401_110170392 | 3300020583 | Soil | VAVEDLKPSSTTIKTGLQENAIGLPGILMQGIATI |
| Ga0210406_109556321 | 3300021168 | Soil | VAVEDLKTSQGTVKTGLQENAVGLPGMLMQGIATIAPSFAILASFV |
| Ga0210405_104207111 | 3300021171 | Soil | MAIEAGQSGTGTVKTELRENAVGLPGILMQGIATIGPSFAILASFVFIVGFAG |
| Ga0210405_106373141 | 3300021171 | Soil | VAVEDLKSTQGTVKTGLQENAIGLPGILMQGIATIAPSFAILASFVF |
| Ga0210396_115175751 | 3300021180 | Soil | MAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFI |
| Ga0210385_114259111 | 3300021402 | Soil | VAVEDLKPSSTTIKTGLRENAIGLPGILMQGIATIAPSFA |
| Ga0182009_104780922 | 3300021445 | Soil | VAIDDRTSGAGTIKTELRENAVGLPGMLMQGIATIAPAYAILASFVFIV |
| Ga0210402_106413611 | 3300021478 | Soil | MAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSF |
| Ga0210402_111290172 | 3300021478 | Soil | VAIEAGQTSKGSVKTELRENAVGLPGMLMQGIATIGPSF |
| Ga0126371_115487281 | 3300021560 | Tropical Forest Soil | LAVEAGQSGTGTIGTDLRENAVGLPGMLMQGIATIAPSFAILASFVFIVGYAGLST |
| Ga0126371_122669802 | 3300021560 | Tropical Forest Soil | VAVEADKPGQGTVKTELRENAVGLPGMLMQGIATI |
| Ga0208356_10088853 | 3300025504 | Arctic Peat Soil | VAVEAGQSSKGSKGSIGTELRENAVGLPGILMQGIATIGPTARWPSCSTK |
| Ga0207692_109921252 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVEAGKTSTGSVRTELRENAVGLPGILMQGIATIGPSFAILASFAFIVTFAGI |
| Ga0207699_112907372 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | VTVEAGKTSTGSVRTELRENAVGLPGILMQGIATIG |
| Ga0207684_109559541 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVETGRGEGTVKTELRENAVGLPGMLMQGIATIAPAFAILA |
| Ga0207707_101497801 | 3300025912 | Corn Rhizosphere | MAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVSFAGL |
| Ga0207707_106713772 | 3300025912 | Corn Rhizosphere | VAIEAGQTSKGSVKTELRENAVGLPGMLMQGIATIGPSFAILA |
| Ga0207693_101800793 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVEAGQSSEGTVRTELRENAVGLPGMLMQGIATIAPSFAILAAF |
| Ga0207693_107961622 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVEAGQTGTGSVRTELRENAVGLPGILMQGIATIGPSFAI |
| Ga0207693_110819911 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | VSVEAGQTSTGSVRTELRENAVGLPGILMQGIATIGP |
| Ga0207663_115956921 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | VAVEAGQTGTGSVRTELRENAVGLPGILMQGIATIGPSFAILASFV |
| Ga0207660_117007221 | 3300025917 | Corn Rhizosphere | VATVDSGSNQGTVKTELRENAVGLPGMLLQGIATIAPSLAI |
| Ga0207646_100986204 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VAIEAGKSGVGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVT |
| Ga0207694_118162401 | 3300025924 | Corn Rhizosphere | VATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAIL |
| Ga0207703_110071861 | 3300026035 | Switchgrass Rhizosphere | VAIEAGQTSKGSVKTELRENAVGLPGMLMQGIATIG |
| Ga0207702_112821562 | 3300026078 | Corn Rhizosphere | VSVEAGKTSTGSVRTELRENAVGLPGILMQGIATIGPSFAILASFAFIV |
| Ga0207641_124052451 | 3300026088 | Switchgrass Rhizosphere | VATVDSGSNQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFV |
| Ga0209871_10269701 | 3300026217 | Permafrost Soil | VAVESGQSSKGSVTTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVGF |
| Ga0207762_10322592 | 3300027063 | Tropical Forest Soil | MAVEDLKGSPGTVKTGLQENAIGIPGILMQGIATIAPSF |
| Ga0209622_10648222 | 3300027502 | Forest Soil | VAVEDLKTSTGTIKTGLRENAIGLPGILMQGIATIAPSFAILASFVFIV |
| Ga0209588_12825312 | 3300027671 | Vadose Zone Soil | MAVETGQSSTGSVKTDLRENAVGLPGMLMQGIATIGPSFAILASFVFIVGFA |
| Ga0209517_100416311 | 3300027854 | Peatlands Soil | MAVETGQSSTGSIKTDLRENAVGLPGILMQGIATIGPSFAILASFVFIVGFAGLV |
| Ga0209693_104918562 | 3300027855 | Soil | VAVGAGQSSTGSVKTELRENAVGLPGMLMQGIATIGP |
| Ga0209382_108129061 | 3300027909 | Populus Rhizosphere | VATDTGRSGQQGFRTELREGAVGLPGVLMQGVATIAPSFAILASFVFIVGFAGI |
| Ga0247684_10890962 | 3300028138 | Soil | VAVEAGQTGTGSVRTELRENAVGLPGILMQGIATIGPSFAILASFVFIVGFAGVV |
| Ga0311340_113223341 | 3300029943 | Palsa | MAVEAGQSGTGTVKTELRENAVSLPGILMQGIATIGPSFAILASFVFI |
| Ga0311338_117360791 | 3300030007 | Palsa | VAVDAGQSSKGTVASELRENAVGLPGILMQGIATIGPSFAILASFVFIVGFAG |
| Ga0302178_101748561 | 3300030013 | Palsa | MAVEAGQSGPGTVKTELRENAVSLPGILMQGIATIGPSFAILASFVFIVSF |
| Ga0311357_112691862 | 3300030524 | Palsa | VAVDAGQSSKGTVASELRENAVGLPGILMQGIATIG |
| Ga0311355_108661931 | 3300030580 | Palsa | MAVEAGQSGTGTVKTELRENAVSLPGILMQGIATIGPSFAILASFVFIVS |
| Ga0302324_1010729872 | 3300031236 | Palsa | VAVGAGQSSKGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFV |
| Ga0318516_104267131 | 3300031543 | Soil | VAVEDARTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFI |
| Ga0318516_104848642 | 3300031543 | Soil | VAVEDLKSSPGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIVTYA |
| Ga0318516_106416191 | 3300031543 | Soil | VAVEAGEASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFV |
| Ga0318515_104953682 | 3300031572 | Soil | VAVEDVKPSPTTVKTGLQENAIGIPGILMQGIATIAPSF |
| Ga0310915_102645461 | 3300031573 | Soil | VAVEDLKTSPGTIKTGLQENAIGLPGILMQGIATIAPSFAILAS |
| Ga0318574_103500691 | 3300031680 | Soil | VAVDAGQASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFV |
| Ga0307476_113920182 | 3300031715 | Hardwood Forest Soil | VAVEDLKPSSTTIKTGLQENAIGLPGILMQGIATIAPSFAILASFVFI |
| Ga0310813_114495341 | 3300031716 | Soil | MAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVSFAGLV |
| Ga0307474_105829262 | 3300031718 | Hardwood Forest Soil | VAVEAGQSGTSKGTVASELQANAVGLPGILMQGIATIGPSFAILASFVFIVG |
| Ga0306917_113219851 | 3300031719 | Soil | VAVEDLKPSSTTVKTGLQENAIGLPGILMQGIATIAPSF |
| Ga0318493_104942862 | 3300031723 | Soil | VAVEDLKPSTGTVKTGLKENAIGIPGILMQGIATIAPSFAI |
| Ga0318500_101102511 | 3300031724 | Soil | VAVEDLKTSPGTIKTGLQENAIGLPGILMQGIATIAPSFAILATFVFI |
| Ga0318501_105228342 | 3300031736 | Soil | VAVGDLKPSQGTIGTELRENAVGIPGMLMQGIATIAPSFAILA |
| Ga0307468_1011436931 | 3300031740 | Hardwood Forest Soil | MAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATI |
| Ga0306918_111244721 | 3300031744 | Soil | VAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVGFAG |
| Ga0306918_115030411 | 3300031744 | Soil | VAVEAGQSKEGTVKTELRENAVGLPGMLMQGIATIAPSFAIL |
| Ga0318535_105077261 | 3300031764 | Soil | VAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILATFVFIVGFAG |
| Ga0318554_101654161 | 3300031765 | Soil | VAVEADKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVGFAG |
| Ga0318509_105277052 | 3300031768 | Soil | VAVEDVKPDATTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVF |
| Ga0318509_108028282 | 3300031768 | Soil | VAVEDLKTSPGTIKTGLQENAIGLPGILMQGIATIAP |
| Ga0318526_100264803 | 3300031769 | Soil | VAVEDLKSSQGTVKTGLQENAVGLPGILMQGIATIAPSFAILASFVFIVTWAG |
| Ga0318543_101774231 | 3300031777 | Soil | VAVEAGQSKEGTVKTELRENAVGLPGMLMQGIATIAPAFAILATFVFIVTYAGVV |
| Ga0318547_101755922 | 3300031781 | Soil | VAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILATFVFIVGFA |
| Ga0318547_110490161 | 3300031781 | Soil | VAVEDVKTSQGTVKTGLQENAIGIPGILMQGIATIAPSF |
| Ga0318576_104945912 | 3300031796 | Soil | VAVEADKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFI |
| Ga0318497_108555931 | 3300031805 | Soil | VAVEDLKTGTGTIKTGLQENAIGLPGILMQGIATIAPSFAILASFVFIVT |
| Ga0318568_109366991 | 3300031819 | Soil | VAVDDLKSSPGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFV |
| Ga0318567_104978611 | 3300031821 | Soil | VAVDAGQASEGTVRTELRENAVGLPGMLMQGIATIA |
| Ga0318512_102014412 | 3300031846 | Soil | VAVEDLKSSQGTVKTGLQENAIGIPGILMQGIATIA |
| Ga0318512_103856552 | 3300031846 | Soil | VAVDDLKSSPGTVKTGLQENAIGIPGILMQGIPIA |
| Ga0306919_109060841 | 3300031879 | Soil | MAVEDLKTSPGTVKTGLQENAIGIPGILMQGIATI |
| Ga0306919_111741381 | 3300031879 | Soil | VAVEDVKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFV |
| Ga0306925_113530262 | 3300031890 | Soil | MAVEDLKSSTGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIVTYAL |
| Ga0306925_116442642 | 3300031890 | Soil | VAVEDLKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIVSFAA |
| Ga0306925_122326831 | 3300031890 | Soil | VAVDAGQASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFVFI |
| Ga0318520_101514492 | 3300031897 | Soil | VAVEAGQSKEGTVKTELRENAVGLPGMLMQGIATIAPAFAILATFVFIVGYAGIVT |
| Ga0308175_1011079682 | 3300031938 | Soil | MAVEAGKPSTGSVKTELRENAVGLPGMLMQGIATIGPSFAILASFVFIVSFA |
| Ga0310912_109177421 | 3300031941 | Soil | VAVEAGQSKEGTVKTELRENAVGLPGMLMQGIATIAPSFAILATFV |
| Ga0310910_100762811 | 3300031946 | Soil | VAVEDLKTSPGTVKTGLQENAIGLPGILMQGIATIAPSFAI |
| Ga0310909_100933711 | 3300031947 | Soil | VAVEDLKTGTGTIKTGLQENAIGLPGILMQGIATIAPSFAILA |
| Ga0306926_117184351 | 3300031954 | Soil | VAVEDRSTSPGTVKTELRENAVGLPGMLMQGIATIAPSFAIL |
| Ga0306922_116384512 | 3300032001 | Soil | VAVEAGEASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFVFIVTYA |
| Ga0306922_122087711 | 3300032001 | Soil | VAVEDHRTSEGTIRTGLRENAVGLPGMLMQGIATIAPAFAILASFVFITGFAG |
| Ga0318563_105410472 | 3300032009 | Soil | VAVEDVKTSQGTVKTGLQENAIGIPGILMQGIATI |
| Ga0318556_105259072 | 3300032043 | Soil | VAVGDLKPSQGTIGTELRENAVGIPGMLMQGIATIAPSFAILATFV |
| Ga0318558_106534032 | 3300032044 | Soil | VAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILAS |
| Ga0318506_105299402 | 3300032052 | Soil | VAVDDLKSSPGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIVTYAG |
| Ga0318570_103290551 | 3300032054 | Soil | VAVEDVKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAIL |
| Ga0318570_103501982 | 3300032054 | Soil | VAVEDLKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFA |
| Ga0318510_103064332 | 3300032064 | Soil | VAVEADKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILATFVFIVG |
| Ga0318514_107435361 | 3300032066 | Soil | VAVGDLKPSQGTIGTELRENAVGIPGMLMQGIATIAPSFAILATFVFIVTYAGVV |
| Ga0318553_107086371 | 3300032068 | Soil | VAVDAGQASEGTVRTELRENAVGLPGMLMQGIATIAPAFAILATFVFIVTYAGIVT |
| Ga0318525_100368393 | 3300032089 | Soil | VAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVGFA |
| Ga0318518_104023992 | 3300032090 | Soil | VAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAILASFLF |
| Ga0307470_116422872 | 3300032174 | Hardwood Forest Soil | VATVDSGSNQGTVKTELRENAVGLPGMLMQGIATI |
| Ga0307471_1006746391 | 3300032180 | Hardwood Forest Soil | VAVEAGQSSEGTVRTELRENAVGLPGMLMQGIATIAPSFAILASFVF |
| Ga0306920_1001591014 | 3300032261 | Soil | VAVEDLKSSTGTVKTGLQGNAIGIPGILMQGIATIAPSFAILASFVFIVTY |
| Ga0306920_1027754182 | 3300032261 | Soil | VAVEAGKPGQGTVKTELRENAVGLPGMLMQGIATIAPSFAI |
| Ga0335085_106936381 | 3300032770 | Soil | VASVDAGSNQGTIKTELRENAVGLPGMLMQGIATIAP |
| Ga0335085_107350911 | 3300032770 | Soil | VAVEDARTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIV |
| Ga0335080_104843581 | 3300032828 | Soil | VAVEDLGTGRGTIKTELRENAVGLPGMLMQGIATIAPSFAILASFVFIVSFAG |
| Ga0335070_103462092 | 3300032829 | Soil | VAVEDARTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILAS |
| Ga0335081_101852901 | 3300032892 | Soil | VAVEDLEPSTGTVKTGLQENAIGLPGILMQGIATIAPSFAILASFVFIVTY |
| Ga0335069_114107201 | 3300032893 | Soil | VAVEDRKTSQGTIQTGLQENAVGLPGILMQGIATIAPSFAILA |
| Ga0335083_101722402 | 3300032954 | Soil | VAVEDRKTSQGTITTGLQENAVGLPGILMQGIATIAPSFAILASFVFIVS |
| Ga0310914_101944663 | 3300033289 | Soil | VAVEDLKTSQGTVKTGLQENAIGIPGILMQGIATIAPSFAILASFVFIV |
| Ga0318519_109544372 | 3300033290 | Soil | VAVEDLKTGTGTIKTGLQENAIGLPGILMQGIATIAPSFAILASFV |
| ⦗Top⦘ |