Basic Information | |
---|---|
Family ID | F026306 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 198 |
Average Sequence Length | 42 residues |
Representative Sequence | MARKTRRSGEKNDGQDLEMEKFIKDLSENTPNEDQFGEEEDE |
Number of Associated Samples | 148 |
Number of Associated Scaffolds | 198 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 70.20 % |
% of genes near scaffold ends (potentially truncated) | 31.31 % |
% of genes from short scaffolds (< 2000 bps) | 89.90 % |
Associated GOLD sequencing projects | 132 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.29 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (39.899 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (21.212 % of family members) |
Environment Ontology (ENVO) | Unclassified (76.263 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (90.909 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 24.29% β-sheet: 0.00% Coil/Unstructured: 75.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.29 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 198 Family Scaffolds |
---|---|---|
PF01467 | CTP_transf_like | 4.04 |
PF13671 | AAA_33 | 2.02 |
PF07691 | PA14 | 0.51 |
PF02796 | HTH_7 | 0.51 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 60.10 % |
Unclassified | root | N/A | 39.90 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10056945 | All Organisms → Viruses → Predicted Viral | 1907 | Open in IMG/M |
3300000115|DelMOSum2011_c10136200 | Not Available | 747 | Open in IMG/M |
3300000116|DelMOSpr2010_c10131219 | Not Available | 887 | Open in IMG/M |
3300001346|JGI20151J14362_10217946 | Not Available | 511 | Open in IMG/M |
3300001349|JGI20160J14292_10144623 | Not Available | 755 | Open in IMG/M |
3300001460|JGI24003J15210_10008851 | All Organisms → Viruses → Predicted Viral | 4150 | Open in IMG/M |
3300001460|JGI24003J15210_10046684 | Not Available | 1467 | Open in IMG/M |
3300001472|JGI24004J15324_10029254 | All Organisms → cellular organisms → Bacteria | 1805 | Open in IMG/M |
3300001472|JGI24004J15324_10051952 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
3300001589|JGI24005J15628_10065329 | All Organisms → cellular organisms → Bacteria | 1340 | Open in IMG/M |
3300001936|GOS2220_1007385 | All Organisms → Viruses → Predicted Viral | 1551 | Open in IMG/M |
3300001955|GOS2237_1012739 | Not Available | 1421 | Open in IMG/M |
3300001966|GOS2245_1024135 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 912 | Open in IMG/M |
3300001974|GOS2246_10097658 | All Organisms → Viruses → Predicted Viral | 1524 | Open in IMG/M |
3300002231|KVRMV2_101688977 | Not Available | 627 | Open in IMG/M |
3300002231|KVRMV2_101742236 | Not Available | 590 | Open in IMG/M |
3300002483|JGI25132J35274_1046886 | Not Available | 942 | Open in IMG/M |
3300004097|Ga0055584_100268676 | All Organisms → Viruses → Predicted Viral | 1744 | Open in IMG/M |
3300004448|Ga0065861_1013689 | Not Available | 7855 | Open in IMG/M |
3300004457|Ga0066224_1123791 | Not Available | 604 | Open in IMG/M |
3300004460|Ga0066222_1064803 | All Organisms → Viruses → Predicted Viral | 4378 | Open in IMG/M |
3300004941|Ga0068514_1016862 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 801 | Open in IMG/M |
3300005057|Ga0068511_1021927 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 935 | Open in IMG/M |
3300005057|Ga0068511_1052578 | All Organisms → cellular organisms → Bacteria | 671 | Open in IMG/M |
3300005057|Ga0068511_1054362 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
3300005057|Ga0068511_1085233 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
3300005239|Ga0073579_1175416 | Not Available | 40536 | Open in IMG/M |
3300005523|Ga0066865_10302732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 605 | Open in IMG/M |
3300005606|Ga0066835_10354611 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
3300005913|Ga0075108_10024956 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
3300005931|Ga0075119_1091576 | Not Available | 678 | Open in IMG/M |
3300005946|Ga0066378_10274756 | Not Available | 526 | Open in IMG/M |
3300006193|Ga0075445_10066122 | All Organisms → Viruses → Predicted Viral | 1402 | Open in IMG/M |
3300006334|Ga0099675_1116902 | All Organisms → cellular organisms → Bacteria | 1043 | Open in IMG/M |
3300006345|Ga0099693_1522974 | Not Available | 624 | Open in IMG/M |
3300006350|Ga0099954_1081901 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
3300006735|Ga0098038_1210334 | Not Available | 626 | Open in IMG/M |
3300006735|Ga0098038_1266243 | Not Available | 538 | Open in IMG/M |
3300006735|Ga0098038_1291883 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 508 | Open in IMG/M |
3300006737|Ga0098037_1062073 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
3300006737|Ga0098037_1189526 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 676 | Open in IMG/M |
3300006749|Ga0098042_1085413 | Not Available | 812 | Open in IMG/M |
3300006749|Ga0098042_1093810 | Not Available | 766 | Open in IMG/M |
3300006749|Ga0098042_1117765 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 664 | Open in IMG/M |
3300006749|Ga0098042_1178204 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
3300006916|Ga0070750_10289863 | Not Available | 702 | Open in IMG/M |
3300006919|Ga0070746_10391880 | Not Available | 624 | Open in IMG/M |
3300006921|Ga0098060_1109092 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 781 | Open in IMG/M |
3300006922|Ga0098045_1051517 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
3300006924|Ga0098051_1109431 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
3300006929|Ga0098036_1066820 | Not Available | 1110 | Open in IMG/M |
3300006929|Ga0098036_1244996 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300006929|Ga0098036_1245304 | Not Available | 542 | Open in IMG/M |
3300009703|Ga0114933_11072010 | Not Available | 508 | Open in IMG/M |
3300010153|Ga0098059_1330801 | Not Available | 580 | Open in IMG/M |
3300011258|Ga0151677_1064317 | Not Available | 515 | Open in IMG/M |
3300012524|Ga0129331_1039820 | Not Available | 507 | Open in IMG/M |
3300012920|Ga0160423_10385086 | All Organisms → Viruses | 959 | Open in IMG/M |
3300012920|Ga0160423_10947849 | Not Available | 577 | Open in IMG/M |
3300012920|Ga0160423_11091572 | Not Available | 533 | Open in IMG/M |
3300012928|Ga0163110_10336908 | All Organisms → Viruses → Predicted Viral | 1114 | Open in IMG/M |
3300012928|Ga0163110_11447736 | Not Available | 557 | Open in IMG/M |
3300012936|Ga0163109_10642664 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 777 | Open in IMG/M |
3300012936|Ga0163109_10969260 | Not Available | 621 | Open in IMG/M |
3300012954|Ga0163111_12096543 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 571 | Open in IMG/M |
3300017708|Ga0181369_1016218 | All Organisms → cellular organisms → Bacteria | 1846 | Open in IMG/M |
3300017708|Ga0181369_1039263 | Not Available | 1089 | Open in IMG/M |
3300017708|Ga0181369_1056695 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 867 | Open in IMG/M |
3300017708|Ga0181369_1121855 | Not Available | 529 | Open in IMG/M |
3300017708|Ga0181369_1121918 | Not Available | 529 | Open in IMG/M |
3300017709|Ga0181387_1125209 | Not Available | 529 | Open in IMG/M |
3300017710|Ga0181403_1020870 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 1391 | Open in IMG/M |
3300017710|Ga0181403_1141668 | Not Available | 501 | Open in IMG/M |
3300017719|Ga0181390_1085174 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 867 | Open in IMG/M |
3300017731|Ga0181416_1047403 | Not Available | 1012 | Open in IMG/M |
3300017731|Ga0181416_1070121 | Not Available | 829 | Open in IMG/M |
3300017731|Ga0181416_1071911 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
3300017733|Ga0181426_1029567 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
3300017737|Ga0187218_1123622 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 616 | Open in IMG/M |
3300017740|Ga0181418_1059694 | All Organisms → cellular organisms → Bacteria | 942 | Open in IMG/M |
3300017740|Ga0181418_1178620 | Not Available | 507 | Open in IMG/M |
3300017741|Ga0181421_1023658 | All Organisms → Viruses → Predicted Viral | 1672 | Open in IMG/M |
3300017742|Ga0181399_1041456 | Not Available | 1222 | Open in IMG/M |
3300017743|Ga0181402_1196916 | Not Available | 500 | Open in IMG/M |
3300017744|Ga0181397_1095662 | Not Available | 784 | Open in IMG/M |
3300017745|Ga0181427_1037588 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
3300017746|Ga0181389_1105539 | Not Available | 773 | Open in IMG/M |
3300017756|Ga0181382_1070844 | All Organisms → cellular organisms → Bacteria | 974 | Open in IMG/M |
3300017756|Ga0181382_1088631 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300017756|Ga0181382_1198452 | Not Available | 508 | Open in IMG/M |
3300017763|Ga0181410_1121386 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
3300017764|Ga0181385_1111291 | Not Available | 837 | Open in IMG/M |
3300017764|Ga0181385_1193006 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 615 | Open in IMG/M |
3300017765|Ga0181413_1033902 | All Organisms → Viruses → Predicted Viral | 1597 | Open in IMG/M |
3300017768|Ga0187220_1088579 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300017768|Ga0187220_1094538 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
3300017770|Ga0187217_1119447 | All Organisms → cellular organisms → Bacteria | 891 | Open in IMG/M |
3300017770|Ga0187217_1195337 | Not Available | 669 | Open in IMG/M |
3300017771|Ga0181425_1248967 | Not Available | 550 | Open in IMG/M |
3300017772|Ga0181430_1063449 | All Organisms → Viruses → Predicted Viral | 1131 | Open in IMG/M |
3300017772|Ga0181430_1202586 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 566 | Open in IMG/M |
3300017779|Ga0181395_1261455 | Not Available | 528 | Open in IMG/M |
3300017781|Ga0181423_1156575 | Not Available | 876 | Open in IMG/M |
3300017781|Ga0181423_1261730 | Not Available | 645 | Open in IMG/M |
3300017782|Ga0181380_1313903 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300017783|Ga0181379_1097680 | All Organisms → cellular organisms → Bacteria | 1078 | Open in IMG/M |
3300017786|Ga0181424_10141976 | Not Available | 1031 | Open in IMG/M |
3300017824|Ga0181552_10356624 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
3300017951|Ga0181577_10958466 | Not Available | 506 | Open in IMG/M |
3300017985|Ga0181576_10062863 | All Organisms → cellular organisms → Bacteria | 2519 | Open in IMG/M |
3300017986|Ga0181569_10575992 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 755 | Open in IMG/M |
3300018036|Ga0181600_10559851 | Not Available | 537 | Open in IMG/M |
3300018416|Ga0181553_10228482 | All Organisms → Viruses → Predicted Viral | 1062 | Open in IMG/M |
3300018416|Ga0181553_10275800 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
3300018416|Ga0181553_10384376 | Not Available | 765 | Open in IMG/M |
3300018416|Ga0181553_10564736 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300018417|Ga0181558_10465170 | Not Available | 662 | Open in IMG/M |
3300018420|Ga0181563_10304306 | All Organisms → cellular organisms → Bacteria | 931 | Open in IMG/M |
3300018421|Ga0181592_10833876 | Not Available | 605 | Open in IMG/M |
3300019098|Ga0188859_1000510 | All Organisms → cellular organisms → Bacteria | 1633 | Open in IMG/M |
3300020165|Ga0206125_10011039 | Not Available | 6346 | Open in IMG/M |
3300020165|Ga0206125_10048541 | All Organisms → Viruses → Predicted Viral | 2083 | Open in IMG/M |
3300020165|Ga0206125_10285697 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
3300020175|Ga0206124_10046177 | All Organisms → Viruses → Predicted Viral | 1936 | Open in IMG/M |
3300020253|Ga0211685_1016407 | All Organisms → Viruses → Predicted Viral | 1095 | Open in IMG/M |
3300020267|Ga0211648_1090821 | Not Available | 568 | Open in IMG/M |
3300020276|Ga0211509_1075128 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300020312|Ga0211542_1031141 | All Organisms → Viruses → Predicted Viral | 1054 | Open in IMG/M |
3300020335|Ga0211690_1008557 | All Organisms → Viruses → Predicted Viral | 3035 | Open in IMG/M |
3300020352|Ga0211505_1036504 | All Organisms → cellular organisms → Bacteria | 1230 | Open in IMG/M |
3300020374|Ga0211477_10007076 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → unclassified Myoviridae → Pelagibacter phage HTVC008M | 5820 | Open in IMG/M |
3300020374|Ga0211477_10299337 | Not Available | 542 | Open in IMG/M |
3300020377|Ga0211647_10157256 | All Organisms → cellular organisms → Bacteria | 750 | Open in IMG/M |
3300020379|Ga0211652_10057525 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
3300020381|Ga0211476_10083618 | All Organisms → cellular organisms → Bacteria | 1220 | Open in IMG/M |
3300020400|Ga0211636_10095195 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
3300020404|Ga0211659_10332145 | Not Available | 666 | Open in IMG/M |
3300020414|Ga0211523_10181923 | All Organisms → cellular organisms → Bacteria | 875 | Open in IMG/M |
3300020421|Ga0211653_10460519 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 544 | Open in IMG/M |
3300020428|Ga0211521_10055919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2018 | Open in IMG/M |
3300020428|Ga0211521_10348744 | Not Available | 652 | Open in IMG/M |
3300020436|Ga0211708_10276057 | Not Available | 681 | Open in IMG/M |
3300020436|Ga0211708_10390294 | Not Available | 570 | Open in IMG/M |
3300020442|Ga0211559_10395154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 639 | Open in IMG/M |
3300020450|Ga0211641_10104123 | All Organisms → cellular organisms → Bacteria | 1454 | Open in IMG/M |
3300020451|Ga0211473_10380022 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 723 | Open in IMG/M |
3300020469|Ga0211577_10105627 | All Organisms → Viruses → Predicted Viral | 1948 | Open in IMG/M |
3300020469|Ga0211577_10815743 | Not Available | 536 | Open in IMG/M |
3300020470|Ga0211543_10172519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1079 | Open in IMG/M |
3300020470|Ga0211543_10324315 | Not Available | 746 | Open in IMG/M |
3300021347|Ga0213862_10053319 | All Organisms → cellular organisms → Bacteria | 1444 | Open in IMG/M |
3300021347|Ga0213862_10298933 | Not Available | 570 | Open in IMG/M |
3300021347|Ga0213862_10302269 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
3300021347|Ga0213862_10362037 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 518 | Open in IMG/M |
3300021356|Ga0213858_10046578 | All Organisms → cellular organisms → Bacteria | 2097 | Open in IMG/M |
3300021356|Ga0213858_10096890 | All Organisms → Viruses → Predicted Viral | 1440 | Open in IMG/M |
3300021356|Ga0213858_10227763 | All Organisms → cellular organisms → Bacteria | 901 | Open in IMG/M |
3300021356|Ga0213858_10391512 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 653 | Open in IMG/M |
3300021389|Ga0213868_10458044 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
3300021442|Ga0206685_10218804 | Not Available | 642 | Open in IMG/M |
3300022074|Ga0224906_1072222 | All Organisms → cellular organisms → Bacteria | 1059 | Open in IMG/M |
3300022178|Ga0196887_1078210 | Not Available | 779 | Open in IMG/M |
3300022183|Ga0196891_1027434 | Not Available | 1076 | Open in IMG/M |
3300022837|Ga0222711_1001612 | All Organisms → Viruses | 5677 | Open in IMG/M |
3300022925|Ga0255773_10137659 | All Organisms → cellular organisms → Bacteria | 1206 | Open in IMG/M |
3300023110|Ga0255743_10241818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 963 | Open in IMG/M |
3300023243|Ga0222630_1050408 | Not Available | 816 | Open in IMG/M |
3300024344|Ga0209992_10179152 | All Organisms → cellular organisms → Bacteria | 909 | Open in IMG/M |
3300024346|Ga0244775_11555895 | Not Available | 504 | Open in IMG/M |
3300025084|Ga0208298_1063325 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
3300025086|Ga0208157_1017312 | All Organisms → Viruses → Predicted Viral | 2248 | Open in IMG/M |
3300025086|Ga0208157_1140180 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 542 | Open in IMG/M |
3300025098|Ga0208434_1108881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 533 | Open in IMG/M |
3300025099|Ga0208669_1088014 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 660 | Open in IMG/M |
3300025101|Ga0208159_1056469 | Not Available | 795 | Open in IMG/M |
3300025120|Ga0209535_1029237 | All Organisms → Viruses → Predicted Viral | 2630 | Open in IMG/M |
3300025128|Ga0208919_1240960 | Not Available | 528 | Open in IMG/M |
3300025132|Ga0209232_1082531 | All Organisms → cellular organisms → Bacteria | 1110 | Open in IMG/M |
3300025137|Ga0209336_10074320 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300025690|Ga0209505_1076631 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
3300025816|Ga0209193_1015591 | All Organisms → Viruses → Predicted Viral | 2507 | Open in IMG/M |
3300025892|Ga0209630_10031080 | All Organisms → Viruses → Predicted Viral | 3434 | Open in IMG/M |
3300027077|Ga0208941_1014185 | All Organisms → cellular organisms → Bacteria | 1096 | Open in IMG/M |
3300027687|Ga0209710_1003910 | Not Available | 9879 | Open in IMG/M |
3300027752|Ga0209192_10067313 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 1554 | Open in IMG/M |
3300029306|Ga0135212_1031691 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
3300029318|Ga0185543_1086393 | Not Available | 620 | Open in IMG/M |
3300029448|Ga0183755_1020397 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Marinovum → unclassified Marinovum → Marinovum sp. | 2208 | Open in IMG/M |
3300031143|Ga0308025_1001647 | All Organisms → Viruses | 10439 | Open in IMG/M |
3300031519|Ga0307488_10255959 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
3300031602|Ga0307993_1029566 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
3300031656|Ga0308005_10138935 | Not Available | 642 | Open in IMG/M |
3300031689|Ga0308017_1091984 | Not Available | 624 | Open in IMG/M |
3300031695|Ga0308016_10044653 | All Organisms → Viruses → Predicted Viral | 1896 | Open in IMG/M |
3300031705|Ga0308003_1092393 | All Organisms → cellular organisms → Bacteria | 980 | Open in IMG/M |
3300031774|Ga0315331_10365584 | Not Available | 1058 | Open in IMG/M |
3300031785|Ga0310343_10401091 | All Organisms → cellular organisms → Bacteria | 994 | Open in IMG/M |
3300032047|Ga0315330_10570019 | Not Available | 675 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 21.21% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 19.19% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.15% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 7.07% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 4.55% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 4.04% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 3.03% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 2.53% |
Marine Water | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Water | 2.02% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.02% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 2.02% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 2.02% |
Marine | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine | 1.52% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 1.52% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.52% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 1.52% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 1.01% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 1.01% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 1.01% |
Saline Lake | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake | 1.01% |
Saline Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water | 1.01% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 0.51% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.51% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.51% |
Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.51% |
Sackhole Brine | Environmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine | 0.51% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 0.51% |
Marine Water | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water | 0.51% |
Marine Harbor | Environmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor | 0.51% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000115 | Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011 | Environmental | Open in IMG/M |
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300001346 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 | Environmental | Open in IMG/M |
3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
3300001460 | Marine viral communities from the Pacific Ocean - LP-28 | Environmental | Open in IMG/M |
3300001472 | Marine viral communities from the Pacific Ocean - LP-32 | Environmental | Open in IMG/M |
3300001589 | Marine viral communities from the Pacific Ocean - LP-40 | Environmental | Open in IMG/M |
3300001936 | Marine microbial communities from Halifax, Nova Scotia, Canada - GS004 | Environmental | Open in IMG/M |
3300001955 | Marine microbial communities from Gulf of Panama, Panama - GS021 | Environmental | Open in IMG/M |
3300001966 | Marine microbial communities from Roca Redonda, Equador - GS030 | Environmental | Open in IMG/M |
3300001974 | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 | Environmental | Open in IMG/M |
3300002231 | Marine sediment microbial communities from Santorini caldera mats, Greece - red mat | Environmental | Open in IMG/M |
3300002483 | Marine viral communities from the Pacific Ocean - ETNP_6_30 | Environmental | Open in IMG/M |
3300004097 | Pelagic marine sediment microbial communities from the LTER site Helgoland, North Sea, for post-phytoplankton bloom and carbon turnover studies - OSD3 (Helgoland) metaG | Environmental | Open in IMG/M |
3300004448 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004457 | Marine viral communities from Newfoundland, Canada MC-1 | Environmental | Open in IMG/M |
3300004460 | Marine viral communities from Newfoundland, Canada BC-1 | Environmental | Open in IMG/M |
3300004941 | Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-0.2um | Environmental | Open in IMG/M |
3300005057 | Marine water microbial communities from the East Sea, Korea with extracellular vesicles - East-Sea-0.2um | Environmental | Open in IMG/M |
3300005239 | Environmental Genome Shotgun Sequencing: Ocean Microbial Populations from the Gulf of Maine | Environmental | Open in IMG/M |
3300005523 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV265 | Environmental | Open in IMG/M |
3300005606 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201302SV84 | Environmental | Open in IMG/M |
3300005913 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK1 | Environmental | Open in IMG/M |
3300005931 | Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UK9 | Environmental | Open in IMG/M |
3300005946 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_DCM_ad_71m_LV_A | Environmental | Open in IMG/M |
3300006193 | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA | Environmental | Open in IMG/M |
3300006334 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0025m | Environmental | Open in IMG/M |
3300006345 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT224_1_0075m | Environmental | Open in IMG/M |
3300006350 | Marine microbial communities from North Pacific Subtropical Gyre, Station ALOHA - HOT225_1_0075m | Environmental | Open in IMG/M |
3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
3300006919 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 | Environmental | Open in IMG/M |
3300006921 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG | Environmental | Open in IMG/M |
3300006922 | Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG | Environmental | Open in IMG/M |
3300006924 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG | Environmental | Open in IMG/M |
3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
3300010153 | Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaG | Environmental | Open in IMG/M |
3300011258 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, permeate | Environmental | Open in IMG/M |
3300012524 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
3300017709 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27 | Environmental | Open in IMG/M |
3300017710 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28 | Environmental | Open in IMG/M |
3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
3300017731 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16 | Environmental | Open in IMG/M |
3300017733 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 49 SPOT_SRF_2013-12-23 | Environmental | Open in IMG/M |
3300017737 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2) | Environmental | Open in IMG/M |
3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
3300017742 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21 | Environmental | Open in IMG/M |
3300017743 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17 | Environmental | Open in IMG/M |
3300017744 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23 | Environmental | Open in IMG/M |
3300017745 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15 | Environmental | Open in IMG/M |
3300017746 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29 | Environmental | Open in IMG/M |
3300017756 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 | Environmental | Open in IMG/M |
3300017763 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20 | Environmental | Open in IMG/M |
3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
3300017765 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28 | Environmental | Open in IMG/M |
3300017768 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2) | Environmental | Open in IMG/M |
3300017770 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2) | Environmental | Open in IMG/M |
3300017771 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 48 SPOT_SRF_2013-11-13 | Environmental | Open in IMG/M |
3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
3300017779 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16 | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017782 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 3 SPOT_SRF_2009-08-19 | Environmental | Open in IMG/M |
3300017783 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 2 SPOT_SRF_2009-07-10 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017986 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018036 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018416 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018417 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018420 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011512CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019098 | Metatranscriptome of marine microbial communities from Baltic Sea - GS684_0p1 | Environmental | Open in IMG/M |
3300020165 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1 | Environmental | Open in IMG/M |
3300020175 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2 | Environmental | Open in IMG/M |
3300020253 | Marine microbial communities from Tara Oceans - TARA_B100000780 (ERX555982-ERR598945) | Environmental | Open in IMG/M |
3300020267 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108) | Environmental | Open in IMG/M |
3300020276 | Marine microbial communities from Tara Oceans - TARA_E500000075 (ERX289007-ERR315858) | Environmental | Open in IMG/M |
3300020312 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX556125-ERR598977) | Environmental | Open in IMG/M |
3300020335 | Marine microbial communities from Tara Oceans - TARA_B100000768 (ERX556030-ERR599035) | Environmental | Open in IMG/M |
3300020352 | Marine microbial communities from Tara Oceans - TARA_B100000497 (ERX556084-ERR599144) | Environmental | Open in IMG/M |
3300020374 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291766-ERR318618) | Environmental | Open in IMG/M |
3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
3300020379 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168) | Environmental | Open in IMG/M |
3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
3300020400 | Marine microbial communities from Tara Oceans - TARA_B100001115 (ERX555947-ERR598992) | Environmental | Open in IMG/M |
3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
3300020414 | Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028) | Environmental | Open in IMG/M |
3300020421 | Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556005-ERR599007) | Environmental | Open in IMG/M |
3300020428 | Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094) | Environmental | Open in IMG/M |
3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
3300020442 | Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162) | Environmental | Open in IMG/M |
3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
3300020469 | Marine microbial communities from Tara Oceans - TARA_B100001093 (ERX555967-ERR599052) | Environmental | Open in IMG/M |
3300020470 | Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053) | Environmental | Open in IMG/M |
3300021347 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266 | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021389 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO127 | Environmental | Open in IMG/M |
3300021442 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 | Environmental | Open in IMG/M |
3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
3300022183 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v3) | Environmental | Open in IMG/M |
3300022837 | Saline water microbial communities from Ace Lake, Antarctica - #1699 | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300023110 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG | Environmental | Open in IMG/M |
3300023243 | Saline water microbial communities from Ace Lake, Antarctica - #3 | Environmental | Open in IMG/M |
3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300025084 | Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes) | Environmental | Open in IMG/M |
3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025098 | Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025099 | Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
3300025816 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes) | Environmental | Open in IMG/M |
3300025892 | Pelagic Microbial community sample from North Sea - COGITO 998_met_01 (SPAdes) | Environmental | Open in IMG/M |
3300027077 | Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - C0912_C27A4_35 (SPAdes) | Environmental | Open in IMG/M |
3300027687 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138 (SPAdes) | Environmental | Open in IMG/M |
3300027752 | Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154 (SPAdes) | Environmental | Open in IMG/M |
3300029306 | Marine harbor viral communities from the Indian Ocean - SCH3 | Environmental | Open in IMG/M |
3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
3300029448 | Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082 | Environmental | Open in IMG/M |
3300031143 | Marine microbial communities from water near the shore, Antarctic Ocean - #422 | Environmental | Open in IMG/M |
3300031519 | Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2 | Environmental | Open in IMG/M |
3300031602 | Marine microbial communities from Ellis Fjord, Antarctic Ocean - #260 | Environmental | Open in IMG/M |
3300031656 | Marine microbial communities from water near the shore, Antarctic Ocean - #67 | Environmental | Open in IMG/M |
3300031689 | Marine microbial communities from water near the shore, Antarctic Ocean - #280 | Environmental | Open in IMG/M |
3300031695 | Marine microbial communities from water near the shore, Antarctic Ocean - #233 | Environmental | Open in IMG/M |
3300031705 | Marine microbial communities from water near the shore, Antarctic Ocean - #36 | Environmental | Open in IMG/M |
3300031774 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915 | Environmental | Open in IMG/M |
3300031785 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-25_MG | Environmental | Open in IMG/M |
3300032047 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_100569453 | 3300000101 | Marine | MARKTRRSGKKNDGQDLEMEKFMKDLSENTPNEDQFGEEEDE* |
DelMOSum2011_101362003 | 3300000115 | Marine | MARKTRRSGEKNDEQDLEMEKFMEEVANNTPNGDQFKEVEDE* |
DelMOSpr2010_101312192 | 3300000116 | Marine | MARKTRRSGEKNDEQDLEMEKFMKEVANNTPNGDQFKEVEDE* |
JGI20151J14362_102179462 | 3300001346 | Pelagic Marine | MARKTRRSGETNDGQDLEMEKFMEEVANNTPNGDQFKEVEDE* |
JGI20160J14292_101446233 | 3300001349 | Pelagic Marine | QRNMARKTRRSGKTNDGKDIEMDKFIKELSENTPHEDQFGEEEDE* |
JGI24003J15210_100088512 | 3300001460 | Marine | MARETRRSGKKNDGKDLEMEKFLKELSDNTPHEEQFKDKEDE* |
JGI24003J15210_100466841 | 3300001460 | Marine | QRIMARKTRRSGEKNDGQDLEMEKFIKDLSENTPNEDQFGEEQDE* |
JGI24004J15324_100292542 | 3300001472 | Marine | MARKTRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFGEETR* |
JGI24004J15324_100519521 | 3300001472 | Marine | IMARKTRRSGEKNDGQDLEMEKFIKDLSENTPNEDQFGEEQDE* |
JGI24005J15628_100653292 | 3300001589 | Marine | MARKTRRSSEKNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE* |
GOS2220_10073853 | 3300001936 | Marine | TRRSSETNDGKDLEMEQFIKDLSENTPNEDQFKENEDE* |
GOS2237_10127392 | 3300001955 | Marine | MARETRRSGEKNDGQDIEMEEFLKELSENTPHDKQFEGEDE* |
GOS2245_10241353 | 3300001966 | Marine | MARETKRGGEKNDGQDLEMEKFLEELANNTPNSDQFTGEEDE* |
GOS2246_100976582 | 3300001974 | Marine | MARETKRGGEKNDGKDLEMEKFIKELSDNTPHEDQFGDKEDE* |
KVRMV2_1016889772 | 3300002231 | Marine Sediment | MARETRRSGKTNDGQDIEMDKFIKDLSDNTPHEDQFGEEEDE* |
KVRMV2_1017422363 | 3300002231 | Marine Sediment | MARETRRSGEKNDGQDLEMEKFIKDLSDNTPHEDQFGEEEDE* |
JGI25132J35274_10468862 | 3300002483 | Marine | MARETRRSGETNDGKDIEMDKFIKELSENTPHEDQFGEEEDE* |
Ga0055584_1002686762 | 3300004097 | Pelagic Marine | MARETRRSGKKNDGEDLEMEKFLKELSDNTPHEEQFKDKEDE* |
Ga0065861_10136892 | 3300004448 | Marine | MARETRRSSETNDEQDLEMDKFMEEVANNTPNGDQFKEVKDE* |
Ga0066224_11237913 | 3300004457 | Marine | MARETRRSSETNDGQDLEMDKFMEEVANNTPNGDQFKEVKDE* |
Ga0066222_10648033 | 3300004460 | Marine | MARKTRRSSETNDEQDLEMDKFMEEVANNTPNGDQFKEVKDE* |
Ga0068514_10168622 | 3300004941 | Marine Water | MARKTRRSGKTNDGKDIEMDKFIKELSENTPHEDQFGEEEDE* |
Ga0068511_10219272 | 3300005057 | Marine Water | MARETRRSGEKNDGQDLEMEKFIKELSENTPHEDQFGEGEDE* |
Ga0068511_10525782 | 3300005057 | Marine Water | MAREIRRSGETNDGEDLEMEKFLKELSNNTPNEDQFKDKEDE* |
Ga0068511_10543622 | 3300005057 | Marine Water | MARETRRSGKKNDGKDIEMEKFLKELSDNTPHEDQFGEEENE* |
Ga0068511_10852332 | 3300005057 | Marine Water | MARETRRSGETNDGQDLEMEKFIKELSENTPHDKQFEGEDE* |
Ga0073579_117541629 | 3300005239 | Marine | MARKTRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE* |
Ga0066865_103027323 | 3300005523 | Marine | ARETRRSGETNDGKDIEMDKFIKELSENTPHEDQFGEEEDE* |
Ga0066835_103546112 | 3300005606 | Marine | MARETRRSGKTNDGQDIEMEKFIKELSENTPHEDQFGEEEDE* |
Ga0075108_100249562 | 3300005913 | Saline Lake | MARETRRSSETNDGEDLEMDKFMEELANNTPNGDQFKEVKDE* |
Ga0075119_10915763 | 3300005931 | Saline Lake | MARRTKQSDKENDRNDLDMEKFMEDIANNTPNGDQFKEEKKDD* |
Ga0066378_102747562 | 3300005946 | Marine | MARETKRSGEKNDGQDLEMEKFIKELSENTPHEDQFGEGEDE* |
Ga0075445_100661222 | 3300006193 | Marine | MARKTRRSSEKNDGKDLTFPISKLEMEQFMKDLLDNTPNEDQFKENKDE* |
Ga0099675_11169022 | 3300006334 | Marine | MARETRRSGEKNDGQDLEMEKFIKDLSDNTPHDKQFEGEDE* |
Ga0099693_15229742 | 3300006345 | Marine | MARETKRSGEKNDGQDLEMEKFLEELANNTPNEEQFKGKEDE* |
Ga0099954_10819012 | 3300006350 | Marine | MARETRRSGEKNDGQDLEMEKFIKDLSDNTPHEDQFGEKEDE* |
Ga0098038_12103342 | 3300006735 | Marine | MARKTRRSGETNDGKDIEMDKFIKELSENTPHEDQFKGEEDE* |
Ga0098038_12662431 | 3300006735 | Marine | KIQRIMARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE* |
Ga0098038_12918833 | 3300006735 | Marine | RRSGETNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE* |
Ga0098037_10620733 | 3300006737 | Marine | MARETRRSGETNDGKDIEMDKFIKELSENTPHEDQFKGEEDE* |
Ga0098037_11895262 | 3300006737 | Marine | MARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE* |
Ga0098042_10854133 | 3300006749 | Marine | MARKTRRSGETNDGQDIEMEKFIKELSENTPHEDQFKGEEDE* |
Ga0098042_10938102 | 3300006749 | Marine | MARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE* |
Ga0098042_11177651 | 3300006749 | Marine | TRRSGETNDGKDIEMDKFIKELSENTPHEDQFREEEDE* |
Ga0098042_11782042 | 3300006749 | Marine | MARKTRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFK |
Ga0070750_102898632 | 3300006916 | Aqueous | MARKTRRSGEKNDGQDLEMEKFIKDLSENTPNEDQFGEEQDE* |
Ga0070746_103918803 | 3300006919 | Aqueous | MAREIRRSGEKNDGKDIEMEKFLKELSDNTPHEDQFGEEENE* |
Ga0098060_11090923 | 3300006921 | Marine | ARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE* |
Ga0098045_10515172 | 3300006922 | Marine | MARKTRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFREEQDE* |
Ga0098051_11094312 | 3300006924 | Marine | MARKTRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFGEEENE* |
Ga0098036_10668201 | 3300006929 | Marine | MARETRRSGKTNDGQDIEMDKFIKELSENTPHEDQFGEEENE* |
Ga0098036_12449961 | 3300006929 | Marine | MARETRRGGETNDGKDIEMDKFIKELSENTPHEDQFKGEEDE* |
Ga0098036_12453042 | 3300006929 | Marine | MARKTRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE* |
Ga0114933_110720101 | 3300009703 | Deep Subsurface | QRIMARETRRSGEKNDGQDLETEKFIKDLSDNTPHEDQFKEMENENE* |
Ga0098059_13308013 | 3300010153 | Marine | RRSGEKNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE* |
Ga0151677_10643173 | 3300011258 | Marine | RSGETNDGKDIEMDKFIKELSENTPHEDQFGEEEDE* |
Ga0129331_10398202 | 3300012524 | Aqueous | ARKTRRSGKTNDGKDIEMDKFIKELSENTPHEDQFGEEEDE* |
Ga0160423_103850863 | 3300012920 | Surface Seawater | GKIQRIMARETRRSGEKNDGQDLEMEKFLEELANNTPNGDQFKGEEDE* |
Ga0160423_109478491 | 3300012920 | Surface Seawater | MARKTRRSGETNDGKDIEMEKFIKELSENTPHEDQFGEEENE* |
Ga0160423_110915721 | 3300012920 | Surface Seawater | KIQRNMARETRRSGETNDGKDIEMDKFIKELSENTPHEDQFGEEEDE* |
Ga0163110_103369083 | 3300012928 | Surface Seawater | RRSGETNDGQDIEMEKFIKELAENTPHEDQFKGEEDE* |
Ga0163110_114477361 | 3300012928 | Surface Seawater | KIQRIMARETKRSGEKNDGQDLEMEKFLEELANNTPNGDQFKGEEDE* |
Ga0163109_106426643 | 3300012936 | Surface Seawater | MARETKRSGEENDGQDLEMEKFLEELANNTPNSDQFTGEEDE* |
Ga0163109_109692601 | 3300012936 | Surface Seawater | MARETRRSGKKNDGQDLEMEEFLKQLSDNTPHEEQFNEEKDE* |
Ga0163111_120965431 | 3300012954 | Surface Seawater | QRIMARETKRSGEKNDGQDLEMEKFLEELSNNTPNGDQFKGEEDE* |
Ga0181369_10162183 | 3300017708 | Marine | MARKTRRSGETNDGKDIEMDKFIKELSENTPHEDQFREEEDE |
Ga0181369_10392632 | 3300017708 | Marine | MERETRRSGKTNDGQDIEMDKFIKELSENTPHEDQFGEEENE |
Ga0181369_10566952 | 3300017708 | Marine | MARKTRRSGKTNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE |
Ga0181369_11218553 | 3300017708 | Marine | IMARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE |
Ga0181369_11219182 | 3300017708 | Marine | MARKTRRSGETNDGQDLEMEKFIKDLSENTPNEDQFKDKEDE |
Ga0181387_11252092 | 3300017709 | Seawater | MARKTRRSGKTNDGQDIEMEKFIKELSENTPHEDQFGEEEDE |
Ga0181403_10208703 | 3300017710 | Seawater | MARKTRRSGETNDGKDIEMDKFIKELSENTPHEDQFGEEENE |
Ga0181403_11416681 | 3300017710 | Seawater | RSSEKNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE |
Ga0181390_10851743 | 3300017719 | Seawater | MARKTRRSSEKNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE |
Ga0181416_10474033 | 3300017731 | Seawater | DMARKTRRSGKTNDGQDIEMEKFIKELSENTPHEDQFGEEENE |
Ga0181416_10701211 | 3300017731 | Seawater | DMARKTRRSGKTNDGQDIEMEKFIKELSENTPHEDQFGEEEDE |
Ga0181416_10719112 | 3300017731 | Seawater | MARKTRRSGKTNDGQDIEMEKFIKELSENTPHEDQFGEEE |
Ga0181426_10295672 | 3300017733 | Seawater | MARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFREEQDE |
Ga0187218_11236221 | 3300017737 | Seawater | IQRIMARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE |
Ga0181418_10596943 | 3300017740 | Seawater | MARKTRRSGEKNDGKDLEMEKFLKELSDNTPHEEQFKDKEDE |
Ga0181418_11786202 | 3300017740 | Seawater | GKIQRIMARETRRSGKKNDGKDLEMEKFLKELSDNTPHEDQFREEEDE |
Ga0181421_10236582 | 3300017741 | Seawater | MARKTRRSGETNDGKDIEMDKFIKELSENTPHEDQFGEGEDE |
Ga0181399_10414563 | 3300017742 | Seawater | RIMARKTRRSSEKNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE |
Ga0181402_11969161 | 3300017743 | Seawater | GKIQRIMARKTRRSGEKNDGQDLEMEKFMKDLSDNTPNEDQFGEEQDE |
Ga0181397_10956621 | 3300017744 | Seawater | KIQRIMARKTRRSGEKNDGQDLEMEKFIKDLSENTPNEDQFKDKEDE |
Ga0181427_10375882 | 3300017745 | Seawater | MARKTRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFGEEQND |
Ga0181389_11055391 | 3300017746 | Seawater | RDMARKTRRSGKTNDGQDIEMDKFIKELSENTPHEDQFGEEEDE |
Ga0181382_10708441 | 3300017756 | Seawater | MARKTRRSGETNDGQDLEMEKFIKDLSENTPNEDQLKDKED |
Ga0181382_10886312 | 3300017756 | Seawater | MARKTRRSGETNDGKDIEMEKFIKELSENTPHEDQFGEEEDE |
Ga0181382_11984522 | 3300017756 | Seawater | GKIQRDMARKTRRSGKTNDGQDIEMDKFIKELSENTPHEDQFGEEEDE |
Ga0181410_11213862 | 3300017763 | Seawater | MARKTRRSGKTNDGQDIEMDKFIKELSENTPHEDQFGEEENE |
Ga0181385_11112912 | 3300017764 | Seawater | MARETRRSGKTNDGQDIEMDKFIKELSDNTPHEDQFGEEEDE |
Ga0181385_11930062 | 3300017764 | Seawater | MARETRRSGKKNDGQDLEMEKFIKDLSDNTPHEDQFKGEEDE |
Ga0181413_10339022 | 3300017765 | Seawater | MARETRRSGKKNDGKDLEMEKFLKELSDNTPHEEQFKEKEDE |
Ga0187220_10885793 | 3300017768 | Seawater | MARKTRRSGEKNDGQDLEMEKFMKDLSDNTPNEDQFGEEQDE |
Ga0187220_10945382 | 3300017768 | Seawater | MARETRRSGKKNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE |
Ga0187217_11194472 | 3300017770 | Seawater | MARKTRRSSEKNDGQDLEMEKFMKDLSENTPNEDQFGEE |
Ga0187217_11953372 | 3300017770 | Seawater | MARKTRRSGEKNDGQDIEMDKFIKELSENTPHEDQFGEEEDE |
Ga0181425_12489673 | 3300017771 | Seawater | RRSGETNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE |
Ga0181430_10634495 | 3300017772 | Seawater | MARKTRRSGKTNDGQDIEMDKFIKELSENTPHEDQFGEGEDE |
Ga0181430_12025862 | 3300017772 | Seawater | MARKTRRSGETNDGQDLEMEKFIKDLSDNTPHEDQFREEEDE |
Ga0181395_12614552 | 3300017779 | Seawater | MARKTRRSGETNDGKDIEMDKFIKELSENTPNEDQFGEEENE |
Ga0181423_11565752 | 3300017781 | Seawater | MARKTRRSSEKNDGQDLEMEKFMKDLSENTPNEDQFREEQDE |
Ga0181423_12617302 | 3300017781 | Seawater | MARKTRRSSEKNDGQDLEMEKFIKELSENTPNEDQFGEEQDE |
Ga0181380_13139032 | 3300017782 | Seawater | MARKTRRSSETNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE |
Ga0181379_10976801 | 3300017783 | Seawater | ARETRRSGKKNDGQDLEMEKFIKDLSDNTPHEDQFREEEDE |
Ga0181424_101419762 | 3300017786 | Seawater | MARKTRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFREEQDE |
Ga0181552_103566242 | 3300017824 | Salt Marsh | MAREIRRSGEKNDGKDIEMEKFLKELSDNTPHEDQFGEEENE |
Ga0181577_109584662 | 3300017951 | Salt Marsh | MARKTRRSGKTNDGQDIEMDKFIKELSENTPHEEQFGEEEDE |
Ga0181576_100628632 | 3300017985 | Salt Marsh | MARETRRSGEKNDGKDIEMEKFLKELSDNTPHEDQFGEEENE |
Ga0181569_105759923 | 3300017986 | Salt Marsh | RSGEKNDGKDIEMEKFLKELSDNTPHEDQFGEEENE |
Ga0181600_105598512 | 3300018036 | Salt Marsh | MARETRRSGKTNDGQDIEMDKFIKELSENTPHEDQFGEEEDE |
Ga0181553_102284822 | 3300018416 | Salt Marsh | MAREIKRSSEKNDGQDLEMKKFLKQLSDNTPHEEQFNEEKDE |
Ga0181553_102758002 | 3300018416 | Salt Marsh | MARETRRSGEKNDGQDLEMEKFIKELSENTPHEDQFGEGEDE |
Ga0181553_103843762 | 3300018416 | Salt Marsh | MARETRRSGKTNDGQDIEMDKFIKELSENTPHEDQFGEEENE |
Ga0181553_105647361 | 3300018416 | Salt Marsh | MARETRRSGEKNDGKDIEMEKFLKELSDNTPHEDQF |
Ga0181558_104651701 | 3300018417 | Salt Marsh | RSGKTNDGQDIEMDKFNKELSENTSHEDQFGEEEDE |
Ga0181563_103043061 | 3300018420 | Salt Marsh | MAREIKRSSEKNDGKDIEMEKFLKELSDNTPHEDQFGEEENE |
Ga0181592_108338761 | 3300018421 | Salt Marsh | KRSSEKNDGQDLEMKKFLKQLSDNTPHEEQFNEEKDE |
Ga0188859_10005102 | 3300019098 | Freshwater Lake | MARKTRRSGETNDGQDLEMEKFMEEVANNTPNGDQFKEVEDE |
Ga0206125_100110393 | 3300020165 | Seawater | MARKTRRSGKKNDGQDLEMEKFMKDLSENTPNEDQFGEEEDE |
Ga0206125_100485413 | 3300020165 | Seawater | MARKTRRSGETNDGQDLEMEKFIKDLSENTPNEEQFREKEDE |
Ga0206125_102856972 | 3300020165 | Seawater | MARKTRRSGKTNDGKDIEMDKFIKELSENTPHEDQFGEEEDE |
Ga0206124_100461773 | 3300020175 | Seawater | MARKTRRSGEKNDGQDLEMEKFINFLSENTPNEDQFGEEQDE |
Ga0211685_10164072 | 3300020253 | Marine | MARKTRRSSEKNDGKDLTFPISKLEMEQFMKDLLDNTPNEDQFKENKDE |
Ga0211648_10908211 | 3300020267 | Marine | MARKTRRSGETNDGQDLEMDKFIKELSENTPHEDQFREEEDE |
Ga0211509_10751282 | 3300020276 | Marine | MARETRRSGKTNDGQDIEMDKFIKDLSDNTPHEDQFGEEEDE |
Ga0211542_10311411 | 3300020312 | Marine | MARETKRSGEKNDGQDLEMEKFIKELSENTPHEDQFGEGEDE |
Ga0211690_10085574 | 3300020335 | Marine | MARKTRRSGETNDGQDLEMEKFIKDLSENTPNEDQFEENKDE |
Ga0211505_10365043 | 3300020352 | Marine | MARKTRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE |
Ga0211477_100070763 | 3300020374 | Marine | MARETRRSGEKNDGQDLEMEKFIKDLSDNTPHEDQFGEEEDE |
Ga0211477_102993371 | 3300020374 | Marine | MARETRRSGKTNDGQDLEMEKFIKELSENTPHEDQFGEEENE |
Ga0211647_101572562 | 3300020377 | Marine | MARETKRGGEKNDGQDLEMEKFLEELSNNTPNGDQFKGEEDE |
Ga0211652_100575252 | 3300020379 | Marine | MARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE |
Ga0211476_100836182 | 3300020381 | Marine | MARETRRSGKKNDGQDLEMEKFIKDLSDNTPHEDQFREEEDE |
Ga0211636_100951952 | 3300020400 | Marine | MARETRRSGETNDGKDIEMEKFIKDLADNTPHEDQFKGEEDE |
Ga0211659_103321452 | 3300020404 | Marine | MARETRRSGETNDGKDIEMDKFIKELSENTPHEDQFKGEEDE |
Ga0211523_101819232 | 3300020414 | Marine | MARKTRRSGETNDGKDIEMDKFIKELSENTPHEDQFKGEEDE |
Ga0211653_104605192 | 3300020421 | Marine | MARKTRRSGEKNDGQDLEMEKFIKDLSENTPNEDQFKDKEDE |
Ga0211521_100559191 | 3300020428 | Marine | RIMARETRRSGEKNDGQDIEMDKFIKDLSDNTPHEDQFGEEEDE |
Ga0211521_103487443 | 3300020428 | Marine | RIMARETRRSGEKNDGQDLEMEKFIKDLSDNTPHEDQFGEEEDE |
Ga0211708_102760573 | 3300020436 | Marine | MAREIRRSGETNDEENLEMEKFLKELSNNTPNEDQFKDKEDE |
Ga0211708_103902941 | 3300020436 | Marine | MARETRRSGETNDGKDIEMDKFIKELSENTPHEDQFGEEEDE |
Ga0211559_103951543 | 3300020442 | Marine | ARETKRGGEKNDGQDLEMEKFLEELANNTPNSDQFTGEEDE |
Ga0211641_101041233 | 3300020450 | Marine | MARETRRSGEKNDGQDLEMEKFIKELADNTPHEDQFKGEEDE |
Ga0211473_103800222 | 3300020451 | Marine | MAREVKRSGKTNDGQDLEMEKFLKELSDNTPHEEQFKEKEDE |
Ga0211577_101056272 | 3300020469 | Marine | MARETRRSGKKNDGQDLEMEKFLKELSDNTPHEEQFKDKEDE |
Ga0211577_108157431 | 3300020469 | Marine | IQRIMARETRRSGKKNDGQDLEMEKFLKELSDNTPHEEQFKEKEDE |
Ga0211543_101725192 | 3300020470 | Marine | MARETKRSGEKNDGQDLEMKKFLEELANNTPHEDQFGEEENE |
Ga0211543_103243153 | 3300020470 | Marine | MARETKRSGEKNDGQDLEMKKFLEELANNTPNAEQFEDKEDE |
Ga0213862_100533192 | 3300021347 | Seawater | MARKTRRSGKTNDGQDIEMDKFIKELSENTPHEDQFGEEEDE |
Ga0213862_102989332 | 3300021347 | Seawater | MARKTRRSGETNDGQDIEMDKFIKDLSENTPHEDQFKEEEDE |
Ga0213862_103022691 | 3300021347 | Seawater | MARETRRSGETNDGKDIEMDKFIKELSENTPHEDQFRE |
Ga0213862_103620373 | 3300021347 | Seawater | TRRSGETNDGKDIEMDKFIKELSENTPHEDQFKGEEDE |
Ga0213858_100465782 | 3300021356 | Seawater | MARKTRRSGETNDGQDIEMEKFIKELSENTPHEDQFGEEENE |
Ga0213858_100968902 | 3300021356 | Seawater | MAREIKRSSEKNDGQDLEMKEFLKQLSDNTPNEEQFKEEKFK |
Ga0213858_102277632 | 3300021356 | Seawater | MARKTRRSGETNDGKDIEMEKFIKELSENTPHEDQFGEEENE |
Ga0213858_103915122 | 3300021356 | Seawater | MTRKTRRSGKTNDGQDIEMDKFIKELSENTPHEDQFGEEEDE |
Ga0213868_104580441 | 3300021389 | Seawater | MARKTRRSGETNDGQDIEMDKFIKELSENTPHEDQFGEEEDE |
Ga0206685_102188042 | 3300021442 | Seawater | MASKTRRSGKENDRQDLEMEEFLKEIADNTPHSEQFVGTEEDKDE |
Ga0224906_10722223 | 3300022074 | Seawater | MARETRRSGKKNDGQDLEMEKFLKELSDNTPHEEQFKEKEDE |
Ga0196887_10782101 | 3300022178 | Aqueous | KIQRIMARKTRRSGKKNDGQDLEMEKFMKDLSENTPNEDQFGEEEDE |
Ga0196891_10274341 | 3300022183 | Aqueous | MARKTRRSGEKNDEQDLEMEKFMKEVANNTPNGDQFKEVEDE |
Ga0222711_10016126 | 3300022837 | Saline Water | MARETRRSSETNDGEDLEMDKFMEELANNTPNGDQFKEVKDE |
Ga0255773_101376593 | 3300022925 | Salt Marsh | ARKTRRSGKTNDGQDIEMDKFIKELSENTPHEEQFGEEEDE |
Ga0255743_102418183 | 3300023110 | Salt Marsh | IQRNMARETRRSGEKNDGKDIEMEKFLKELSDNTPHEDQFGEEENE |
Ga0222630_10504083 | 3300023243 | Saline Water | RIMARRTKQSDKENDRNDLDMEKFMEDIANNTPNGDQFKEEKKDD |
Ga0209992_101791522 | 3300024344 | Deep Subsurface | MARETRRSGEKNDGQDLEMEKFIKELSENTPHEDQFGE |
Ga0244775_115558952 | 3300024346 | Estuarine | MARKTRRSGEKNDGQDLEMEKFIKDLSENTPNEDQFGEEQDE |
Ga0208298_10633251 | 3300025084 | Marine | MARKTRRSSEKNDGQDLEMEKFMKDLSENTPNEDQFGEEENE |
Ga0208157_10173121 | 3300025086 | Marine | MARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE |
Ga0208157_11401803 | 3300025086 | Marine | ARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE |
Ga0208434_11088812 | 3300025098 | Marine | MARKTRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE |
Ga0208669_10880143 | 3300025099 | Marine | GKIQRIMARKTRRSGETNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE |
Ga0208159_10564692 | 3300025101 | Marine | MARKTRRSGETNDGQDIEMEKFIKELSENTPHEDQFKGEEDE |
Ga0209535_10292372 | 3300025120 | Marine | MARETRRSGKKNDGKDLEMEKFLKELSDNTPHEEQFKDKEDE |
Ga0208919_12409603 | 3300025128 | Marine | TRRSGETNDGQDLEMEKFMKDLSENTPNEDQFKDKEDE |
Ga0209232_10825313 | 3300025132 | Marine | MARETRRSGEKNDGQDLEMEKFIKDLSDNTPHEDQFGEKEDE |
Ga0209336_100743203 | 3300025137 | Marine | RIMARKTRRSGEKNDGQDLEMEKFIKDLSENTPNEDQFGEEQDE |
Ga0209505_10766311 | 3300025690 | Pelagic Marine | MARKTRRSGETNDGEDLEMEKFMKDLSNNTPNKDQFGEEEDE |
Ga0209193_10155911 | 3300025816 | Pelagic Marine | RKTRRSGKKNDGQDLEMEKFMKDLSENTPNEDQFGEEEDE |
Ga0209630_100310803 | 3300025892 | Pelagic Marine | MARKTRRSGEKNDGQDLEMEKFIKDLSENTPNEDQFGEEEDE |
Ga0208941_10141852 | 3300027077 | Marine | MARKTRRSSEKNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE |
Ga0209710_100391012 | 3300027687 | Marine | MARKTRRSSETNDGKDLEMEQFIKDLSENTPNEDQFKENEDE |
Ga0209192_100673133 | 3300027752 | Marine | MARETRRSSETNDGQDLEMDKFMEELANNTPNGDQFKEVKDE |
Ga0135212_10316912 | 3300029306 | Marine Harbor | MARETRRSGEKNDGQDLEMEKFIKELSENTPPEIVTGKPT |
Ga0185543_10863932 | 3300029318 | Marine | MARKTRRSGETNDGKDIEMDKFIKELSENTPHEDQFGEEEDE |
Ga0183755_10203973 | 3300029448 | Marine | MARETRRSGEKNDGQDIEMDKFIKDLSENTPNEDQFGEEQDE |
Ga0308025_10016477 | 3300031143 | Marine | MARKTRRSSEKNDGKDLTFPISKLEMEKFMKDLLDNTPNEDQFKENKDE |
Ga0307488_102559592 | 3300031519 | Sackhole Brine | MARKTRRSGEKNDEQDLEMEKFMEEVANNTPNGDQFKEVEDE |
Ga0307993_10295663 | 3300031602 | Marine | MARKTRRSSEKNDGKDLTFPISKLEMEKFMKDLLENTPNEDQFKENKDE |
Ga0308005_101389353 | 3300031656 | Marine | MARKTRRSSEKNDGKDLTFPISKLEMEQFMKDLLENTPNEDQFKENKDE |
Ga0308017_10919843 | 3300031689 | Marine | RIMARKTRRSSEKNDGKDLTFPISKLEMEQFMKDLLDNTPNEDQFKENKDE |
Ga0308016_100446532 | 3300031695 | Marine | MARKTRRSSEKNDGKDLTFPISKLEMEQFMKDLLEN |
Ga0308003_10923931 | 3300031705 | Marine | MARKTRRSSEKNDGKDITFPISKLEMEQFMKDLLDNTPNEDQFKENKD |
Ga0315331_103655843 | 3300031774 | Seawater | MARKTRRSGKTNDGQDIEMEKFIKELSENTPHEDQFGEEENE |
Ga0310343_104010911 | 3300031785 | Seawater | MAREIRRSGETNDGEDLEMEKFLKELSNNTPNEDQFKDKEDE |
Ga0315330_105700191 | 3300032047 | Seawater | TRRSGEKNDGQDLEMEKFMKDLSENTPNEDQFGEEQDE |
⦗Top⦘ |