| Basic Information | |
|---|---|
| Family ID | F026226 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 198 |
| Average Sequence Length | 39 residues |
| Representative Sequence | EGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Number of Associated Samples | 173 |
| Number of Associated Scaffolds | 198 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 100.00 % |
| % of genes from short scaffolds (< 2000 bps) | 85.86 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (87.879 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (16.667 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.737 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.535 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 26.56% Coil/Unstructured: 73.44% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 198 Family Scaffolds |
|---|---|---|
| PF00005 | ABC_tran | 60.10 |
| PF12399 | BCA_ABC_TP_C | 16.67 |
| PF04963 | Sigma54_CBD | 11.62 |
| PF00309 | Sigma54_AID | 6.06 |
| PF03668 | ATP_bind_2 | 3.54 |
| PF00664 | ABC_membrane | 0.51 |
| PF05960 | DUF885 | 0.51 |
| PF13304 | AAA_21 | 0.51 |
| PF00625 | Guanylate_kin | 0.51 |
| COG ID | Name | Functional Category | % Frequency in 198 Family Scaffolds |
|---|---|---|---|
| COG1508 | DNA-directed RNA polymerase specialized sigma subunit, sigma54 homolog | Transcription [K] | 17.68 |
| COG1660 | RNase adaptor protein RapZ for GlmZ sRNA degradation, contains a P-loop ATPase domain | Signal transduction mechanisms [T] | 3.54 |
| COG0194 | Guanylate kinase | Nucleotide transport and metabolism [F] | 0.51 |
| COG4805 | Uncharacterized conserved protein, DUF885 family | Function unknown [S] | 0.51 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 87.88 % |
| Unclassified | root | N/A | 12.12 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000574|JGI1357J11328_10092221 | Not Available | 976 | Open in IMG/M |
| 3300001180|JGI12695J13573_1003230 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1101 | Open in IMG/M |
| 3300001593|JGI12635J15846_10136551 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1704 | Open in IMG/M |
| 3300001661|JGI12053J15887_10397413 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100699559 | Not Available | 892 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101484970 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300004082|Ga0062384_100039164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2211 | Open in IMG/M |
| 3300004152|Ga0062386_101065333 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300004478|Ga0068972_1603121 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300005526|Ga0073909_10379032 | All Organisms → cellular organisms → Bacteria | 662 | Open in IMG/M |
| 3300005541|Ga0070733_10191447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1336 | Open in IMG/M |
| 3300005541|Ga0070733_10214024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300005552|Ga0066701_10461499 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300005555|Ga0066692_10090010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1800 | Open in IMG/M |
| 3300005555|Ga0066692_10887566 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300005557|Ga0066704_10032667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3186 | Open in IMG/M |
| 3300005602|Ga0070762_11051898 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300005618|Ga0068864_102380751 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300005712|Ga0070764_10045569 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2240 | Open in IMG/M |
| 3300005712|Ga0070764_10778684 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300005764|Ga0066903_107818771 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300006041|Ga0075023_100105610 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 980 | Open in IMG/M |
| 3300006046|Ga0066652_100802179 | Not Available | 900 | Open in IMG/M |
| 3300006047|Ga0075024_100242574 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 862 | Open in IMG/M |
| 3300006050|Ga0075028_100564747 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300006800|Ga0066660_11251861 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300006806|Ga0079220_10427888 | Not Available | 876 | Open in IMG/M |
| 3300009038|Ga0099829_11158789 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300009088|Ga0099830_10096917 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2194 | Open in IMG/M |
| 3300009088|Ga0099830_10301681 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1279 | Open in IMG/M |
| 3300009088|Ga0099830_10862970 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300009101|Ga0105247_10028658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3369 | Open in IMG/M |
| 3300009137|Ga0066709_100369879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1977 | Open in IMG/M |
| 3300009143|Ga0099792_10981198 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300009524|Ga0116225_1014065 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4256 | Open in IMG/M |
| 3300009621|Ga0116116_1023931 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2151 | Open in IMG/M |
| 3300009700|Ga0116217_10687002 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300010339|Ga0074046_10534915 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300010341|Ga0074045_10764779 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300010343|Ga0074044_10032452 | Not Available | 3667 | Open in IMG/M |
| 3300010343|Ga0074044_11149536 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300010358|Ga0126370_11861515 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300010360|Ga0126372_12259355 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300010391|Ga0136847_11227890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1236 | Open in IMG/M |
| 3300011110|Ga0138578_1274232 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300011120|Ga0150983_10401489 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300011120|Ga0150983_12992346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1523 | Open in IMG/M |
| 3300011120|Ga0150983_13937316 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2649 | Open in IMG/M |
| 3300011120|Ga0150983_14006959 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300011269|Ga0137392_10510625 | Not Available | 998 | Open in IMG/M |
| 3300011269|Ga0137392_10792810 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300011271|Ga0137393_11338817 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300012096|Ga0137389_10000104 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 45127 | Open in IMG/M |
| 3300012189|Ga0137388_11488119 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300012922|Ga0137394_10460381 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1082 | Open in IMG/M |
| 3300012925|Ga0137419_10093476 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2064 | Open in IMG/M |
| 3300014151|Ga0181539_1125395 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1049 | Open in IMG/M |
| 3300014501|Ga0182024_10000633 | All Organisms → cellular organisms → Bacteria | 91073 | Open in IMG/M |
| 3300014501|Ga0182024_10216861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2598 | Open in IMG/M |
| 3300014638|Ga0181536_10208552 | Not Available | 967 | Open in IMG/M |
| 3300014658|Ga0181519_10804414 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300015356|Ga0134073_10020433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1584 | Open in IMG/M |
| 3300015373|Ga0132257_101147686 | Not Available | 982 | Open in IMG/M |
| 3300016294|Ga0182041_10183487 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1650 | Open in IMG/M |
| 3300016341|Ga0182035_10512956 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1025 | Open in IMG/M |
| 3300017936|Ga0187821_10041492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1639 | Open in IMG/M |
| 3300017942|Ga0187808_10327660 | All Organisms → cellular organisms → Bacteria | 693 | Open in IMG/M |
| 3300017974|Ga0187777_11357137 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300017995|Ga0187816_10011243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3319 | Open in IMG/M |
| 3300017998|Ga0187870_1331746 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300018006|Ga0187804_10164484 | Not Available | 939 | Open in IMG/M |
| 3300018008|Ga0187888_1377718 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300018012|Ga0187810_10472616 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300018034|Ga0187863_10644767 | All Organisms → cellular organisms → Bacteria | 597 | Open in IMG/M |
| 3300018060|Ga0187765_11258928 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300018079|Ga0184627_10510368 | All Organisms → cellular organisms → Bacteria | 618 | Open in IMG/M |
| 3300018433|Ga0066667_10050174 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2514 | Open in IMG/M |
| 3300018468|Ga0066662_10284964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1376 | Open in IMG/M |
| 3300019190|Ga0184600_133592 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300019260|Ga0181506_1222280 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300019270|Ga0181512_1657433 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300019788|Ga0182028_1097373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1731 | Open in IMG/M |
| 3300020034|Ga0193753_10235478 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300020199|Ga0179592_10347377 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300020581|Ga0210399_10894986 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300021046|Ga0215015_10140299 | All Organisms → cellular organisms → Bacteria | 785 | Open in IMG/M |
| 3300021086|Ga0179596_10181215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1018 | Open in IMG/M |
| 3300021088|Ga0210404_10362826 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300021170|Ga0210400_10592453 | Not Available | 914 | Open in IMG/M |
| 3300021171|Ga0210405_10579072 | Not Available | 875 | Open in IMG/M |
| 3300021171|Ga0210405_10588042 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300021171|Ga0210405_10984874 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300021405|Ga0210387_10635991 | Not Available | 947 | Open in IMG/M |
| 3300021432|Ga0210384_10167049 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1976 | Open in IMG/M |
| 3300021474|Ga0210390_10124251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2164 | Open in IMG/M |
| 3300021475|Ga0210392_11137580 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300021477|Ga0210398_10072581 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2800 | Open in IMG/M |
| 3300021560|Ga0126371_10844501 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300021560|Ga0126371_13548791 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300021855|Ga0213854_1331480 | All Organisms → cellular organisms → Bacteria | 732 | Open in IMG/M |
| 3300022506|Ga0242648_1012574 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300022523|Ga0242663_1053633 | All Organisms → cellular organisms → Bacteria | 716 | Open in IMG/M |
| 3300022528|Ga0242669_1053594 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300022530|Ga0242658_1076691 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300022721|Ga0242666_1155705 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300022722|Ga0242657_1081333 | All Organisms → cellular organisms → Bacteria | 769 | Open in IMG/M |
| 3300022726|Ga0242654_10016603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1735 | Open in IMG/M |
| 3300023012|Ga0228597_109170 | All Organisms → cellular organisms → Bacteria | 576 | Open in IMG/M |
| 3300023030|Ga0224561_1023640 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300024178|Ga0247694_1018147 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300024325|Ga0247678_1065566 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300024330|Ga0137417_1009580 | Not Available | 997 | Open in IMG/M |
| 3300025318|Ga0209519_10644606 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300025509|Ga0208848_1091108 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300025812|Ga0208457_1037892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1072 | Open in IMG/M |
| 3300025905|Ga0207685_10689251 | All Organisms → cellular organisms → Bacteria | 555 | Open in IMG/M |
| 3300025906|Ga0207699_10054898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2368 | Open in IMG/M |
| 3300025910|Ga0207684_10956155 | All Organisms → cellular organisms → Bacteria | 718 | Open in IMG/M |
| 3300025910|Ga0207684_11572415 | All Organisms → cellular organisms → Bacteria | 533 | Open in IMG/M |
| 3300025935|Ga0207709_11699934 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300025939|Ga0207665_10152812 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1655 | Open in IMG/M |
| 3300026298|Ga0209236_1105218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1264 | Open in IMG/M |
| 3300026332|Ga0209803_1244726 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300026481|Ga0257155_1071187 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300026489|Ga0257160_1068915 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300026494|Ga0257159_1031962 | Not Available | 877 | Open in IMG/M |
| 3300027073|Ga0208366_1033638 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300027512|Ga0209179_1003073 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2355 | Open in IMG/M |
| 3300027512|Ga0209179_1152887 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300027565|Ga0209219_1035817 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1237 | Open in IMG/M |
| 3300027605|Ga0209329_1149318 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300027643|Ga0209076_1046989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1220 | Open in IMG/M |
| 3300027671|Ga0209588_1017574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2218 | Open in IMG/M |
| 3300027738|Ga0208989_10112005 | Not Available | 927 | Open in IMG/M |
| 3300027767|Ga0209655_10228074 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300027812|Ga0209656_10549515 | All Organisms → cellular organisms → Bacteria | 500 | Open in IMG/M |
| 3300027826|Ga0209060_10122092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1213 | Open in IMG/M |
| 3300027855|Ga0209693_10274620 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
| 3300027875|Ga0209283_10012210 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5117 | Open in IMG/M |
| 3300027882|Ga0209590_10834981 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300027884|Ga0209275_10145152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1253 | Open in IMG/M |
| 3300027889|Ga0209380_10299205 | Not Available | 945 | Open in IMG/M |
| 3300027894|Ga0209068_10736313 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300027903|Ga0209488_11022949 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300027908|Ga0209006_11469166 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300028047|Ga0209526_10189137 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1430 | Open in IMG/M |
| 3300028536|Ga0137415_10431471 | All Organisms → cellular organisms → Bacteria | 1123 | Open in IMG/M |
| 3300028773|Ga0302234_10068578 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1582 | Open in IMG/M |
| 3300028780|Ga0302225_10013329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4239 | Open in IMG/M |
| 3300028792|Ga0307504_10141525 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria) | 808 | Open in IMG/M |
| 3300028800|Ga0265338_10166543 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1696 | Open in IMG/M |
| 3300028906|Ga0308309_10560535 | Not Available | 990 | Open in IMG/M |
| 3300029636|Ga0222749_10123973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1236 | Open in IMG/M |
| 3300029943|Ga0311340_11383152 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300029944|Ga0311352_10081142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2885 | Open in IMG/M |
| 3300029999|Ga0311339_11877665 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300030524|Ga0311357_10410895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1276 | Open in IMG/M |
| 3300030580|Ga0311355_10397936 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1349 | Open in IMG/M |
| 3300030718|Ga0307919_1001224 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3218 | Open in IMG/M |
| 3300031057|Ga0170834_108752526 | Not Available | 1022 | Open in IMG/M |
| 3300031057|Ga0170834_112541984 | All Organisms → cellular organisms → Bacteria | 657 | Open in IMG/M |
| 3300031122|Ga0170822_15215533 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300031231|Ga0170824_124956276 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300031236|Ga0302324_102255915 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria) | 673 | Open in IMG/M |
| 3300031446|Ga0170820_17389823 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300031474|Ga0170818_101257022 | Not Available | 956 | Open in IMG/M |
| 3300031525|Ga0302326_10680503 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1509 | Open in IMG/M |
| 3300031525|Ga0302326_12357674 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300031718|Ga0307474_10016335 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5379 | Open in IMG/M |
| 3300031719|Ga0306917_10995548 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031720|Ga0307469_11539972 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300031720|Ga0307469_12000678 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300031744|Ga0306918_10873903 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300031748|Ga0318492_10694432 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300031751|Ga0318494_10128396 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1417 | Open in IMG/M |
| 3300031754|Ga0307475_10540950 | Not Available | 934 | Open in IMG/M |
| 3300031754|Ga0307475_11411427 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300031780|Ga0318508_1062050 | Not Available | 1002 | Open in IMG/M |
| 3300031820|Ga0307473_10064092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1810 | Open in IMG/M |
| 3300031820|Ga0307473_11013626 | All Organisms → cellular organisms → Bacteria | 607 | Open in IMG/M |
| 3300031823|Ga0307478_10612387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 911 | Open in IMG/M |
| 3300031879|Ga0306919_10224196 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1406 | Open in IMG/M |
| 3300031942|Ga0310916_10185219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1736 | Open in IMG/M |
| 3300031942|Ga0310916_11308096 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300031954|Ga0306926_10010923 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 10052 | Open in IMG/M |
| 3300031954|Ga0306926_11580155 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300032010|Ga0318569_10220811 | Not Available | 879 | Open in IMG/M |
| 3300032035|Ga0310911_10644389 | All Organisms → cellular organisms → Bacteria | 614 | Open in IMG/M |
| 3300032061|Ga0315540_10362018 | All Organisms → cellular organisms → Bacteria | 588 | Open in IMG/M |
| 3300032067|Ga0318524_10685069 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300032076|Ga0306924_12405107 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300032174|Ga0307470_10002384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 7194 | Open in IMG/M |
| 3300032180|Ga0307471_101458177 | Not Available | 843 | Open in IMG/M |
| 3300032261|Ga0306920_100181707 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3137 | Open in IMG/M |
| 3300032261|Ga0306920_101476576 | Not Available | 972 | Open in IMG/M |
| 3300032954|Ga0335083_10206288 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1793 | Open in IMG/M |
| 3300033289|Ga0310914_10487407 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1115 | Open in IMG/M |
| 3300033755|Ga0371489_0546293 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.67% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.62% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 7.58% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.05% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.05% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.05% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.54% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.54% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 3.03% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.53% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.53% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.53% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.02% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.02% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.02% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.02% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.02% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.02% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.52% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.01% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.01% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.01% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.51% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.51% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Contaminated → Groundwater | 0.51% |
| Salt Marsh Sediment | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment | 0.51% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.51% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.51% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.51% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.51% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.51% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.51% |
| Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.51% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.51% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.51% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.51% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.51% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000574 | Subsurface groundwater microbial communities from S. Glens Falls, New York, USA - GMW46 contaminated, 5.4 m | Environmental | Open in IMG/M |
| 3300001180 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M3 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004478 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 69 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006041 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011110 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017995 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_1 | Environmental | Open in IMG/M |
| 3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019190 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZE3 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019260 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019270 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020034 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021855 | Metatranscriptome of freshwater sediment microbial communities from pre-fracked creek in Pennsylvania, United States - G-2016_18 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022506 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-26-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022523 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022528 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022530 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022722 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-12-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023012 | Spruce litter microbial communities from Bohemian Forest, Czech Republic - CLU4 | Environmental | Open in IMG/M |
| 3300023030 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU2 | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024325 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK19 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025318 | Soil microbial communities from Rifle, Colorado, USA - sediment 13ft 1 | Environmental | Open in IMG/M |
| 3300025509 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
| 3300027073 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027605 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030718 | Metatranscriptome of soil microbial communities from Risofladan, Vaasa, Finland - OX-1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032061 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1357J11328_100922211 | 3300000574 | Groundwater | TILGTTTGRQLTFFLADDKILIDSEEGSRTLSRHRVEK* |
| JGI12695J13573_10032301 | 3300001180 | Forest Soil | GTTTGRQLTFFLADDTIIVDSEKGSRTLTKHQVQK* |
| JGI12635J15846_101365513 | 3300001593 | Forest Soil | QGTTTGRQLTFFLADDTIIVDSEKGSRTLTKHQVQK* |
| JGI12053J15887_103974131 | 3300001661 | Forest Soil | ASKGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK* |
| JGIcombinedJ26739_1006995592 | 3300002245 | Forest Soil | TTTGRQLTFFLADDTIIVDSEKGSRTLTKHQVQK* |
| JGIcombinedJ26739_1014849701 | 3300002245 | Forest Soil | EGKPTLYSSTGDTTTGRQLTFYFADDRIVVDSTDGSKTVTLHQVEK* |
| Ga0062384_1000391643 | 3300004082 | Bog Forest Soil | FDADQGTTTGRELTFFLSDDRILIDSGNGTRTLSRHRIQ* |
| Ga0062386_1010653331 | 3300004152 | Bog Forest Soil | IFDATEGTTTGRQLTFFLADATIIVDSENGSRTLTKHRVDK* |
| Ga0068972_16031211 | 3300004478 | Peatlands Soil | KPTLYSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK* |
| Ga0073909_103790321 | 3300005526 | Surface Soil | GTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK* |
| Ga0070733_101914473 | 3300005541 | Surface Soil | EGTTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK* |
| Ga0070733_102140241 | 3300005541 | Surface Soil | GKPTLYSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK* |
| Ga0066701_104614991 | 3300005552 | Soil | EGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK* |
| Ga0066692_100900101 | 3300005555 | Soil | TTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK* |
| Ga0066692_108875661 | 3300005555 | Soil | PTIFDAAEGTTTGLQLTFFLADDTIIVDSEKGSRTLTKHRVDR* |
| Ga0066704_100326674 | 3300005557 | Soil | FDAAEGTTTGLQLTFFLADDTIIVDSEKGSRTLTKHRVDK* |
| Ga0070762_110518982 | 3300005602 | Soil | TEGTTKGRQLTFYLADDTIIVDSENGSRTLTKHRVEK* |
| Ga0068864_1023807511 | 3300005618 | Switchgrass Rhizosphere | TATGRQLTFYFADDRIVVDSTDGSKTVTLHQVEK* |
| Ga0070764_100455693 | 3300005712 | Soil | SGTTTGTQLTFFLADDTIIVDSENGSRTLTKHRVQQ* |
| Ga0070764_107786842 | 3300005712 | Soil | LYDGASGTTTGTQLTFFLADDTIIVDSENGSRTLTKHRVQQ* |
| Ga0066903_1078187712 | 3300005764 | Tropical Forest Soil | TLYSSTGDTTTGRQLTFYFADDRIVVESAEGSKTVTLHQVEK* |
| Ga0075023_1001056101 | 3300006041 | Watersheds | FVLSEGKPTLYSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK* |
| Ga0066652_1008021791 | 3300006046 | Soil | SEGTTTGRQLTFYLADATIIVDSENGSRTLTKHRVEK* |
| Ga0075024_1002425742 | 3300006047 | Watersheds | TLYSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK* |
| Ga0075028_1005647471 | 3300006050 | Watersheds | GTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVDR* |
| Ga0066660_112518612 | 3300006800 | Soil | FDASSGTTTGRQLTFFLADATIIVDSENGPRTLTKHRVENK* |
| Ga0079220_104278883 | 3300006806 | Agricultural Soil | DTTTGHSLTFFVASDTILIDSQEGSRTLTKHRIEK* |
| Ga0099829_111587891 | 3300009038 | Vadose Zone Soil | IYDAVEGTTTGRQLTFFLADDTIIVDSENGSRTLTRHRVEK* |
| Ga0099830_100969173 | 3300009088 | Vadose Zone Soil | ALEGTTTGHQLTFFLADDTIIIDSENGSRTLTKHRVDK* |
| Ga0099830_103016813 | 3300009088 | Vadose Zone Soil | AGTTTGRQLTFYLADDTIIVDSETGSRIVTKHRVEK* |
| Ga0099830_108629701 | 3300009088 | Vadose Zone Soil | SSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK* |
| Ga0105247_100286581 | 3300009101 | Switchgrass Rhizosphere | GSTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK* |
| Ga0066709_1003698793 | 3300009137 | Grasslands Soil | SEGATTDRQLTFFLADDTIIVDSENGARTLTKHRVEK* |
| Ga0099792_109811981 | 3300009143 | Vadose Zone Soil | TTTGRQLTFFLADDTIIVDSENGSRTLTKHRVDK* |
| Ga0116225_10140651 | 3300009524 | Peatlands Soil | DTITGHSLTFFVASDTILIDSQEGSRTLTKHRVEK* |
| Ga0116116_10239311 | 3300009621 | Peatland | GTTSGRELTFFLADDTIVVDSGNGSRTLTKHRVQR* |
| Ga0116217_106870022 | 3300009700 | Peatlands Soil | YLLFLLIVGQPSLFFPDHFPITLRELTFFLADDTIMIDSGNGSRTLTKHRVQR* |
| Ga0074046_105349152 | 3300010339 | Bog Forest Soil | FDPEQGTTSGRELTFFLADDTIVVDSGNGSRTLTKHRVQK* |
| Ga0074045_107647792 | 3300010341 | Bog Forest Soil | YDAEEGKTTGRELTFNIADDTIIVDSGNGTRTLTKHRVQR* |
| Ga0074044_100324521 | 3300010343 | Bog Forest Soil | KPTLFDADQGTTTGRELTFFLADDRILVDSGDGTRTLSRHRIQ* |
| Ga0074044_111495361 | 3300010343 | Bog Forest Soil | VLYDDSGNSTTGRQLTFIFADDRIVVDSEEGTKTVTLHRVEK* |
| Ga0126370_118615152 | 3300010358 | Tropical Forest Soil | DAAEGTTTGRQLTFFLADATIIVDSENGSRTLTKHRVENK* |
| Ga0126372_122593551 | 3300010360 | Tropical Forest Soil | AGTTSGRQLTFFLADDTIIVDSETGSRILTKHRVEK* |
| Ga0136847_112278901 | 3300010391 | Freshwater Sediment | TLYDTVLGTTTGRQLTFFLADDKILIDSEEGSRTLSRHRVEK* |
| Ga0138578_12742321 | 3300011110 | Peatlands Soil | YDSNGDTTTGRQLTFYFADDRIVVDSEEGSRTVTLHRVEK* |
| Ga0150983_104014892 | 3300011120 | Forest Soil | VLSEGKPTLYSSTGDTTTGRQLTFYFADDRIVVDSADGTKTVTLHQVEK* |
| Ga0150983_129923461 | 3300011120 | Forest Soil | SDTTTGHSLTFFVANDTILIDSQSGSRTLTKHRVEK* |
| Ga0150983_139373161 | 3300011120 | Forest Soil | EGTTTGHQLTFFLADDTIIVDSEKGSRTLTKHRVE* |
| Ga0150983_140069592 | 3300011120 | Forest Soil | TTTGRQLTFYFADDRILVDSADGSKTVTLHQVEK* |
| Ga0137392_105106253 | 3300011269 | Vadose Zone Soil | AEGTTTGHQLTFFLADDTIIVDSETGSRTLTKHRVDR* |
| Ga0137392_107928101 | 3300011269 | Vadose Zone Soil | YDAVEGTTTGRQLTFFLADDTIIVDSENGSRTLTRHRVEK* |
| Ga0137393_113388171 | 3300011271 | Vadose Zone Soil | GTTTGHQLTFFLADDTIIVDSENGSRTLTKHRVEK* |
| Ga0137389_1000010445 | 3300012096 | Vadose Zone Soil | TTTGHQLTFFLADDTIIVDSENGSRTLTKHRVDK* |
| Ga0137388_114881191 | 3300012189 | Vadose Zone Soil | DAFRGTTTGRQLTFFFADDTIVVDSEEGSRTLTRHRVEK* |
| Ga0137394_104603813 | 3300012922 | Vadose Zone Soil | YDASQGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVDK* |
| Ga0137419_100934761 | 3300012925 | Vadose Zone Soil | LFDASEGTTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK* |
| Ga0181539_11253951 | 3300014151 | Bog | LFDPEQGTTSGRELTFFLADDTIVVDSGNGSRTLTKHRVQR* |
| Ga0182024_100006331 | 3300014501 | Permafrost | TQGTTTGRQLTFFLADDTIIVDSEKGSRTLTKHQVQK* |
| Ga0182024_102168611 | 3300014501 | Permafrost | NDTTTGRSLTFFVASDTILVDSQEGVRTITKHRVEK* |
| Ga0181536_102085521 | 3300014638 | Bog | KPTLFDPEQGTTTGRELTFFLADDTIIVDSGNGLRTLTKHRVQR* |
| Ga0181519_108044141 | 3300014658 | Bog | AANDTTTGRSLTFFVASDTILIDSQEGLRTLTKHRVEK* |
| Ga0134073_100204333 | 3300015356 | Grasslands Soil | FDASEGATTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK* |
| Ga0132257_1011476861 | 3300015373 | Arabidopsis Rhizosphere | ASEGSTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK* |
| Ga0182041_101834871 | 3300016294 | Soil | TLYDENEGKTTGRELTFNIADDTIVVDSGSGKRTLTRHRVQR |
| Ga0182035_105129563 | 3300016341 | Soil | LYDENEGKTTGRELTFNIADDTIVVDSGSGKRTLTRHRVQR |
| Ga0187821_100414921 | 3300017936 | Freshwater Sediment | DSTGDTTTGRQLTFYFADDRIVVDSEEGTKTVTLHRVEK |
| Ga0187808_103276601 | 3300017942 | Freshwater Sediment | NSTTGRQLTFFFADDRIVVDSDEGTRTVTLHRVGK |
| Ga0187777_113571372 | 3300017974 | Tropical Peatland | EGKTTGRELTFNIADDTIVVDSGNGTRTLTKHRVQR |
| Ga0187816_100112431 | 3300017995 | Freshwater Sediment | GKPTLYSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK |
| Ga0187870_13317461 | 3300017998 | Peatland | TIFDASSGTTTGRQLTFYNADDTIIVDSELGSRTLTKHRVEK |
| Ga0187804_101644841 | 3300018006 | Freshwater Sediment | FVLSEGKPTLYSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK |
| Ga0187888_13777181 | 3300018008 | Peatland | NDTTTGRSLTFYRASDTILVDSEAGSRTLTKHRVEK |
| Ga0187810_104726162 | 3300018012 | Freshwater Sediment | VLSEGKPTLYSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK |
| Ga0187863_106447671 | 3300018034 | Peatland | NTTTGRSLTFYRASDTILVDSEAGSRTLTKHRVEK |
| Ga0187765_112589281 | 3300018060 | Tropical Peatland | GTTVGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0184627_105103681 | 3300018079 | Groundwater Sediment | KPTLYDAVLGTLTGRQLTFFLADDKILVDSEEGSRTVTRHRVEK |
| Ga0066667_100501741 | 3300018433 | Grasslands Soil | EGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0066662_102849641 | 3300018468 | Grasslands Soil | TLFDSVNGTTTGHELTFFFADDTIIVDSENGLRTVTKHRVER |
| Ga0184600_1335921 | 3300019190 | Soil | LYSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK |
| Ga0181506_12222801 | 3300019260 | Peatland | DTTTTGRSLTFYVASDTILIDSQEGLRTLTKHRVEK |
| Ga0181512_16574331 | 3300019270 | Peatland | SDGDTTTGRQLTFYFSDDRIVVDSEAGSKTVTLHRVEK |
| Ga0182028_10973731 | 3300019788 | Fen | FDPDFDPEQGTTSGRELTFFLADDTIMVDSGNGSRTLTKHRVQR |
| Ga0193753_102354782 | 3300020034 | Soil | LFDGTQGTTTGRQLTFFLADDTIIVDSEKGSRTLTKHQVQK |
| Ga0179592_103473771 | 3300020199 | Vadose Zone Soil | YDAVEGTTTGHQLTFFLADDTIIVDSETGSRTLTKHRVDR |
| Ga0210399_108949861 | 3300020581 | Soil | IYDAAEGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVDK |
| Ga0215015_101402991 | 3300021046 | Soil | TLYSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK |
| Ga0179596_101812153 | 3300021086 | Vadose Zone Soil | SEGTTTGRQLTFYLADATIIVDSENGSRTLTKHRVEK |
| Ga0210404_103628261 | 3300021088 | Soil | ALYDGTSGTTTGTQLTFFLADDTIIVDSENGSRTLTKHRVQQ |
| Ga0210400_105924532 | 3300021170 | Soil | DGTSGTTTGTQLTFFLADDTIIVDSENGSRTLTKHRVQQ |
| Ga0210405_105790721 | 3300021171 | Soil | EGTTTGRQLTFFLADDTIIVDSENGPRTLTKHRVDN |
| Ga0210405_105880422 | 3300021171 | Soil | DGSAGTTVGRQLTFFLADDTIIVDSENGSRTLTKHRVQN |
| Ga0210405_109848742 | 3300021171 | Soil | SDTTTGHSLTFFVANDTILIDSQEGLRTLTKHRVEK |
| Ga0210387_106359911 | 3300021405 | Soil | YDPIEGTTTGRELTFFMADDTIIVDSGNGTRTLTRHRVQR |
| Ga0210384_101670491 | 3300021432 | Soil | ASEGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVDK |
| Ga0210390_101242511 | 3300021474 | Soil | SAGTTTGRQLTFYLADDTIIVDSENGSRTLTKHRVEK |
| Ga0210392_111375802 | 3300021475 | Soil | GGTPTLYDPVEGTTTGRELTFFMADDTIIVDSGNGTRTLTKHRVQR |
| Ga0210398_100725814 | 3300021477 | Soil | DGSAGNTTGRQLTFFLADDTIIVDSENGSRVLTKHRVEK |
| Ga0126371_108445011 | 3300021560 | Tropical Forest Soil | IFDASEGTTTGTQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0126371_135487912 | 3300021560 | Tropical Forest Soil | FDASEGTTTGRQLTFFLADATIIVNSEAGSRTLTKHRVEK |
| Ga0213854_13314801 | 3300021855 | Watersheds | TLYSSTGDSTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK |
| Ga0242648_10125743 | 3300022506 | Soil | STGDTTTGRQLTFYFADDRILVDSADGSKTVTLHQVEK |
| Ga0242663_10536331 | 3300022523 | Soil | IFDASEGTTRGHQLTFFLADDTIIADSENGARTLTKHRVDK |
| Ga0242669_10535942 | 3300022528 | Soil | STGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK |
| Ga0242658_10766911 | 3300022530 | Soil | EGITMGRQLTFHIADDTIIVDSGEGLRTLTKHRVQ |
| Ga0242666_11557052 | 3300022721 | Soil | LYSSTGDTTTGRQLTFYFADDRILVDSTDGSKTVTLHQVEK |
| Ga0242657_10813332 | 3300022722 | Soil | LYSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHTVEK |
| Ga0242654_100166033 | 3300022726 | Soil | PTLYDAQEGITMGRQLTFHIADDTIIVDSGEGLRTLTKHRVQ |
| Ga0228597_1091701 | 3300023012 | Plant Litter | DTTTQGHSLTFYVASDTILIDAQAGSKTLTKHRVEK |
| Ga0224561_10236401 | 3300023030 | Soil | YDGSAGTTTGRQLTFYLADDRIIVDSENGSRTLTKHRVEK |
| Ga0247694_10181472 | 3300024178 | Soil | AGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0247678_10655662 | 3300024325 | Soil | SAGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0137417_10095803 | 3300024330 | Vadose Zone Soil | EGTTTGRELTFFLADDTIIVGSENGSRTLTKHRVEK |
| Ga0209519_106446062 | 3300025318 | Soil | ARGTTTGRQLTFFLADDKILIDSEEGSRTLTRHRVEK |
| Ga0208848_10911082 | 3300025509 | Arctic Peat Soil | GTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0208457_10378923 | 3300025812 | Peatland | PTLFDPEQGTTSGRELTFFLADDTIVVDSGNGSRTLTKHRVQR |
| Ga0207685_106892512 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | ASQGTTTGRQLTFFLADATIIVDSENGSRTVTKHRVEK |
| Ga0207699_100548983 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | LYDGTAGTTTGTQLTFFLADDTIIVDSENGSRTLTKHRVQQ |
| Ga0207684_109561552 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | QGTTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0207684_115724151 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | TEGATTGRQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0207709_116999342 | 3300025935 | Miscanthus Rhizosphere | ASEGTTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0207665_101528123 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | DASEGTTTGRQLTFYLADATIIVDSENGSRTLTKHRVEK |
| Ga0209236_11052183 | 3300026298 | Grasslands Soil | DASQGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0209803_12447262 | 3300026332 | Soil | IYDAAEGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0257155_10711871 | 3300026481 | Soil | AASGTTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0257160_10689152 | 3300026489 | Soil | AGTTTGLQLTFFLADDTIIVDSENGSRTLTKHRVQK |
| Ga0257159_10319621 | 3300026494 | Soil | SQGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0208366_10336381 | 3300027073 | Forest Soil | GTTTGRQLTFYLADDTIIVDSENGSRTLTKHRVEK |
| Ga0209179_10030731 | 3300027512 | Vadose Zone Soil | AGTTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0209179_11528871 | 3300027512 | Vadose Zone Soil | YDAVEGTTTGRQLTFFLADDTIIVDSENGSRTLTRHRVEK |
| Ga0209219_10358173 | 3300027565 | Forest Soil | DTTTGRQLTFYFADDRIVVDSADGSKTVTLHQVEK |
| Ga0209329_11493181 | 3300027605 | Forest Soil | DTTTGRQLTFYFADDRIVVDSTDGSKTVTLHQVEK |
| Ga0209076_10469893 | 3300027643 | Vadose Zone Soil | GSAGTTTGRQLTFYLADDTIIVDSENGSRTLTKHRVEK |
| Ga0209588_10175741 | 3300027671 | Vadose Zone Soil | TIYDAVEGTTVGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0208989_101120051 | 3300027738 | Forest Soil | IFDAVEGTTTGHQLTFFLADDTIIVDSETGSRTLTKHRVEK |
| Ga0209655_102280741 | 3300027767 | Bog Forest Soil | TGGNPTLYDSTEGTTTGRQLTFFLADDTIIVDSENGPRILTKHRVEN |
| Ga0209656_105495151 | 3300027812 | Bog Forest Soil | GTPTLYDATEGTTTGRELTFNNADDTIIVDSGKGMRTLTKHRVQR |
| Ga0209060_101220923 | 3300027826 | Surface Soil | DATEGTTTGRELTFNMADDTIIVDSGSGSRTLTKHRVQK |
| Ga0209693_102746202 | 3300027855 | Soil | TEGTTKGRQLTFYLADDTIIVDSENGSRTLTKHRVEK |
| Ga0209283_100122101 | 3300027875 | Vadose Zone Soil | FDASEGTTTGRQLTFFLADDTIIVDSENGSRTLTKHRVEK |
| Ga0209590_108349812 | 3300027882 | Vadose Zone Soil | ASEGTTTGRQLTFFLADDTIIVDSETGSRTLTKHRVD |
| Ga0209275_101451523 | 3300027884 | Soil | GSAGTTTGRQLTFYLADDRIIVDSENGSRTLTKHRVEK |
| Ga0209380_102992051 | 3300027889 | Soil | EGKTTGRELTFNIADDTIIVDSGSGKRTLTRHRVQR |
| Ga0209068_107363132 | 3300027894 | Watersheds | AKEGTTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0209488_110229491 | 3300027903 | Vadose Zone Soil | YDASEGTTTGRQLTFFLADDTIIVDSETGSRTLTKHRVD |
| Ga0209006_114691661 | 3300027908 | Forest Soil | SNRAEYTVAEGKFGLSEGKPTIYDSTGDTTTGRQLTFYFADDRIVVDSEAGSRTVTLHRVEK |
| Ga0209526_101891371 | 3300028047 | Forest Soil | ASAGTTTGRQLTFHLADDTIVVDSETGSRIVTKHRVQK |
| Ga0137415_104314711 | 3300028536 | Vadose Zone Soil | YSSTGDTTTGRQLTFYFADDRIVVDSADGSKTVTLHRVEK |
| Ga0302234_100685783 | 3300028773 | Palsa | DDSGNSTTGRQLTFIFADDTIVVDSEEGTRTLTLHRVEK |
| Ga0302225_100133291 | 3300028780 | Palsa | GAEGNTTGRQLTFFLADDTIIVDSESGPRILTKHRVEK |
| Ga0307504_101415251 | 3300028792 | Soil | KPTLTDAFQNTTTGRQLTFFTANDTILVESSAGLRTLTKHRVEK |
| Ga0265338_101665431 | 3300028800 | Rhizosphere | TTEGMTRGRELTFYIASDTIIVDSGNGLRTLTKHRVQR |
| Ga0308309_105605351 | 3300028906 | Soil | LYDGSAGTTTGLQLTFFLADDTIIVDSENGSRTLTKHRVRQ |
| Ga0222749_101239731 | 3300029636 | Soil | DTTTGHSLTFFVANDTILIDSQSGSRTLTKHRVEK |
| Ga0311340_113831521 | 3300029943 | Palsa | SEGKPTLYSSTGDTTTGRQLTFYFADDRILVDSADGSKTVTLHQVEK |
| Ga0311352_100811421 | 3300029944 | Palsa | PTLYDGTDGTTVGRQLTFFLANDTIIVDSENGPRILTRHRVDKDR |
| Ga0311339_118776651 | 3300029999 | Palsa | LSEGKPTLYSSTGDTTTGRQLTFYFADDRIVVDSADGLKTVTLHQVQK |
| Ga0311357_104108951 | 3300030524 | Palsa | DGTDGTTVGRQLTFFLANDTIIVDSENGPRILTRHRVDKDR |
| Ga0311355_103979361 | 3300030580 | Palsa | AENDTTTGRSLTFYRASDTIFIDSAAGSRTLTKHQVEK |
| Ga0307919_10012244 | 3300030718 | Soil | SGNTTTGRELTFFLASDTILVDSQNGPRTITKRRVEK |
| Ga0170834_1087525263 | 3300031057 | Forest Soil | ASGTTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0170834_1125419842 | 3300031057 | Forest Soil | GTTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0170822_152155332 | 3300031122 | Forest Soil | DTSEGTTTGHQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0170824_1249562762 | 3300031231 | Forest Soil | SEGTTTGRQLTFFLADATIIVGSENGSRTLTKHRVEK |
| Ga0302324_1022559151 | 3300031236 | Palsa | DTTTGHSLTFFVANDTILIDSREGSRTLTKHRVEK |
| Ga0170820_173898232 | 3300031446 | Forest Soil | SEGTTTGRQLTFFLADATIIVGSENGSRTLTKHQVEK |
| Ga0170818_1012570222 | 3300031474 | Forest Soil | GSAGTTTGTQLTFFLADDTIIVDSENGSRTLTKHRVRQ |
| Ga0302326_106805031 | 3300031525 | Palsa | GDTTTGRQLTFYFADDRIVVDSEAGSRTVTLHRVEK |
| Ga0302326_123576741 | 3300031525 | Palsa | DTTTGGRSLTFFVASDTILVDSQEGLRTLTKHRVEK |
| Ga0307474_100163356 | 3300031718 | Hardwood Forest Soil | ASEGTTTGQQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0306917_109955481 | 3300031719 | Soil | LVDAAEGTTVGRQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0307469_115399721 | 3300031720 | Hardwood Forest Soil | TLFDPIEGTTTGRELTFYKADDTIVVDSGNGLRTLTKHRVQR |
| Ga0307469_120006782 | 3300031720 | Hardwood Forest Soil | GSTTGRQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0306918_108739031 | 3300031744 | Soil | LYDATEGTTTGRELTFNIADDTIIVDSGNGTRTLTKHRVQR |
| Ga0318492_106944322 | 3300031748 | Soil | NQGSTTGRQLTFFLTDATIIVDSENGSRTLTKHRVEK |
| Ga0318494_101283963 | 3300031751 | Soil | TEGTTTGRELTFNIANDTIIVDSGNGTRTLTKHRVQR |
| Ga0307475_105409502 | 3300031754 | Hardwood Forest Soil | FDASEGTTTGRQLTFFLADDTIIVDSETGSRTLTKHRVDK |
| Ga0307475_114114271 | 3300031754 | Hardwood Forest Soil | DGSAGTTTGLQLTFFLADDTIIVDSENGSRTLTKHRVQK |
| Ga0318508_10620502 | 3300031780 | Soil | SGGTPTLYDATEGTTTGRELTFNIANDTIIVDSGNGTRTLTKHRVQR |
| Ga0307473_100640923 | 3300031820 | Hardwood Forest Soil | QEGTTTGRQLTFHIADDTIIVDSAEGLRTLTKHRVQ |
| Ga0307473_110136261 | 3300031820 | Hardwood Forest Soil | TIFDATEGTTTGRQLTFFLADDTIIVDSETGSRTLTKHRVD |
| Ga0307478_106123871 | 3300031823 | Hardwood Forest Soil | TSGDTTTGRQLTFYFADDRIVVDSTDGSKTVTLHQVEK |
| Ga0306919_102241961 | 3300031879 | Soil | DATEGTTTGRELTFNIADDTIIVDSGTGTRTLTKHRVQK |
| Ga0310916_101852193 | 3300031942 | Soil | EGTTSGRELTFNLADDTIIVDSGNGLRTLTKHRVQR |
| Ga0310916_113080961 | 3300031942 | Soil | TLYDATEGTTTGRELTFNIADDTITVDSGNGTRTLTKHRVQR |
| Ga0306926_1001092311 | 3300031954 | Soil | GTPTLYDATEGTTTGRELTFNIADDTIIVDSGNGTRTLTKHRVQR |
| Ga0306926_115801552 | 3300031954 | Soil | LYDENEGKTTGRELTFNIADDTIVVDSGNGTRTLTKHRVQR |
| Ga0318569_102208111 | 3300032010 | Soil | GTPTLYDATEGTTTGRELTFNIANDTIIVDSGNGTRTLTKHRVQR |
| Ga0310911_106443891 | 3300032035 | Soil | GTTTGRQLTFFLADATIIVNSETGSRTLTKHRVEK |
| Ga0315540_103620181 | 3300032061 | Salt Marsh Sediment | GKPTLYSSSGDMTTGRQLTFFFADDRIVVDSEEGSKTVTLHRVEK |
| Ga0318524_106850691 | 3300032067 | Soil | GTTTGRELTFNIANDTIIVDSGNGTRTLTKHRVQR |
| Ga0306924_124051072 | 3300032076 | Soil | NPTLYDAQEGTTTGRQLTFHIADDTIIVDSAQGLRTLTKHRVQ |
| Ga0307470_100023849 | 3300032174 | Hardwood Forest Soil | GTTTGHQLTFFLADATIIVDSENGSRTLTKHRVEK |
| Ga0307471_1014581772 | 3300032180 | Hardwood Forest Soil | EGTTTGHQLTFFLADATIIVDSESGSRTLTKHRVEK |
| Ga0306920_1001817071 | 3300032261 | Soil | LYDATEGTTTGRELTFNIADDTITVDSGNGTRTLTKHRVQR |
| Ga0306920_1014765762 | 3300032261 | Soil | FDAAEGTTTGRQLTFFSADATIIVDSENGSRTLTKHRVEK |
| Ga0335083_102062883 | 3300032954 | Soil | GNPTLYDADQGTTTGRELTFFLADDRILIDSGNGTRTLSRHRIP |
| Ga0310914_104874073 | 3300033289 | Soil | GTTTGRELTFNIADDTITVDSGNGTRTLTKHRVQR |
| Ga0371489_0546293_388_504 | 3300033755 | Peat Soil | ASEGTTTGRELTFNNADDTIIVDSGNGTRTLTKHRVQR |
| ⦗Top⦘ |