| Basic Information | |
|---|---|
| Family ID | F026165 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 199 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LLLLDGQVHHDTHAIPMGNYVIGVGNYVIATPSELGNYMSADT |
| Number of Associated Samples | 166 |
| Number of Associated Scaffolds | 199 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 83.16 % |
| % of genes near scaffold ends (potentially truncated) | 72.86 % |
| % of genes from short scaffolds (< 2000 bps) | 70.85 % |
| Associated GOLD sequencing projects | 153 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.18 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.271 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (15.075 % of family members) |
| Environment Ontology (ENVO) | Unclassified (21.106 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.216 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.18 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 199 Family Scaffolds |
|---|---|---|
| PF00665 | rve | 33.67 |
| PF01695 | IstB_IS21 | 8.54 |
| PF02661 | Fic | 1.01 |
| PF01850 | PIN | 1.01 |
| PF02899 | Phage_int_SAM_1 | 1.01 |
| PF00198 | 2-oxoacid_dh | 1.01 |
| PF00313 | CSD | 0.50 |
| PF01527 | HTH_Tnp_1 | 0.50 |
| PF13460 | NAD_binding_10 | 0.50 |
| PF03721 | UDPG_MGDP_dh_N | 0.50 |
| PF13413 | HTH_25 | 0.50 |
| PF13424 | TPR_12 | 0.50 |
| PF12161 | HsdM_N | 0.50 |
| PF09952 | AbiEi_2 | 0.50 |
| PF08241 | Methyltransf_11 | 0.50 |
| PF07508 | Recombinase | 0.50 |
| PF00474 | SSF | 0.50 |
| PF02838 | Glyco_hydro_20b | 0.50 |
| PF00589 | Phage_integrase | 0.50 |
| PF12770 | CHAT | 0.50 |
| PF13589 | HATPase_c_3 | 0.50 |
| PF04542 | Sigma70_r2 | 0.50 |
| PF01546 | Peptidase_M20 | 0.50 |
| PF00440 | TetR_N | 0.50 |
| PF00293 | NUDIX | 0.50 |
| PF13561 | adh_short_C2 | 0.50 |
| PF00196 | GerE | 0.50 |
| PF13191 | AAA_16 | 0.50 |
| PF13408 | Zn_ribbon_recom | 0.50 |
| PF13672 | PP2C_2 | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 199 Family Scaffolds |
|---|---|---|---|
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 33.67 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 33.67 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 33.67 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 33.67 |
| COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 8.54 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 1.01 |
| COG4974 | Site-specific recombinase XerD | Replication, recombination and repair [L] | 1.01 |
| COG4973 | Site-specific recombinase XerC | Replication, recombination and repair [L] | 1.01 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.50 |
| COG1893 | Ketopantoate reductase | Coenzyme transport and metabolism [H] | 0.50 |
| COG1961 | Site-specific DNA recombinase SpoIVCA/DNA invertase PinE | Replication, recombination and repair [L] | 0.50 |
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 0.50 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.50 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG3525 | N-acetyl-beta-hexosaminidase | Carbohydrate transport and metabolism [G] | 0.50 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.50 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.50 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.27 % |
| All Organisms | root | All Organisms | 45.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001356|JGI12269J14319_10045770 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia dioxanivorans | 2673 | Open in IMG/M |
| 3300001384|JGI20190J14840_1001871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 2661 | Open in IMG/M |
| 3300001403|JGI20205J14842_1027103 | Not Available | 593 | Open in IMG/M |
| 3300003351|JGI26346J50198_1000343 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2983 | Open in IMG/M |
| 3300004091|Ga0062387_100296637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1039 | Open in IMG/M |
| 3300004152|Ga0062386_100451157 | All Organisms → cellular organisms → Bacteria | 1040 | Open in IMG/M |
| 3300005327|Ga0070658_10567358 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.23 | 982 | Open in IMG/M |
| 3300005332|Ga0066388_104478259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.23 | 712 | Open in IMG/M |
| 3300005334|Ga0068869_101272561 | Not Available | 648 | Open in IMG/M |
| 3300005336|Ga0070680_100015542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5971 | Open in IMG/M |
| 3300005337|Ga0070682_101222833 | Not Available | 635 | Open in IMG/M |
| 3300005354|Ga0070675_100709645 | Not Available | 916 | Open in IMG/M |
| 3300005436|Ga0070713_100289705 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans suffuscus | 1504 | Open in IMG/M |
| 3300005439|Ga0070711_101395517 | Not Available | 609 | Open in IMG/M |
| 3300005458|Ga0070681_10110272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2691 | Open in IMG/M |
| 3300005458|Ga0070681_11293313 | Not Available | 652 | Open in IMG/M |
| 3300005467|Ga0070706_100010709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia | 8513 | Open in IMG/M |
| 3300005468|Ga0070707_102029900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 542 | Open in IMG/M |
| 3300005471|Ga0070698_100032161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5435 | Open in IMG/M |
| 3300005471|Ga0070698_100210822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1877 | Open in IMG/M |
| 3300005537|Ga0070730_10453700 | Not Available | 825 | Open in IMG/M |
| 3300005537|Ga0070730_10539300 | Not Available | 747 | Open in IMG/M |
| 3300005542|Ga0070732_10980323 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.23 | 517 | Open in IMG/M |
| 3300005546|Ga0070696_100965234 | Not Available | 710 | Open in IMG/M |
| 3300005549|Ga0070704_100951733 | Not Available | 775 | Open in IMG/M |
| 3300005602|Ga0070762_10387788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.23 | 897 | Open in IMG/M |
| 3300005712|Ga0070764_10071920 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.23 | 1807 | Open in IMG/M |
| 3300005843|Ga0068860_101937017 | Not Available | 611 | Open in IMG/M |
| 3300006028|Ga0070717_10155744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1979 | Open in IMG/M |
| 3300006086|Ga0075019_10634292 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 672 | Open in IMG/M |
| 3300006806|Ga0079220_10096978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → unclassified Frankia → Frankia sp. BMG5.23 | 1519 | Open in IMG/M |
| 3300006893|Ga0073928_10645983 | Not Available | 743 | Open in IMG/M |
| 3300006914|Ga0075436_100163404 | Not Available | 1570 | Open in IMG/M |
| 3300009090|Ga0099827_10257861 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300009098|Ga0105245_10005116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 11524 | Open in IMG/M |
| 3300009177|Ga0105248_12162986 | Not Available | 633 | Open in IMG/M |
| 3300009520|Ga0116214_1155934 | Not Available | 851 | Open in IMG/M |
| 3300009525|Ga0116220_10505374 | Not Available | 549 | Open in IMG/M |
| 3300009698|Ga0116216_10055352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2444 | Open in IMG/M |
| 3300009698|Ga0116216_10660664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 629 | Open in IMG/M |
| 3300009700|Ga0116217_10235582 | Not Available | 1192 | Open in IMG/M |
| 3300009824|Ga0116219_10035431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2995 | Open in IMG/M |
| 3300009839|Ga0116223_10268192 | Not Available | 1026 | Open in IMG/M |
| 3300010049|Ga0123356_10529654 | Not Available | 1337 | Open in IMG/M |
| 3300010162|Ga0131853_11309483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
| 3300010358|Ga0126370_10461851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans suffuscus | 1062 | Open in IMG/M |
| 3300010358|Ga0126370_11685513 | Not Available | 610 | Open in IMG/M |
| 3300010366|Ga0126379_10733737 | Not Available | 1083 | Open in IMG/M |
| 3300010373|Ga0134128_11995054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 639 | Open in IMG/M |
| 3300010379|Ga0136449_100741052 | Not Available | 1638 | Open in IMG/M |
| 3300010379|Ga0136449_104054524 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae | 546 | Open in IMG/M |
| 3300010876|Ga0126361_10801491 | Not Available | 594 | Open in IMG/M |
| 3300010877|Ga0126356_10405599 | Not Available | 733 | Open in IMG/M |
| 3300011119|Ga0105246_10130844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces parmotrematis | 1874 | Open in IMG/M |
| 3300012200|Ga0137382_10632196 | Not Available | 765 | Open in IMG/M |
| 3300012362|Ga0137361_11442173 | Not Available | 611 | Open in IMG/M |
| 3300012917|Ga0137395_10545346 | Not Available | 837 | Open in IMG/M |
| 3300012925|Ga0137419_10987130 | Not Available | 697 | Open in IMG/M |
| 3300012927|Ga0137416_11524404 | Not Available | 607 | Open in IMG/M |
| 3300012971|Ga0126369_10170478 | Not Available | 2069 | Open in IMG/M |
| 3300012971|Ga0126369_11587031 | Not Available | 744 | Open in IMG/M |
| 3300013307|Ga0157372_11380399 | Not Available | 812 | Open in IMG/M |
| 3300014165|Ga0181523_10141493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans suffuscus | 1421 | Open in IMG/M |
| 3300014165|Ga0181523_10816027 | Not Available | 508 | Open in IMG/M |
| 3300014201|Ga0181537_10134202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Allocatelliglobosispora → Allocatelliglobosispora scoriae | 1694 | Open in IMG/M |
| 3300014491|Ga0182014_10144507 | Not Available | 1351 | Open in IMG/M |
| 3300014968|Ga0157379_10515352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans suffuscus | 1110 | Open in IMG/M |
| 3300015372|Ga0132256_103398257 | Not Available | 535 | Open in IMG/M |
| 3300016294|Ga0182041_10521348 | Not Available | 1034 | Open in IMG/M |
| 3300016341|Ga0182035_11977300 | Not Available | 529 | Open in IMG/M |
| 3300016371|Ga0182034_10722919 | Not Available | 848 | Open in IMG/M |
| 3300016445|Ga0182038_11143228 | Not Available | 693 | Open in IMG/M |
| 3300016445|Ga0182038_11520118 | Not Available | 601 | Open in IMG/M |
| 3300017924|Ga0187820_1106950 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 809 | Open in IMG/M |
| 3300017937|Ga0187809_10269466 | Not Available | 620 | Open in IMG/M |
| 3300017942|Ga0187808_10014185 | Not Available | 3159 | Open in IMG/M |
| 3300017970|Ga0187783_10051081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Nonomuraea → unclassified Nonomuraea → Nonomuraea sp. PA05 | 3051 | Open in IMG/M |
| 3300018001|Ga0187815_10016666 | Not Available | 3180 | Open in IMG/M |
| 3300018032|Ga0187788_10267707 | Not Available | 683 | Open in IMG/M |
| 3300018060|Ga0187765_10438534 | Not Available | 814 | Open in IMG/M |
| 3300019887|Ga0193729_1028660 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2364 | Open in IMG/M |
| 3300019890|Ga0193728_1033288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2556 | Open in IMG/M |
| 3300019890|Ga0193728_1095628 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1380 | Open in IMG/M |
| 3300020077|Ga0206351_10421307 | Not Available | 656 | Open in IMG/M |
| 3300021168|Ga0210406_10944141 | Not Available | 646 | Open in IMG/M |
| 3300021171|Ga0210405_11155293 | Not Available | 576 | Open in IMG/M |
| 3300021180|Ga0210396_11688356 | Not Available | 515 | Open in IMG/M |
| 3300021377|Ga0213874_10440123 | Not Available | 513 | Open in IMG/M |
| 3300021401|Ga0210393_10625543 | Not Available | 879 | Open in IMG/M |
| 3300021402|Ga0210385_11492329 | Not Available | 516 | Open in IMG/M |
| 3300021403|Ga0210397_10090331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2049 | Open in IMG/M |
| 3300021405|Ga0210387_10090623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2540 | Open in IMG/M |
| 3300021405|Ga0210387_11072521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 703 | Open in IMG/M |
| 3300021420|Ga0210394_10086926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2700 | Open in IMG/M |
| 3300021474|Ga0210390_11308876 | Not Available | 581 | Open in IMG/M |
| 3300021559|Ga0210409_11311860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis → unclassified Amycolatopsis → Amycolatopsis sp. FDAARGOS 1241 | 600 | Open in IMG/M |
| 3300021560|Ga0126371_12663959 | Not Available | 606 | Open in IMG/M |
| 3300022557|Ga0212123_10022909 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6930 | Open in IMG/M |
| 3300022727|Ga0224567_101833 | Not Available | 666 | Open in IMG/M |
| 3300025320|Ga0209171_10024752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4577 | Open in IMG/M |
| 3300025625|Ga0208219_1009690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3153 | Open in IMG/M |
| 3300025633|Ga0208480_1000988 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10489 | Open in IMG/M |
| 3300025634|Ga0208589_1009637 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2980 | Open in IMG/M |
| 3300025917|Ga0207660_10090900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2263 | Open in IMG/M |
| 3300025927|Ga0207687_10151947 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces parmotrematis | 1768 | Open in IMG/M |
| 3300025928|Ga0207700_10063544 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2808 | Open in IMG/M |
| 3300025929|Ga0207664_10073145 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2765 | Open in IMG/M |
| 3300026088|Ga0207641_10248769 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces parmotrematis | 1659 | Open in IMG/M |
| 3300027167|Ga0208096_100407 | All Organisms → cellular organisms → Bacteria | 1679 | Open in IMG/M |
| 3300027604|Ga0208324_1148025 | Not Available | 640 | Open in IMG/M |
| 3300027795|Ga0209139_10159118 | Not Available | 799 | Open in IMG/M |
| 3300027846|Ga0209180_10249335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans suffuscus | 1022 | Open in IMG/M |
| 3300027854|Ga0209517_10539174 | Not Available | 629 | Open in IMG/M |
| 3300027862|Ga0209701_10028178 | All Organisms → cellular organisms → Bacteria | 3656 | Open in IMG/M |
| 3300027882|Ga0209590_10026945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2985 | Open in IMG/M |
| 3300027884|Ga0209275_10068299 | Not Available | 1754 | Open in IMG/M |
| 3300027894|Ga0209068_10324429 | Not Available | 868 | Open in IMG/M |
| 3300028773|Ga0302234_10475093 | Not Available | 534 | Open in IMG/M |
| 3300028800|Ga0265338_10668517 | Not Available | 719 | Open in IMG/M |
| 3300028801|Ga0302226_10213055 | Not Available | 825 | Open in IMG/M |
| 3300028808|Ga0302228_10178363 | Not Available | 972 | Open in IMG/M |
| 3300028906|Ga0308309_10094616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces parmotrematis | 2295 | Open in IMG/M |
| 3300029882|Ga0311368_10638830 | Not Available | 744 | Open in IMG/M |
| 3300029943|Ga0311340_10972946 | Not Available | 699 | Open in IMG/M |
| 3300029951|Ga0311371_10541628 | Not Available | 1519 | Open in IMG/M |
| 3300029999|Ga0311339_10750903 | Not Available | 946 | Open in IMG/M |
| 3300030007|Ga0311338_11299070 | Not Available | 683 | Open in IMG/M |
| 3300030056|Ga0302181_10334118 | Not Available | 665 | Open in IMG/M |
| 3300030399|Ga0311353_10459431 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans suffuscus | 1135 | Open in IMG/M |
| 3300030494|Ga0310037_10000602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 22479 | Open in IMG/M |
| 3300030494|Ga0310037_10016207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3602 | Open in IMG/M |
| 3300030494|Ga0310037_10196809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 895 | Open in IMG/M |
| 3300030520|Ga0311372_10228365 | All Organisms → cellular organisms → Bacteria | 3056 | Open in IMG/M |
| 3300030524|Ga0311357_10053810 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4107 | Open in IMG/M |
| 3300030580|Ga0311355_10014483 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10047 | Open in IMG/M |
| 3300030707|Ga0310038_10020057 | All Organisms → cellular organisms → Bacteria | 4189 | Open in IMG/M |
| 3300030707|Ga0310038_10138103 | Not Available | 1226 | Open in IMG/M |
| 3300030730|Ga0307482_1006036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1987 | Open in IMG/M |
| 3300030739|Ga0302311_10026896 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella aerolata | 5247 | Open in IMG/M |
| 3300031028|Ga0302180_10023334 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3959 | Open in IMG/M |
| 3300031231|Ga0170824_101133760 | Not Available | 523 | Open in IMG/M |
| 3300031234|Ga0302325_10064084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 7174 | Open in IMG/M |
| 3300031234|Ga0302325_10634335 | Not Available | 1561 | Open in IMG/M |
| 3300031525|Ga0302326_12874196 | Not Available | 592 | Open in IMG/M |
| 3300031679|Ga0318561_10511256 | Not Available | 661 | Open in IMG/M |
| 3300031708|Ga0310686_102591638 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Phytohabitans → Phytohabitans suffuscus | 1200 | Open in IMG/M |
| 3300031708|Ga0310686_103010128 | Not Available | 1934 | Open in IMG/M |
| 3300031708|Ga0310686_105839328 | Not Available | 914 | Open in IMG/M |
| 3300031708|Ga0310686_109990300 | Not Available | 600 | Open in IMG/M |
| 3300031708|Ga0310686_115738744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2898 | Open in IMG/M |
| 3300031708|Ga0310686_119551193 | Not Available | 1273 | Open in IMG/M |
| 3300031718|Ga0307474_11075994 | Not Available | 636 | Open in IMG/M |
| 3300031724|Ga0318500_10104985 | Not Available | 1289 | Open in IMG/M |
| 3300031736|Ga0318501_10549955 | All Organisms → cellular organisms → Archaea → Euryarchaeota | 632 | Open in IMG/M |
| 3300031748|Ga0318492_10577407 | Not Available | 599 | Open in IMG/M |
| 3300031768|Ga0318509_10118544 | Not Available | 1441 | Open in IMG/M |
| 3300031770|Ga0318521_11026337 | Not Available | 506 | Open in IMG/M |
| 3300031782|Ga0318552_10328546 | Not Available | 778 | Open in IMG/M |
| 3300031799|Ga0318565_10088782 | Not Available | 1475 | Open in IMG/M |
| 3300031819|Ga0318568_10308952 | Not Available | 982 | Open in IMG/M |
| 3300031823|Ga0307478_10070297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2645 | Open in IMG/M |
| 3300031880|Ga0318544_10074548 | Not Available | 1256 | Open in IMG/M |
| 3300031938|Ga0308175_100055562 | All Organisms → cellular organisms → Bacteria | 3448 | Open in IMG/M |
| 3300031981|Ga0318531_10150579 | Not Available | 1042 | Open in IMG/M |
| 3300032039|Ga0318559_10625759 | Not Available | 502 | Open in IMG/M |
| 3300032041|Ga0318549_10343770 | Not Available | 672 | Open in IMG/M |
| 3300032041|Ga0318549_10357740 | Not Available | 658 | Open in IMG/M |
| 3300032065|Ga0318513_10132784 | Not Available | 1181 | Open in IMG/M |
| 3300032066|Ga0318514_10071158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces → Streptomyces parmotrematis | 1720 | Open in IMG/M |
| 3300032074|Ga0308173_10033178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3613 | Open in IMG/M |
| 3300032090|Ga0318518_10157596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1155 | Open in IMG/M |
| 3300032090|Ga0318518_10224164 | Not Available | 964 | Open in IMG/M |
| 3300032094|Ga0318540_10669113 | Not Available | 500 | Open in IMG/M |
| 3300032160|Ga0311301_10082791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 6547 | Open in IMG/M |
| 3300032160|Ga0311301_10112764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 5198 | Open in IMG/M |
| 3300032160|Ga0311301_10241652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella flavalba | 2997 | Open in IMG/M |
| 3300032160|Ga0311301_10717374 | Not Available | 1400 | Open in IMG/M |
| 3300032261|Ga0306920_104197800 | Not Available | 520 | Open in IMG/M |
| 3300032770|Ga0335085_10292626 | Not Available | 1934 | Open in IMG/M |
| 3300032782|Ga0335082_10087013 | All Organisms → cellular organisms → Bacteria | 3127 | Open in IMG/M |
| 3300032805|Ga0335078_10134708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3516 | Open in IMG/M |
| 3300032892|Ga0335081_10207608 | All Organisms → cellular organisms → Bacteria | 2701 | Open in IMG/M |
| 3300032895|Ga0335074_10335226 | All Organisms → cellular organisms → Bacteria | 1696 | Open in IMG/M |
| 3300032896|Ga0335075_10158888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2799 | Open in IMG/M |
| 3300032896|Ga0335075_10173211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2639 | Open in IMG/M |
| 3300032896|Ga0335075_11641078 | Not Available | 526 | Open in IMG/M |
| 3300032898|Ga0335072_10142999 | Not Available | 2951 | Open in IMG/M |
| 3300032954|Ga0335083_10289173 | Not Available | 1445 | Open in IMG/M |
| 3300032954|Ga0335083_11432537 | Not Available | 527 | Open in IMG/M |
| 3300032954|Ga0335083_11543722 | Not Available | 503 | Open in IMG/M |
| 3300032955|Ga0335076_10069596 | All Organisms → cellular organisms → Bacteria | 3466 | Open in IMG/M |
| 3300032955|Ga0335076_10814740 | Not Available | 815 | Open in IMG/M |
| 3300033134|Ga0335073_10258903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2114 | Open in IMG/M |
| 3300033134|Ga0335073_10945193 | Not Available | 901 | Open in IMG/M |
| 3300033158|Ga0335077_10124955 | All Organisms → cellular organisms → Bacteria | 2984 | Open in IMG/M |
| 3300034090|Ga0326723_0071347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1483 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 15.08% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 11.56% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.05% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 8.54% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.03% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.52% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.52% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.02% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.02% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.51% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.01% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.01% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.01% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.51% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.51% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.51% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.51% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.51% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.51% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.00% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.50% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.50% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001384 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-3 shallow-072012 | Environmental | Open in IMG/M |
| 3300001403 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 | Environmental | Open in IMG/M |
| 3300003351 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006914 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Host-Associated | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022727 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU3 | Environmental | Open in IMG/M |
| 3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025633 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025634 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027167 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF034 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027795 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028801 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029943 | I_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030494 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2) | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030524 | II_Palsa_N3 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030707 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2) | Environmental | Open in IMG/M |
| 3300030730 | Metatranscriptome of hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030739 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031679 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031770 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031799 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21 | Environmental | Open in IMG/M |
| 3300031819 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031981 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25 | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
| 3300032094 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f25 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300034090 | Peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF00N | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12269J14319_100457703 | 3300001356 | Peatlands Soil | LHCLDGQVHHDTHPTPMGNYVIGLGNYVIATPSQLGNYKIADTXTARKPLG* |
| JGI20190J14840_10018713 | 3300001384 | Arctic Peat Soil | LLLLDGQVHHDTHLIPMGNYVIEVGNYLSANPSDLGNYVSADTHPGGTLFG |
| JGI20205J14842_10271031 | 3300001403 | Arctic Peat Soil | LLHLDGQVHHDTHPIPMGNYVIGVGNYVIATPSQVGNYKIADMHAYFASA |
| JGI26346J50198_10003434 | 3300003351 | Bog Forest Soil | LLLLDGQVHPDTLVIPMGNYVIGVGNYVSANPSELGNYMSADTE |
| Ga0062387_1002966371 | 3300004091 | Bog Forest Soil | LLLLDGQVHPDTLVIPMGNYVIGVGNYVSANPSELGNYMSAD |
| Ga0062386_1004511571 | 3300004152 | Bog Forest Soil | RTGGRLLLLDGQVHHDTHVIPMRNYVIAVGNYVIVRPSKLGNYKIADTPSRP* |
| Ga0070658_105673581 | 3300005327 | Corn Rhizosphere | LLLLDGQVHHDTHVLPMGNYVIGVGNYVIATPSELGNYEITDTVSGPD |
| Ga0066388_1044782592 | 3300005332 | Tropical Forest Soil | LLLLDGQVHHDTHPIPMGNYVIEVGNYVIVSPSKLGNYVSADT* |
| Ga0068869_1012725612 | 3300005334 | Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYVSADTIEQE |
| Ga0070680_1000155424 | 3300005336 | Corn Rhizosphere | LLLLDGQVHHDTHVLPMGNYVIGVGNYVIATPSELGNYEITDTP* |
| Ga0070682_1012228331 | 3300005337 | Corn Rhizosphere | LLLLDGQVHPDTHAVPMGNYVIGVRNYVIATPSELGNYKIADT |
| Ga0070675_1007096452 | 3300005354 | Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYVSADTEAGNTGAMVGLGVLLS |
| Ga0070713_1002897052 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYMSAD |
| Ga0070711_1013955171 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYVSADSISAVLL* |
| Ga0070681_101102721 | 3300005458 | Corn Rhizosphere | LLLLDGQVHHDTHVLPMGNYVIGVGNYVIATPSELGNYEITDT |
| Ga0070681_112933132 | 3300005458 | Corn Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYMS |
| Ga0070706_1000107093 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | LLVPEGQVHHDTHPIPTGNYVIEVGNYVSVSPSDLGNYVSADSATV* |
| Ga0070707_1020299001 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSGVGNYVSANPSDLGNYVSADKRSGRRYHVYRA* |
| Ga0070698_1000321618 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSGVGNYVSANPSDLGNYVSAD |
| Ga0070698_1002108221 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | LDGQVHHDTHVIPMGNYVSGVGNYVSANPSDLGNYVSADTRRSSDCRR* |
| Ga0070730_104537002 | 3300005537 | Surface Soil | DGQVHHDTHVIPMGNYVSEVGNYVSASRSNRGIT* |
| Ga0070730_105393003 | 3300005537 | Surface Soil | FLDGQVHHDTHVIPMGNYVSEVGNYVSASRSNRGIT* |
| Ga0070732_109803232 | 3300005542 | Surface Soil | LLLLDGQVHPDTHVIPMGNYVSGVGNYLSVSPSELGNYVSAD |
| Ga0070696_1009652341 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYVSADTP |
| Ga0070704_1009517331 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYMSADMITHID |
| Ga0070762_103877881 | 3300005602 | Soil | LLHLDGQVHHDTHAVPMGNYVIGVGNYVIVSPSELGNY |
| Ga0070764_100719202 | 3300005712 | Soil | LPLLDGQVHHDTHAIPMGNYVIAVGNYVIVSPSELGNYM |
| Ga0068860_1019370171 | 3300005843 | Switchgrass Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNY |
| Ga0070717_101557443 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | LLDGQVHHDTHVIPMGNYVSGVGNYVSANPSDLGNYVSADKRSGRRYHVYRA* |
| Ga0075019_106342921 | 3300006086 | Watersheds | LLLLDGQVHPDTLVIPVGNYVIGVGNYVSANPSELGNYMSAD |
| Ga0079220_100969781 | 3300006806 | Agricultural Soil | LLLLDGQVHHDTHVIPMGNYVIGVGNYLSATPSELGNYMSADILVKR* |
| Ga0073928_106459832 | 3300006893 | Iron-Sulfur Acid Spring | LLHLDGQVHHDTHAVPTGNYVIGVGNYVIATPSEVGNYKIAD |
| Ga0075436_1001634042 | 3300006914 | Populus Rhizosphere | LLLLDGQIHHDTHIFPMGNYVIGVGNYMIATPSELGNYMSADTRRTASPGRHAL |
| Ga0099827_102578611 | 3300009090 | Vadose Zone Soil | HPDTHVIPVGNYVIRVGNYVSANRSTMGNYVSADTVLTLT* |
| Ga0105245_100051161 | 3300009098 | Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYMSADMITHIDEGLDFLG |
| Ga0105248_121629862 | 3300009177 | Switchgrass Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYMSADMITHIDEGLDFLGWRI |
| Ga0116214_11559341 | 3300009520 | Peatlands Soil | LLLLDGQVHHDTHVIPVGNYVIGVGNYVIVTRSNVGNYVSADNWATCL* |
| Ga0116220_105053741 | 3300009525 | Peatlands Soil | LLLLDGQVHHDTHVIPVGNYVIGVGNYVIATPSELGNYMSADKGPSS |
| Ga0116216_100553521 | 3300009698 | Peatlands Soil | LLDGQVHHDTHVIPMGNYVSEVGNYVSASRSNRGIT* |
| Ga0116216_106606642 | 3300009698 | Peatlands Soil | LLLLDGQVHHDTHVIPVGNYVIGVGNYVIVTRSNVGNYVIADT* |
| Ga0116217_102355822 | 3300009700 | Peatlands Soil | LLLLDGQVHHDTHAIPMGNYVIEAGNYVIATPSQLGNCMIADTTSGR |
| Ga0116219_100354316 | 3300009824 | Peatlands Soil | LLLDGQVHHDTHVIPMGNYVSEVGNYVSASRSNRGIT* |
| Ga0116223_102681921 | 3300009839 | Peatlands Soil | LLLLDGQVHHDTHVIPVGNYVIGVGNYVIATPSELGNYMSADT* |
| Ga0123356_105296542 | 3300010049 | Termite Gut | LPLLDGQVHHDTHALPMENYVIGVGKTVIVSPSELGN* |
| Ga0131853_113094832 | 3300010162 | Termite Gut | LRDGQVHHDTHRHPHGNYVIEVGKYLIATPSELGNYKIADIN* |
| Ga0126370_104618512 | 3300010358 | Tropical Forest Soil | LLHLDGQVHHDTHALPMGNYVIEVGNYVIATPSELGNYKIADTRLPR* |
| Ga0126370_116855132 | 3300010358 | Tropical Forest Soil | GGRLLVPDGQVHHDTHPIPMGNYVIAVGNYVSVSASDLGNYVRDVS* |
| Ga0126379_107337372 | 3300010366 | Tropical Forest Soil | LLLLDGQIHHDTHAVPMGNYVIGVGNYVIATPSELGNYMSADTV* |
| Ga0134128_119950542 | 3300010373 | Terrestrial Soil | ERLLLLDGQVHHNTHAVPMGNYVIVVGNYVIATPSELGNYMIADT* |
| Ga0136449_1001991081 | 3300010379 | Peatlands Soil | CLDGQVHHDTHPIPMGNYVIGLGNYVIATPSQLGNYKIADTSCSPRCTRPDENC* |
| Ga0136449_1007410522 | 3300010379 | Peatlands Soil | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSVSPSELGNYVSVDT* |
| Ga0136449_1040545242 | 3300010379 | Peatlands Soil | LLDGQVHHDTHVIPVGNYVIGVGNYVIVTRSNVGNYVSADNWATCL* |
| Ga0126361_108014911 | 3300010876 | Boreal Forest Soil | LLDLDGQVHPDTHPIPMGNYVIEAGNYMIATPSQV |
| Ga0126356_104055992 | 3300010877 | Boreal Forest Soil | LPLLDGQVHHDTHAVPMGNYVIAVGNYLIVSPSGLGNYKIADRPS* |
| Ga0105246_101308441 | 3300011119 | Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYMSADMITHIDEGL |
| Ga0137382_106321962 | 3300012200 | Vadose Zone Soil | LLLLDGQVHHDTHVIPMGNYVIGVGNYVIATPSELGNYKIAD |
| Ga0137361_114421732 | 3300012362 | Vadose Zone Soil | LDGQVHHDTHAIPLGNYVSAVGNYVSVSPSELGNYVSADISQP* |
| Ga0137395_105453462 | 3300012917 | Vadose Zone Soil | LLLLDGQIHHDTHVIPMGNYVIVVGNYVIATPSELGNYMSADIHARSGTHP |
| Ga0137419_109871302 | 3300012925 | Vadose Zone Soil | LLLLDGQVHHDTHIIPMGNYVIGVGNYVIVTSSNVGNYVSAD |
| Ga0137416_115244041 | 3300012927 | Vadose Zone Soil | LLDLDGQVHPDTHALPMGNYVIGVGNYVIATPSQVGNYKIADNTRGSASRLR* |
| Ga0126369_101704782 | 3300012971 | Tropical Forest Soil | LLLLDGQVHHDTHAVPMGNYVIGVGNYVIATPSELGNYMSADT* |
| Ga0126369_115870312 | 3300012971 | Tropical Forest Soil | LLVLDGQVHHDTHAIPRGNYVIEVGNYVIVSPSELGNYMSVDTQQVEPPIAR* |
| Ga0157372_113803992 | 3300013307 | Corn Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYVSADT |
| Ga0181523_101414932 | 3300014165 | Bog | LLLLDGQVHHDTHVLPMGNYVIAVGNYVIVSPSELGNYKIADKRLSTGTALA* |
| Ga0181523_108160272 | 3300014165 | Bog | LLLLDGQVHHDTHAIPLGNYVSEVGNYVNANPSELGNYVSADT* |
| Ga0181537_101342021 | 3300014201 | Bog | VHHDTHAIPRGNYVIAAGNYLIVSPSELGNYKIADN* |
| Ga0182014_101445071 | 3300014491 | Bog | LHLLDGQVHHDTHAVPTGNYVIGAGNYLIATPSEL |
| Ga0157379_105153521 | 3300014968 | Switchgrass Rhizosphere | LLLLDGQVHHDTHVLPMGNYVIGVGNYVIATPSELGN |
| Ga0132256_1033982572 | 3300015372 | Arabidopsis Rhizosphere | LLVLDGQVHHDTHPIPMGNYVIEVGNYVIVNPSELGNYVSADTWAPMSS* |
| Ga0182041_105213482 | 3300016294 | Soil | LLLLDGQVHHDTHAVPMGNYVSEVGNYVIATPSDLGNYMSADTWGTLCEGPGADPED |
| Ga0182035_119773001 | 3300016341 | Soil | LLLLDGQVHHDTHAVPMGNYVIGVGNYVIVNPSELGNYKIADR |
| Ga0182034_107229191 | 3300016371 | Soil | LHLLDGQVHHDTHPIPMGNYVSAVGNYVSVSPSDLGNYVSADT |
| Ga0182038_111432281 | 3300016445 | Soil | LHLLDGQVHHDTHPIPMGNYVSAVGNYVSASPSDL |
| Ga0182038_115201182 | 3300016445 | Soil | LLLLDGQIHHDTHTLPMGNYVIEVGNYVIATPSELGNYKIADTRGSGLL |
| Ga0187820_11069501 | 3300017924 | Freshwater Sediment | LLHLDGQVHHDTHAVPIGNYVIAVGNYVIVSPSELGNYKIVDNSTT |
| Ga0187809_102694662 | 3300017937 | Freshwater Sediment | LLLHDGQVHHDTHAIPVGNYVIGVGNYVIVSPSKLGNYV |
| Ga0187808_100141851 | 3300017942 | Freshwater Sediment | LLHLDGQVHHDTHAVPMGNYVIGVGNYMIATPSEVGNYKIADTLAKAIG |
| Ga0187783_100510815 | 3300017970 | Tropical Peatland | LLDGQVHHDTHPIPMGKYVIGVGNYVIVNPSELGNYVSADTSSGHRTVAL |
| Ga0187815_100166662 | 3300018001 | Freshwater Sediment | LLHLDGQVHHDTHAVPMGNYVIGVGNYMIATPSEVGNYKIADIMSD |
| Ga0187788_102677072 | 3300018032 | Tropical Peatland | LLLLDGQVHHDTHVLPMGNYVSVVGNYVSASRSNRGIT |
| Ga0187765_104385342 | 3300018060 | Tropical Peatland | LLLLDGQVHHDTRAIPMGNYVIAVGNYVSVSPSDLG |
| Ga0193729_10286604 | 3300019887 | Soil | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYVSADTFL |
| Ga0193728_10332881 | 3300019890 | Soil | LLLLDGQVHHDTHPIPMGNYVIEVGNYLSANPSDLGNYVSADTYA |
| Ga0193728_10956283 | 3300019890 | Soil | HLLDGQVHHDTHAVPMGNYVIGAGNYVIATPSELGNYLSADRWPPAAGRMQ |
| Ga0206351_104213072 | 3300020077 | Corn, Switchgrass And Miscanthus Rhizosphere | PRREERLLLLDGQVHHDTHVLPMGNYVIGVGNYVIATPSELGNYEITDTCT |
| Ga0210406_109441411 | 3300021168 | Soil | LLLLDGQVHHDTHAIPMGNYVIEAGNYVIATPSQLGNCMI |
| Ga0210405_111552932 | 3300021171 | Soil | LLHLDGQVHHDTHAVPMGNYVIEVGNYVIATPSELGNYKIADT |
| Ga0210396_116883561 | 3300021180 | Soil | LLDLDGQVHPDTHPIPMGNYVIGVRNYMIATPSQVGNYLIAD |
| Ga0213874_104401231 | 3300021377 | Plant Roots | LLLDGQVHHDTHVIPMGNYVSEVGNYVSASRSNRGIT |
| Ga0210393_106255431 | 3300021401 | Soil | LLHLDGQVHHDTHAVPMGNYVIGVGNYVIVSPSQLGNYKIADNRNSLD |
| Ga0210385_114923292 | 3300021402 | Soil | LLHLDGQVHPDTHAIPMGNYVIGVGNYMIATPSEVGNYKIADT |
| Ga0210397_100903311 | 3300021403 | Soil | LLLLDGQVHHDTHLIPMGNYVIVVGNYVIATPSELGNYMSADTR |
| Ga0210387_100906233 | 3300021405 | Soil | LLLLDGQVHHDTHLIPMGNYVIVVGNYVIATPSELGNYMSADIREGPRS |
| Ga0210387_110725211 | 3300021405 | Soil | LLLDGQVHHDTHLIPMGNYVIVVGNYVIATPSELGNYMSADRNRETTL |
| Ga0210394_100869261 | 3300021420 | Soil | LLHLDGQVHHDTHVIPMGNYVIGVGNYVIATPSELGNYMSADTRSART |
| Ga0210390_113088762 | 3300021474 | Soil | LLLLDGQVHHNTHLIPMGNYVIVVGNYVIATPSELGNYMSADNRR |
| Ga0210409_113118601 | 3300021559 | Soil | LLLDGQVHHDTHAIPMGNYVIEAGNYVIATPSQLGNCMIADTD |
| Ga0126371_126639591 | 3300021560 | Tropical Forest Soil | LLLLDGQVHHDTHAIPMGNYVIEVGNYVIVSPSELGN |
| Ga0212123_100229091 | 3300022557 | Iron-Sulfur Acid Spring | LHLLDGQVHHDTHAVPTGNYVIGAGNYLIATPSELGNYMLADRAPPSCLRNCMRPGP |
| Ga0224567_1018332 | 3300022727 | Plant Litter | LLLLDGQVHHDTHAIPMGNYVIGVGNYVIATPSKLGNYMSADSV |
| Ga0209171_100247521 | 3300025320 | Iron-Sulfur Acid Spring | LHLLDGQVHHDTHAVPTGNYVIGAGNYLIATPSELGNYMLADRILEFVSI |
| Ga0208219_10096904 | 3300025625 | Arctic Peat Soil | LLHLDGQVHHDTHPIPMGNYVIGVGNYVIATPSQVGNYKIADMHAYFASAK |
| Ga0208480_100098810 | 3300025633 | Arctic Peat Soil | LLLLDGQVHHDTHLIPMGNYVIEVGNYLSANPSDLGNYVSADKGL |
| Ga0208589_10096371 | 3300025634 | Arctic Peat Soil | LLLLDGQVHHDTHLIPMGNYVIEVGNYLSANPSDLGNYVSADT |
| Ga0207660_100909003 | 3300025917 | Corn Rhizosphere | LLLLDGQVHHDTHVLPMGNYVIGVGNYVIATPSELGNYEITD |
| Ga0207687_101519472 | 3300025927 | Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYVSA |
| Ga0207700_100635441 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYVSADSTA |
| Ga0207664_100731453 | 3300025929 | Agricultural Soil | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYMSADTRDWCSPVTD |
| Ga0207711_114605952 | 3300025941 | Switchgrass Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYVSADNRATVAADEYAIRT |
| Ga0207641_102487691 | 3300026088 | Switchgrass Rhizosphere | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSARPSDLGNYVSADNRLPGGL |
| Ga0208096_1004071 | 3300027167 | Forest Soil | LLLLDGQVHPDTHVIPKGNYVSGVGNYLSVSPSELGN |
| Ga0208324_11480252 | 3300027604 | Peatlands Soil | LLLLDGQVHHDTHVIPVGNYVIGVGNYVIVTRSNVGNYVIADT |
| Ga0209139_101591182 | 3300027795 | Bog Forest Soil | LHLLDGQVHHDTHAVPMGNYVIAVGNYVIVSPSELGNYKIVDSL |
| Ga0209180_102493352 | 3300027846 | Vadose Zone Soil | LLLLDGQVHHDTHVIPMGNYVIGVGNYVIVSPSDLGNYVSAD |
| Ga0209517_105391742 | 3300027854 | Peatlands Soil | LLLLDGQVHHDTHVIPVGNYVIGVGNYVIATPSELGNYMSADIRKGA |
| Ga0209701_100281786 | 3300027862 | Vadose Zone Soil | LLLLDGQVHHDTHVIPMGNYVIGVGNYVIVSPSDLGNYVSADSQGYGLAAVI |
| Ga0209590_100269454 | 3300027882 | Vadose Zone Soil | LLLRDGQVHPDTHVIPVGNYVIRVGNYVSANRSTMGNYVSADSGY |
| Ga0209275_100682992 | 3300027884 | Soil | LLHLDGQVHHDTHAVPMGNYVIGVGNYVIVSPSELGNYMIADTCIAVIFLSP |
| Ga0209068_103244291 | 3300027894 | Watersheds | GRLLLLDGQVHHDTHVIPMGNYVSAVGNYVSASRSNRGIT |
| Ga0302234_104750931 | 3300028773 | Palsa | LLHLDGQVHHDTHAVPMGNYVIGVGNYVIATPSEVGNYK |
| Ga0265338_106685172 | 3300028800 | Rhizosphere | LLLLDGQVHHDTHALPMGNYVIEVGNYVIVSPSELGNCMIADTHSAPADWG |
| Ga0302226_102130552 | 3300028801 | Palsa | LLLLDGQVHHDTHVIPMGNYVIEAGNYVIATPSELGNYLIADIP |
| Ga0302228_101783631 | 3300028808 | Palsa | LLLLDGQVHHDTHVIPMGNYVIEAGNYVIATPSELGNYLIADT |
| Ga0308309_100946164 | 3300028906 | Soil | LLLLDGQVHHDTHVIPMGNYVIEVGNYVIATPSELGNYLIADRLPGIEVS |
| Ga0311368_106388302 | 3300029882 | Palsa | LLHLDGQVHHDTHAIPMGNYVIAVRNYVIVSPSELGNYMIADTGQG |
| Ga0311340_109729461 | 3300029943 | Palsa | LLHLDGQVHHDTHAIPMGNYVIAVRNYVIVSPSELGNYMIADTGQ |
| Ga0311371_105416282 | 3300029951 | Palsa | LLHLDGQVHHDTHAIPMGNYVIAVRNYVIVSPSELGNYMIADSCATSPSG |
| Ga0311339_107509032 | 3300029999 | Palsa | LLLLDGQVHHDTHAAPMGNYVIGVGNYVIANPSKLGNYLSADRAGDDP |
| Ga0311338_112990701 | 3300030007 | Palsa | LHLLDGQVHHDTHAVPMGNYVIGVGNYLIAIPSELGN |
| Ga0302181_103341182 | 3300030056 | Palsa | LLLLDGQVHHDTHAAPMGNYVIGVGNYVIANPSKLGNYLSADSRV |
| Ga0311353_104594312 | 3300030399 | Palsa | LLLLDGQVHHDTHVIPMGNYVIEAGNYVIATPSELGNYLIADIN |
| Ga0310037_100006021 | 3300030494 | Peatlands Soil | LLLLDGQVHHDTHVIPMGNYVSEVGNYVSASRSNRGIT |
| Ga0310037_100162071 | 3300030494 | Peatlands Soil | LLLLDGQVHHDTHVIPVGNYVIGVGNYVIVTRSNVGNYVSADTQGHCRECP |
| Ga0310037_101968091 | 3300030494 | Peatlands Soil | GRLLLLDGQVHHDTHVIPVGNYVIGVGNYVIVTRSNVGNYVIADT |
| Ga0311372_102283655 | 3300030520 | Palsa | LLHLDGQVHHDTHAIPMGNYVIAVRNYVIVSPSELGNYMIADSCAT |
| Ga0311357_100538101 | 3300030524 | Palsa | LHLLDGQVHHDTHAVPTGNYVIGAGNYLITIPSELGNYMLA |
| Ga0311355_100144838 | 3300030580 | Palsa | QVHHDTHAIPIGNYVIGVGNYLIVSPSELGNYKIADTQICSC |
| Ga0310038_100200574 | 3300030707 | Peatlands Soil | LLLLDGQVHHDTHVIPVGNYVIGVGNYVIVTRSNVGNYVSADNWA |
| Ga0310038_101381032 | 3300030707 | Peatlands Soil | LLLLDGQVHHDTHAIPMGNYVIEAGNYVIATPSQLGNCMIADTTSG |
| Ga0307482_10060363 | 3300030730 | Hardwood Forest Soil | LPLLDGQVHHDTHAIPMGNYVIGVGNYVIVSPSELGNYKIVDSLCPR |
| Ga0302311_100268966 | 3300030739 | Palsa | LHLLDGQVHHDTHAVPTGNYVIGAGNYLITIPSELG |
| Ga0302180_100233347 | 3300031028 | Palsa | VHHDTHAIPIGNYVIGVGNYLIVSPSELGNYKIADTQICSC |
| Ga0170824_1011337601 | 3300031231 | Forest Soil | LPLLDGQVHHDTHAIPMGNYVIAVGNYVIVTCSKVGNYVSADT |
| Ga0302325_100640841 | 3300031234 | Palsa | LLLLDGQVHHDTHVIPMGNYVIEAGNYVIATPSELGNYLIADTL |
| Ga0302325_106343352 | 3300031234 | Palsa | LLHLDGQVHHDTHAIPMGNYVIAVRNYVIVSPSELGNYMIADTASPGRQP |
| Ga0302326_128741961 | 3300031525 | Palsa | LLLLDGQVHHDTHAAPMGNYVIGVGNYVIANPSKLG |
| Ga0318561_105112561 | 3300031679 | Soil | LHLLDGQVHHDTHPIPMGNYVSAVGNYVSVNPSDLGNYVGADKKRPRKP |
| Ga0310686_1025916382 | 3300031708 | Soil | LLLLDGQVHHDTHVIPMGNYVIMVGNYVIATPSELGNYMSAD |
| Ga0310686_1030101281 | 3300031708 | Soil | LLLLDGQVHPDTHVIPKGNYVSGVGNYLSVSPSELGNYVSADTMVF |
| Ga0310686_1058393282 | 3300031708 | Soil | LLLLDGQVHHDTHAIPMGNYVIGVGNYVIATPSKLGNYMSAD |
| Ga0310686_1099903002 | 3300031708 | Soil | LPLLDGQVHHGTHVIPVGHYVIPVGHYVIGVGNYVIATPSELE |
| Ga0310686_1157387444 | 3300031708 | Soil | LLLLDGQVHHDTHAIPMGNYVIGVGNYVIATPSKLGNYMSADKQPGEPGTH |
| Ga0310686_1195511932 | 3300031708 | Soil | LLLLDGQVHHDTHVIPMGNYVIEVGKYLIVSPSKPGNYVIVHT |
| Ga0307474_110759942 | 3300031718 | Hardwood Forest Soil | LLLLDGQVHHDTHAIPMGNYVIEVGNYVIATPSEQGNYKIADSRE |
| Ga0318500_101049851 | 3300031724 | Soil | LLLLDGQVHHDTHAVPMGNYVSEVGNYVIATPSDLGNYMSADTT |
| Ga0318501_105499553 | 3300031736 | Soil | ERLLLLDGQVHHDTHVIPMGNYVSEVGNYVSASRSNRGIT |
| Ga0318492_105774072 | 3300031748 | Soil | LLLLDGQVHHDTHAIPMGNYVSGVGNYVSVSPSELGNY |
| Ga0318509_101185441 | 3300031768 | Soil | LLLLDGQVHHDTHAVPMGNYVSEVGNYVIATPSDLGNYMS |
| Ga0318521_110263371 | 3300031770 | Soil | LLLLDGQIHHDTHTLPMGNYVIEVGNYVIATPSELGNYKIADTDHL |
| Ga0318552_103285461 | 3300031782 | Soil | LLHLDGQVHHDTHVLPMENYVIEVGKTVIVSPSELGN |
| Ga0318565_100887822 | 3300031799 | Soil | LLLLDGQVHHDTHAVPMGNYVSEVGNYVIATPSDLGNYM |
| Ga0318568_103089521 | 3300031819 | Soil | LHLLDGQVHHDTHPIPMGNYVSAVGNYVSASPSDLGNYVSAD |
| Ga0307478_100702973 | 3300031823 | Hardwood Forest Soil | LPLLDGQVHHDTHAIPMGNYVIAAGNYVIVSPSELGNYMSADTWP |
| Ga0318544_100745481 | 3300031880 | Soil | LLLLDGQVHHDTHAIPMGNYVIGVGNYVIATPSELGNYMSADT |
| Ga0308175_1000555624 | 3300031938 | Soil | LLHLDGQVHHDTHVVPMGNYVIGVGNYVIATPSELGNYKIADS |
| Ga0318531_101505792 | 3300031981 | Soil | LHLLDGQVHHDTHPIPMGNYVSAVGNYVSASPSDLG |
| Ga0318559_106257591 | 3300032039 | Soil | LHLLDGQVHHDTHPIPMGNYVSAVGNYVSVNPSDLGNYVGADTWA |
| Ga0318549_103437701 | 3300032041 | Soil | LLLLDGQVHHDTHAVPMGNYVSEVGNYVIATPSDLGNY |
| Ga0318549_103577401 | 3300032041 | Soil | LLHLDGQVHHDTHAVPMGNYVIGVGNYVIATPSEVGNYKIADT |
| Ga0318513_101327842 | 3300032065 | Soil | LLLLDGQVHHDTHAVPMGNYVSEVGNYVIATPSDLGNYMSADR |
| Ga0318514_100711582 | 3300032066 | Soil | LLLLDGQVHHDTHAVPMGNYVSEVGNYVIATPSDLGNYMSADRQIRALPPVM |
| Ga0308173_100331784 | 3300032074 | Soil | LLHLDGQVHHDTHVVPMGNYVIGVGNYVIATPSELGNYKIADSHGHPSSRTQWPLSY |
| Ga0318518_101575961 | 3300032090 | Soil | HLLDGQVHHDTHPIPMGNYVSAVGNYVSASPSDLGNYVSADTRVAAAASS |
| Ga0318518_102241642 | 3300032090 | Soil | LHLLDGQVHHDTHPIPMGNYVSAVGNYVSASPSDLGNYVSADSHVTRSS |
| Ga0318540_106691132 | 3300032094 | Soil | LHLLDGQVHHDTHPIPMGNYVSAVGNYVSASPSDLGNYV |
| Ga0311301_100827911 | 3300032160 | Peatlands Soil | RLLLLDGQVHHDTHVIPMGNYVSEVGNYVSASRSTWGIT |
| Ga0311301_101127642 | 3300032160 | Peatlands Soil | LLLLDGQVHHDTHVIPVGNYVIGVGNYVIVTRSNVGNYVSADT |
| Ga0311301_102416521 | 3300032160 | Peatlands Soil | LLLLDGQVHHDTHAIPMGNYVIEAGNYVIATPSQLGNCMIADICHHRPLMR |
| Ga0311301_102453931 | 3300032160 | Peatlands Soil | HCLDGQVHHDTHPIPMGNYVIGLGNYVIATPSQLGNYKIADTSCSPRCTRPDENC |
| Ga0311301_107173742 | 3300032160 | Peatlands Soil | LLLLDGQVHHDTHVIPMGNYVSEVGNYLSVSPSELGNYVSVDT |
| Ga0306920_1041978001 | 3300032261 | Soil | LLLLDGQVHPDTHAIPMGNYVIRVGNYVSASPSELGN |
| Ga0335085_102926261 | 3300032770 | Soil | LLHLDGQVHHDTHAIPMGNYVIGVGNYVIVSPSEL |
| Ga0335082_100870131 | 3300032782 | Soil | LLLLDGQVHHDTHVIPMGNYVIGVGNYLSATPSELGNYVSADS |
| Ga0335078_101347081 | 3300032805 | Soil | LLLLDGQVHHDTHVIPMGNYVIGVGNYLSATPSELGNYVSADIV |
| Ga0335081_102076084 | 3300032892 | Soil | LLLLDGQVHHDTHVIPMGNYVIGVGNYLSATPSELGNYVSADSY |
| Ga0335074_103352262 | 3300032895 | Soil | LLHLDGQVHHDTHALPMGNYVIGVGNYVIATPSELGNYKIADRTFCA |
| Ga0335075_101588883 | 3300032896 | Soil | LPELDGQVHHDTHLIPMGNYAIEVGKSVIRSPSRMGNYKIADTCLKRTGQSR |
| Ga0335075_101732111 | 3300032896 | Soil | LPLPDGQVHHDTHVVPMGNYVIAVGNYVIVTCLPVGNYVSADTRAGSVCLWLV |
| Ga0335075_116410782 | 3300032896 | Soil | LHLDGQVHHDTHALPMGNYVIEVGNYVIVSPSKLGNYKIADRQSPSAPAWN |
| Ga0335072_101429991 | 3300032898 | Soil | LLHLDGQVHHDTHALPMGNYVIGVGNYVIATPSELGNYKIAD |
| Ga0335083_102891731 | 3300032954 | Soil | LLLLDGQVHHDTHAVPMGNYVIEVGNYVIATPSEL |
| Ga0335083_114325371 | 3300032954 | Soil | LHLDGQVHHDTHAIPMGNYVIGVGNYVIVSPSELGNYKIADTCQSNAHWR |
| Ga0335083_115437222 | 3300032954 | Soil | LLHLDGQVHHDTHAIPMGNYVIGVGNYVIVSPSELGNYKIADTSCP |
| Ga0335076_100695961 | 3300032955 | Soil | LLLLDGQVHHDTHVIPMGNYVIGVGNYLSATPSELGNYVSADTRLRAQSNG |
| Ga0335076_108147402 | 3300032955 | Soil | LLLLDGQIHHDTHALPMRNYVIGVGNYVIVSPSELGNYVIA |
| Ga0335073_102589033 | 3300033134 | Soil | LLLLDGQVHHDTHPIPMGNYVIEVRNYVIVSPSQLGNYKIADTQVRLSRSR |
| Ga0335073_109451931 | 3300033134 | Soil | LPLSDGQVHHDTHVVPMGNYVIAVGNYVIVTCLPVGNYVSADSG |
| Ga0335077_101249551 | 3300033158 | Soil | LLLLDGQVHHDTHVIPMGNYVIGVGNYLSATPSELGNYVSAD |
| Ga0326723_0071347_27_143 | 3300034090 | Peat Soil | MPSPEIWVHHDTHVIPIGNYVSEVGNYVSASRSTWGIT |
| ⦗Top⦘ |