NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F026159

Metagenome Family F026159

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F026159
Family Type Metagenome
Number of Sequences 199
Average Sequence Length 140 residues
Representative Sequence MKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Number of Associated Samples 122
Number of Associated Scaffolds 199

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 73.87 %
% of genes near scaffold ends (potentially truncated) 42.21 %
% of genes from short scaffolds (< 2000 bps) 73.37 %
Associated GOLD sequencing projects 107
AlphaFold2 3D model prediction Yes
3D model pTM-score0.46

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.447 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Strait → Unclassified → Seawater
(39.698 % of family members)
Environment Ontology (ENVO) Unclassified
(91.457 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.965 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 56.07%    β-sheet: 0.00%    Coil/Unstructured: 43.93%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.46
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 199 Family Scaffolds
PF00254FKBP_C 16.08
PF13203DUF2201_N 4.52
PF07728AAA_5 3.02
PF13578Methyltransf_24 2.01
PF07432Hc1 1.01
PF02086MethyltransfD12 1.01
PF05708Peptidase_C92 0.50
PF05050Methyltransf_21 0.50
PF08298AAA_PrkA 0.50
PF13365Trypsin_2 0.50

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 199 Family Scaffolds
COG0338DNA-adenine methylaseReplication, recombination and repair [L] 1.01
COG3392Adenine-specific DNA methylaseReplication, recombination and repair [L] 1.01
COG2766Predicted Ser/Thr protein kinaseSignal transduction mechanisms [T] 0.50


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms97.99 %
UnclassifiedrootN/A2.01 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000101|DelMOSum2010_c10004652All Organisms → cellular organisms → Bacteria → Proteobacteria9816Open in IMG/M
3300000115|DelMOSum2011_c10096800All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium978Open in IMG/M
3300001450|JGI24006J15134_10001976All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium11545Open in IMG/M
3300001450|JGI24006J15134_10012766All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium4059Open in IMG/M
3300001450|JGI24006J15134_10038154All Organisms → Viruses → Predicted Viral2053Open in IMG/M
3300001460|JGI24003J15210_10133557All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium659Open in IMG/M
3300001472|JGI24004J15324_10116980All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium659Open in IMG/M
3300001952|GOS2224_1021005All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1502Open in IMG/M
3300001974|GOS2246_10124128All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1710Open in IMG/M
3300002482|JGI25127J35165_1057074All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium834Open in IMG/M
3300002488|JGI25128J35275_1019920All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1664Open in IMG/M
3300002514|JGI25133J35611_10007643All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium4949Open in IMG/M
3300002514|JGI25133J35611_10011361All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3856Open in IMG/M
3300005430|Ga0066849_10205922All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium765Open in IMG/M
3300005514|Ga0066866_10187226All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium729Open in IMG/M
3300005514|Ga0066866_10321177All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium526Open in IMG/M
3300005521|Ga0066862_10018151All Organisms → Viruses → Predicted Viral2620Open in IMG/M
3300005521|Ga0066862_10035582All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1795Open in IMG/M
3300006735|Ga0098038_1001782All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium9293Open in IMG/M
3300006754|Ga0098044_1048155All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1823Open in IMG/M
3300006754|Ga0098044_1073783All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1421Open in IMG/M
3300006754|Ga0098044_1214419All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium754Open in IMG/M
3300006789|Ga0098054_1002451All Organisms → cellular organisms → Bacteria → Proteobacteria8751Open in IMG/M
3300006789|Ga0098054_1019135All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2737Open in IMG/M
3300006793|Ga0098055_1075162All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1334Open in IMG/M
3300006793|Ga0098055_1188629All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium785Open in IMG/M
3300006919|Ga0070746_10270205All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium789Open in IMG/M
3300006921|Ga0098060_1041894All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1371Open in IMG/M
3300006928|Ga0098041_1311161All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium500Open in IMG/M
3300007231|Ga0075469_10045593All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1339Open in IMG/M
3300007276|Ga0070747_1128072All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium922Open in IMG/M
3300007276|Ga0070747_1241491All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium629Open in IMG/M
3300008050|Ga0098052_1002720All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium10654Open in IMG/M
3300009071|Ga0115566_10007512All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium8443Open in IMG/M
3300009071|Ga0115566_10293302All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium961Open in IMG/M
3300009071|Ga0115566_10358090All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium849Open in IMG/M
3300009071|Ga0115566_10615105All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium607Open in IMG/M
3300009077|Ga0115552_1216152All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium782Open in IMG/M
3300009108|Ga0117920_1002160All Organisms → cellular organisms → Bacteria → Proteobacteria15719Open in IMG/M
3300009435|Ga0115546_1056882All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1491Open in IMG/M
3300009507|Ga0115572_10432702All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium734Open in IMG/M
3300009593|Ga0115011_10041522All Organisms → Viruses → Predicted Viral3126Open in IMG/M
3300009593|Ga0115011_10823875All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium770Open in IMG/M
3300009593|Ga0115011_11005604All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium706Open in IMG/M
3300009593|Ga0115011_11297373All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium633Open in IMG/M
3300010150|Ga0098056_1009785All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3529Open in IMG/M
3300010150|Ga0098056_1051422All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1426Open in IMG/M
3300010151|Ga0098061_1351576All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium500Open in IMG/M
3300010153|Ga0098059_1025685All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2400Open in IMG/M
3300010368|Ga0129324_10236444All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium732Open in IMG/M
3300011252|Ga0151674_1074922All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium581Open in IMG/M
3300011254|Ga0151675_1082961All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium538Open in IMG/M
3300012928|Ga0163110_10492480All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium933Open in IMG/M
3300012952|Ga0163180_11335179All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium592Open in IMG/M
3300012953|Ga0163179_10013030All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5439Open in IMG/M
3300012953|Ga0163179_11081127All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium703Open in IMG/M
3300013010|Ga0129327_10239097All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium925Open in IMG/M
3300014959|Ga0134299_1060741All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium534Open in IMG/M
3300017697|Ga0180120_10035662All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2280Open in IMG/M
3300017697|Ga0180120_10038795All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2174Open in IMG/M
3300017697|Ga0180120_10441785All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium508Open in IMG/M
3300017708|Ga0181369_1090046All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium645Open in IMG/M
3300017709|Ga0181387_1042451All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium900Open in IMG/M
3300017710|Ga0181403_1018189All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1497Open in IMG/M
3300017710|Ga0181403_1042349All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium955Open in IMG/M
3300017714|Ga0181412_1021309All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1813Open in IMG/M
3300017714|Ga0181412_1127053All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium584Open in IMG/M
3300017717|Ga0181404_1013803All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2111Open in IMG/M
3300017717|Ga0181404_1104360All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium694Open in IMG/M
3300017720|Ga0181383_1065146All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium978Open in IMG/M
3300017720|Ga0181383_1195325All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium538Open in IMG/M
3300017724|Ga0181388_1071176All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium832Open in IMG/M
3300017727|Ga0181401_1107579All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium705Open in IMG/M
3300017728|Ga0181419_1046895All Organisms → Viruses → Predicted Viral1137Open in IMG/M
3300017728|Ga0181419_1050545All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1085Open in IMG/M
3300017730|Ga0181417_1009903All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2464Open in IMG/M
3300017730|Ga0181417_1019569All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1700Open in IMG/M
3300017731|Ga0181416_1010659All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2184Open in IMG/M
3300017731|Ga0181416_1045006All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1039Open in IMG/M
3300017731|Ga0181416_1176384All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium517Open in IMG/M
3300017732|Ga0181415_1145597All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium530Open in IMG/M
3300017735|Ga0181431_1014338All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1871Open in IMG/M
3300017735|Ga0181431_1126736All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium569Open in IMG/M
3300017737|Ga0187218_1015837All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1994Open in IMG/M
3300017738|Ga0181428_1003309All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3702Open in IMG/M
3300017738|Ga0181428_1090002All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium716Open in IMG/M
3300017738|Ga0181428_1115219All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium630Open in IMG/M
3300017739|Ga0181433_1077749All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium820Open in IMG/M
3300017740|Ga0181418_1102028All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium695Open in IMG/M
3300017742|Ga0181399_1114137All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium663Open in IMG/M
3300017743|Ga0181402_1079220All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium861Open in IMG/M
3300017743|Ga0181402_1119418All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium675Open in IMG/M
3300017744|Ga0181397_1039997All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1322Open in IMG/M
3300017744|Ga0181397_1082305All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium858Open in IMG/M
3300017744|Ga0181397_1107182All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium731Open in IMG/M
3300017745|Ga0181427_1040522All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1157Open in IMG/M
3300017750|Ga0181405_1009003All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2872Open in IMG/M
3300017750|Ga0181405_1013507All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2317Open in IMG/M
3300017750|Ga0181405_1144144All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium590Open in IMG/M
3300017752|Ga0181400_1028840All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1793Open in IMG/M
3300017753|Ga0181407_1012138All Organisms → Viruses → Predicted Viral2442Open in IMG/M
3300017753|Ga0181407_1058614All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium999Open in IMG/M
3300017753|Ga0181407_1061155All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium975Open in IMG/M
3300017753|Ga0181407_1168768All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium536Open in IMG/M
3300017755|Ga0181411_1104701All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium834Open in IMG/M
3300017757|Ga0181420_1218056All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium549Open in IMG/M
3300017758|Ga0181409_1079293All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium990Open in IMG/M
3300017758|Ga0181409_1113617All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium802Open in IMG/M
3300017758|Ga0181409_1189025All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium596Open in IMG/M
3300017759|Ga0181414_1093228All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium794Open in IMG/M
3300017759|Ga0181414_1173833All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium561Open in IMG/M
3300017760|Ga0181408_1032455All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1425Open in IMG/M
3300017760|Ga0181408_1072955All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium903Open in IMG/M
3300017763|Ga0181410_1028895All Organisms → Viruses → Predicted Viral1785Open in IMG/M
3300017763|Ga0181410_1091959All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium885Open in IMG/M
3300017764|Ga0181385_1009612All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3138Open in IMG/M
3300017764|Ga0181385_1022374All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2017Open in IMG/M
3300017764|Ga0181385_1044923All Organisms → Viruses → Predicted Viral1380Open in IMG/M
3300017764|Ga0181385_1078425All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1017Open in IMG/M
3300017764|Ga0181385_1086778All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium961Open in IMG/M
3300017765|Ga0181413_1007746All Organisms → Viruses → Predicted Viral3341Open in IMG/M
3300017765|Ga0181413_1198719All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium599Open in IMG/M
3300017768|Ga0187220_1007879Not Available3229Open in IMG/M
3300017768|Ga0187220_1020797All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1973Open in IMG/M
3300017768|Ga0187220_1167473All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium663Open in IMG/M
3300017768|Ga0187220_1251528All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium528Open in IMG/M
3300017770|Ga0187217_1288946All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium529Open in IMG/M
3300017772|Ga0181430_1155518All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium663Open in IMG/M
3300017772|Ga0181430_1197021All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium576Open in IMG/M
3300017773|Ga0181386_1042502All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1475Open in IMG/M
3300017773|Ga0181386_1050129All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1343Open in IMG/M
3300017773|Ga0181386_1082959All Organisms → Viruses → Predicted Viral1008Open in IMG/M
3300017773|Ga0181386_1091454All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium953Open in IMG/M
3300017773|Ga0181386_1245863All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium529Open in IMG/M
3300017775|Ga0181432_1010110All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2286Open in IMG/M
3300017776|Ga0181394_1053805All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1348Open in IMG/M
3300017779|Ga0181395_1053855All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1323Open in IMG/M
3300017779|Ga0181395_1270121All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium517Open in IMG/M
3300017781|Ga0181423_1016773Not Available3022Open in IMG/M
3300017781|Ga0181423_1171774All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium829Open in IMG/M
3300017781|Ga0181423_1247892All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium666Open in IMG/M
3300020165|Ga0206125_10000134All Organisms → cellular organisms → Bacteria97993Open in IMG/M
3300020165|Ga0206125_10014018All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium5288Open in IMG/M
3300020165|Ga0206125_10046591All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2149Open in IMG/M
3300020165|Ga0206125_10049536All Organisms → Viruses → Predicted Viral2052Open in IMG/M
3300020175|Ga0206124_10051752All Organisms → Viruses → Predicted Viral1804Open in IMG/M
3300020175|Ga0206124_10237263All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium710Open in IMG/M
3300020404|Ga0211659_10024607All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2937Open in IMG/M
3300020428|Ga0211521_10015050All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium4628Open in IMG/M
3300020428|Ga0211521_10020667All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3794Open in IMG/M
3300020438|Ga0211576_10006133All Organisms → cellular organisms → Bacteria → Proteobacteria7993Open in IMG/M
3300020438|Ga0211576_10319051All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium805Open in IMG/M
3300020438|Ga0211576_10560239All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium572Open in IMG/M
3300020595|Ga0206126_10079224All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1673Open in IMG/M
3300021365|Ga0206123_10031273All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2973Open in IMG/M
3300021365|Ga0206123_10307002All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium674Open in IMG/M
3300021958|Ga0222718_10083460All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1921Open in IMG/M
3300022164|Ga0212022_1010919All Organisms → Viruses → Predicted Viral1275Open in IMG/M
3300022178|Ga0196887_1010584All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2978Open in IMG/M
(restricted) 3300024255|Ga0233438_10143119All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1035Open in IMG/M
3300025066|Ga0208012_1004000All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium3152Open in IMG/M
3300025120|Ga0209535_1000545All Organisms → cellular organisms → Bacteria27010Open in IMG/M
3300025120|Ga0209535_1013633All Organisms → cellular organisms → Bacteria4407Open in IMG/M
3300025127|Ga0209348_1043948All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1538Open in IMG/M
3300025127|Ga0209348_1063200All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1216Open in IMG/M
3300025128|Ga0208919_1036200All Organisms → Viruses → Predicted Viral1759Open in IMG/M
3300025131|Ga0209128_1045378All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1649Open in IMG/M
3300025133|Ga0208299_1195817All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium603Open in IMG/M
3300025133|Ga0208299_1198485All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium597Open in IMG/M
3300025137|Ga0209336_10002792All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium8188Open in IMG/M
3300025141|Ga0209756_1104001All Organisms → Viruses → Predicted Viral1219Open in IMG/M
3300025168|Ga0209337_1005173All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium8917Open in IMG/M
3300025168|Ga0209337_1070752All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1726Open in IMG/M
3300025168|Ga0209337_1182084All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium874Open in IMG/M
3300025508|Ga0208148_1052209All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1005Open in IMG/M
3300025652|Ga0208134_1058808All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1185Open in IMG/M
3300025696|Ga0209532_1166735All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium662Open in IMG/M
3300025816|Ga0209193_1047183All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1211Open in IMG/M
3300025849|Ga0209603_1292960All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium572Open in IMG/M
3300026257|Ga0208407_1132774All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium767Open in IMG/M
3300026263|Ga0207992_1013290All Organisms → cellular organisms → Bacteria2748Open in IMG/M
3300026269|Ga0208766_1182259All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium518Open in IMG/M
3300027906|Ga0209404_10038249All Organisms → Viruses → Predicted Viral2684Open in IMG/M
3300027906|Ga0209404_10624099All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium722Open in IMG/M
3300027906|Ga0209404_10916825All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium598Open in IMG/M
3300029448|Ga0183755_1053314All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1002Open in IMG/M
3300031519|Ga0307488_10562299All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium669Open in IMG/M
3300031605|Ga0302132_10252427All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium832Open in IMG/M
3300031757|Ga0315328_10629879All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium611Open in IMG/M
3300031766|Ga0315322_10100935All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium2082Open in IMG/M
3300031774|Ga0315331_10295271All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1195Open in IMG/M
3300031775|Ga0315326_10257760All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1144Open in IMG/M
3300031851|Ga0315320_10603231All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium721Open in IMG/M
3300032011|Ga0315316_10018352Not Available5343Open in IMG/M
3300032032|Ga0315327_10292278All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium1023Open in IMG/M
3300032032|Ga0315327_10576981All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → Gammaproteobacteria bacterium695Open in IMG/M
3300032047|Ga0315330_10134676All Organisms → Viruses → Predicted Viral1624Open in IMG/M
3300032073|Ga0315315_10018761Not Available6395Open in IMG/M
3300032073|Ga0315315_10124723All Organisms → Viruses → Predicted Viral2400Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater39.70%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine27.64%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater5.53%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.52%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater4.52%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous4.02%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.52%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.51%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater1.51%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.51%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine1.00%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.00%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater0.50%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.50%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.50%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.50%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.50%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine0.50%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000101Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010EnvironmentalOpen in IMG/M
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300001450Marine viral communities from the Pacific Ocean - LP-53EnvironmentalOpen in IMG/M
3300001460Marine viral communities from the Pacific Ocean - LP-28EnvironmentalOpen in IMG/M
3300001472Marine viral communities from the Pacific Ocean - LP-32EnvironmentalOpen in IMG/M
3300001952Marine microbial communities from Newport Harbor, Rhode Island, USA - GS008EnvironmentalOpen in IMG/M
3300001974Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031EnvironmentalOpen in IMG/M
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300002488Marine viral communities from the Pacific Ocean - ETNP_2_60EnvironmentalOpen in IMG/M
3300002514Marine viral communities from the Pacific Ocean - ETNP_6_85EnvironmentalOpen in IMG/M
3300005430Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69EnvironmentalOpen in IMG/M
3300005514Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263EnvironmentalOpen in IMG/M
3300005521Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255EnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006921Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300007231Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009077Pelagic marine microbial communities from North Sea - COGITO_mtgs_110328EnvironmentalOpen in IMG/M
3300009108Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, May cruise - 234m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300009435Pelagic marine microbial communities from North Sea - COGITO_mtgs_100413EnvironmentalOpen in IMG/M
3300009507Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607EnvironmentalOpen in IMG/M
3300009593Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 MetagenomeEnvironmentalOpen in IMG/M
3300010150Marine viral communities from the Subarctic Pacific Ocean - 17B_ETSP_OMZ_AT15314_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010368Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNAEnvironmentalOpen in IMG/M
3300011252Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_4, permeateEnvironmentalOpen in IMG/M
3300011254Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2015_1, 0.02EnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300013010Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.8_DNAEnvironmentalOpen in IMG/M
3300014959Marine microbial communities to study oil droplet degradation from Trondheimsfjord, Norway - 0148 : 4 days incubationEnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017717Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017724Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 11 SPOT_SRF_2010-05-17EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017732Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 38 SPOT_SRF_2012-12-11EnvironmentalOpen in IMG/M
3300017735Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 54 SPOT_SRF_2014-05-21EnvironmentalOpen in IMG/M
3300017737Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11 (version 2)EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017743Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 25 SPOT_SRF_2011-08-17EnvironmentalOpen in IMG/M
3300017744Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 20 SPOT_SRF_2011-02-23EnvironmentalOpen in IMG/M
3300017745Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 50 SPOT_SRF_2014-01-15EnvironmentalOpen in IMG/M
3300017750Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 28 SPOT_SRF_2011-11-29EnvironmentalOpen in IMG/M
3300017752Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 23 SPOT_SRF_2011-06-22EnvironmentalOpen in IMG/M
3300017753Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 30 SPOT_SRF_2012-01-26EnvironmentalOpen in IMG/M
3300017755Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09EnvironmentalOpen in IMG/M
3300017757Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 43 SPOT_SRF_2013-05-22EnvironmentalOpen in IMG/M
3300017758Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30EnvironmentalOpen in IMG/M
3300017759Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017770Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 (version 2)EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300017773Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24EnvironmentalOpen in IMG/M
3300017775Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 55 SPOT_SRF_2014-07-17EnvironmentalOpen in IMG/M
3300017776Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 17 SPOT_SRF_2010-11-23EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017781Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14EnvironmentalOpen in IMG/M
3300020165Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160331_1EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020428Marine microbial communities from Tara Oceans - TARA_E500000331 (ERX556032-ERR599094)EnvironmentalOpen in IMG/M
3300020438Marine microbial communities from Tara Oceans - TARA_B100001094 (ERX555907-ERR598942)EnvironmentalOpen in IMG/M
3300020595Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160412_1EnvironmentalOpen in IMG/M
3300021365Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1EnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300022164Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v2)EnvironmentalOpen in IMG/M
3300022178Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3)EnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300025066Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025120Marine viral communities from the Pacific Ocean - LP-28 (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025131Marine viral communities from the Pacific Ocean - ETNP_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025133Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025137Marine viral communities from the Pacific Ocean - LP-32 (SPAdes)EnvironmentalOpen in IMG/M
3300025141Marine viral communities from the Pacific Ocean - ETNP_6_85 (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025508Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_20_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025696Pelagic Microbial community sample from North Sea - COGITO 998_met_02 (SPAdes)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025849Pelagic marine microbial communities from North Sea - COGITO_mtgs_120607 (SPAdes)EnvironmentalOpen in IMG/M
3300026257Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 (SPAdes)EnvironmentalOpen in IMG/M
3300026263Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F10-02SV255 (SPAdes)EnvironmentalOpen in IMG/M
3300026269Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F12-01SV263 (SPAdes)EnvironmentalOpen in IMG/M
3300027906Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT8 Metagenome (SPAdes)EnvironmentalOpen in IMG/M
3300029448Marine viral communities collected during Tara Oceans survey from station TARA_023 - TARA_E500000082EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031605Marine microbial communities from Western Arctic Ocean, Canada - CB9_32.1EnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031774Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 34915EnvironmentalOpen in IMG/M
3300031775Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315EnvironmentalOpen in IMG/M
3300031851Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515EnvironmentalOpen in IMG/M
3300032011Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 60m 3416EnvironmentalOpen in IMG/M
3300032032Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 32315EnvironmentalOpen in IMG/M
3300032047Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 34915EnvironmentalOpen in IMG/M
3300032073Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 3416EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2010_1000465233300000101MarineMKKFNLIDIVTMLGIAASLLLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF*
DelMOSum2011_1009680023300000115MarineMKKFTLIDIITMLGIAASILLVLMIASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITEPDLNGGWIKPNCDPAEIHCEGD*
JGI24006J15134_10001976223300001450MarineMKKFTLIDIITMVGIASSILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF*
JGI24006J15134_1001276643300001450MarineMKKFTLIDIVTMAGIASSIILVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMNKFARYCKVALFLANSENKKEVGSGVRKGARDAVDICKFVYDVKTDSDLLSAGDRQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF*
JGI24006J15134_1003815423300001450MarineMKKFTLIDIVTMLGIASTIVVMLMYTTGCSMKFYKESPAAVQNCCDRVSAVNKEMDKFNRYCKIALFLANSENKKEVGNGIRKGAREAVNICKFVYKVETDDDLLAAGDHHDYHRVRSYVITEPDLNGGWINPGCDPAEIHCEGD*
JGI24003J15210_1013355723300001460MarineMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF*
JGI24004J15324_1011698023300001472MarineITMVGIASSILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF*
GOS2224_102100543300001952MarineMKKFTLIDIVTMLGIAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLSAGDDQQDYYKVRSYILPSPAQSGGWHPPQCDPAEIHCEEF
GOS2246_1012412843300001974MarineMKNMKSAEWVSILGILAVLALLFAGGCSAKFYRKAAPDVRQCCDRLNAHTTEMEKFNRYCKVALFLANSENKKQVGSGVRKAARDAVNICKFVYAVETDADLRAAGDEQAYYKVRSYILLEPDA
JGI25127J35165_105707423300002482MarineMKKFNLIDVVTLVGIISSILLILMFASGCAMKMKFYEQSPADVRKCCERVSLHQKEMEKFNRYCKVALFLANSEKSKNIGSGVRKGARDAVNVCKFVFGVKTDAELVAAGDEQEYQRVQTFITLPEDEMGFRKTLDCDPQEFSCEEF*
JGI25128J35275_101992023300002488MarineMKKYNLIDIVTTLGIVASILLVLMIVFGSGCSMKFYKQSPADVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRTYIYKDPRNNGGWNPPXCDPAEIHCEEF*
JGI25133J35611_1000764313300002514MarineMKRFTTLDVVTLVGILACLLLVLMSGCSLKFNKKSPADIRHCCDRVSAHTREMEKFNRYCKVALFLSTSKNTKAVGSGVRKGARDVVKICKFVFNVQTDEELVAAGDEQEYYKVRSYILPSP
JGI25133J35611_1001136133300002514MarineMKRFTTLDVVTLVGILACLLLVLMSGCSLKFNKKSPADIRHCCDRVSAHTREMEKFNRYCKVALFLSTSKNTKAVGSGVRXGARDVVKICKFVFNVQTDEELVAAGDEQEYYKVRSYILPSPXNGGWNHPLCDPSDVHCEEF*
Ga0066849_1020592223300005430MarineMKKLTTHDVVTYLGIAATILLILTYATGCSMKFYKKSSEDVRRCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHCEEF*
Ga0066866_1018722623300005514MarineATGCSLKYFKNSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDDQQDYYKVRSYIVKDPDGGWYHPQCDPAEIHCEEF*
Ga0066866_1032117723300005514MarineMKKLTLIDIVTMLGVAATLLLMLMYATGCSMKFYKNSPGDVRKCCERVSAHTQQMEQFNRYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFNVKTDDDLVHAADAQDYYKVRSYITTDSNGDSGWHHPECSP
Ga0066862_1001815153300005521MarineMKKFTLIDIVTTLGIVASILLVLMIVFGSGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHCEEF*
Ga0066862_1003558223300005521MarineMKKLTLIDIVTMLGVAATLLLMLMYATGCSMKFYKNSPGDVRKCCERVSAHTQQMEQFNRYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFNVKTDDDLVHAADAQDYYKVRSYITTDSNGDSGWHHPECSPAEIHCEEF*
Ga0098038_1001782183300006735MarineMKKYNLIDIVTTLGIVASILLVLMIVFGSGCSMKFYKQSPADVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRTYIYKDPRNNGGWNPPQCDPAEIHCEEF*
Ga0098044_104815523300006754MarineMLGIASSILLVLMFASGCSMKFYKKSAEDTRQCCERLNVHTTEMEKFNRYCKVALFLANSDSEKKKEVGSGVRKAARDAVNICKFVYAVETDDDLRAAGDEQAYYKVRSYILTEPETNGGWLHPECDPAEIHCEEF*
Ga0098044_107378323300006754MarineMKRFTTLDVVTLVGILACLLLVLMSGCSLKFNKKSPADIRHCCDRVSAHTREMEKFNRYCKVALFLSTSKNTKAVGSGVRQGARDVVKICKFVFNVQTDEELVAAGDEQEYYKVRSYILPSPDNGGWNHPLCDPSDVHCEEF*
Ga0098044_121441913300006754MarineMKKLNSHEVITYLGILACIALLLSGGCSLKFSKKSAEDVRQCCDRVSAHTQEMEKFNRYCKVALFLATSKNLKAVGAGVRKGARDAVEVCKFVFNVETDDELVSAADEQDYYKVRSYIIRDPDGNGGWFHPQCDPAEIHCEEF*
Ga0098054_100245123300006789MarineMKRFTTLDVVTLVGILACLLLVLMSGCSLKFNKKSPADIRHCCDRVSAHTREMEKFNRYCKVALFLSTSKNTKAVGSGVRQGARDVVKICKFVFNVQTDEELVAAGDEQEYYKVRSYILPSPYNGGWNHPLCDPSDVHCEEF*
Ga0098054_101913543300006789MarineMKKFTLIDIVTMLGIASSILLVLMFASGCSMKFYKKSAQDTRQCCERLNVHTTEMEKFNRYCKVALFLANSDSEKKKEVGSGVRKAARDAVNICKFVYAVETDDDLRAAGDEQAYYKVRSYILTEPETNGGWLHPECDPAEIHCEEF*
Ga0098055_107516223300006793MarineMKKLSTHDIVTGLGIAATILLMLAYATGCSMKLYKQSPADTRQCCERLNVHTTEMEKFNRYCKVALFLANSDSEKKKEVGSGVRKAARDAVNICKFVYAVETDDDLRAAGDEQAYYKVRSYILTEPETNGGWLHPECDPAEIHCEEF*
Ga0098055_118862913300006793MarineMKKFTLIDIVTTLGIVASILLVLMIVFGSGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHC
Ga0070746_1027020523300006919AqueousMKKFTLIDIVTMAGIAASILLVLMFASGCSMKFYKKSPTDVRKCCERVNAHVQEMEKFNRYCKVALFLARGDNKKEIGSGVKKAAREAVEVCKFVYRVESDDDLLASGDEQDYYRVRSYLIEDPRNEATGWMRMSCDPAEIHCEEF*
Ga0098060_104189413300006921MarineFGSGCSMKFYKQSPADVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRTYIYKDPRNNGGWNPPQCDPAEIHCEEF*
Ga0098041_131116123300006928MarineMKKLNTYEIVSYAGIIATILLMLLYVSGCSMKFYKQSPAEVQNCCDRVSAVNKEMDKFNRYCKIALFLANSNYKKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYVITESDLNGGWINP
Ga0075469_1004559313300007231AqueousKMKKFNLIDIVTMLGIAASLLLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF*
Ga0070747_112807213300007276AqueousSRHQKEKKMKKFTLIDIVTMLGIAASILLVLMFASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEMHCEGD*
Ga0070747_124149113300007276AqueousMKKFTLIDIITMLGIAASILLVLMYASGCSMKFYKETPAQIQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEMHCEGD*
Ga0098052_100272053300008050MarineMKRFTTLDVVTLVGILACLLLVLMSGCSLKFNKKSPADIRHCCDRVSAHTREMEKFNRYCKVALFLSTSKNTKAVGSGVRKGARDVVKICKFVFNVQTDEELVAAGDEQEYYKVRSYILPSPDNGGWNHPLCDPSDVHCEEF*
Ga0115566_10007512103300009071Pelagic MarineMKKFNLIDIITMLGIAASILLILMFASGCSMKFYKKSTEDVRKCCERVSLHQKQMAQFTRYCKVALFLANSENKKEVGNGVRKGARDAVNVCKFVFGVDSDEDLLAAGDRQDYYKVRSYIYTKDDPSGRWHPPQCDPAEIHCEEF*
Ga0115566_1029330233300009071Pelagic MarineMKKFTLIDIVTMLGIAASILLVLMFASGCSMKFYKQSREDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLSAGDDQQDYYKVRSYILPSPAQSGGWNPPLCDPAEIHCEEF*
Ga0115566_1035809023300009071Pelagic MarineMKKFTLIDIITMLGIAASILLVLMYASGCSMKFYKETPAQIQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDDHDYYRVRSYRITEPDLNGGWINPGCDPAEIHCEGD*
Ga0115566_1061510513300009071Pelagic MarineMKKFTLIDIVTMAGIAASILLVLMFASGCSMKFYKKSPTDVRKCCERVNAHVQEMEKFNRYCKVALFLARGDNKKEIGSGVKKAAREAVDICKFVYRVESDDDLLASGDEQDYYRVRSYLIEDPRNEATGWMRMGCDPAEIHCEEF*
Ga0115552_121615223300009077Pelagic MarineMKKFTLIDIVTMAGIAASILLVLMFASGCSMKFYKKSPADVRECCERVNAHVQEMEKFNRYCKVALFLARGDNKKEIGSGVKKAAREAVEVCKFVYRVESDDDLLASGDEQDYYRVRSYLIEDPRNEATGWMRMSCDPAEIHCEEF*
Ga0117920_1002160193300009108MarineMKKFNTIEVVTFVGILTCLVLLLTAGCSMKLARNSAADVRKCCDRVSAHTKEMDKFNRYCKVALFLANSENKKEVGSGVRKGARDAVNICKFVFDVETDEDLLAAGDEQDYYKVRSYIIKSPDGNGGWIHPQCDPADMHCEEF*
Ga0115546_105688223300009435Pelagic MarineMKKFTLIDIVTMLGIAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLSAGDDQQDYYKVRSYILPSPAQSGGWNPPLCDPAEIHCEEF*
Ga0115572_1043270213300009507Pelagic MarineMKKFTLIDIITMLGIAASILLVLMYASGCSMKFYKETPAQIQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDDHDYYRVRSYRITEPDLNGGWINPGCDPA
Ga0115011_1004152213300009593MarineMKKLNTYEVVSYLGIAASILLLLMFASGCSLKYFKNSPEDVRKCCERVSLHTKEMDKFARYCKVALFLASSENTKEVGSGVRKGARDAVNVCKFVFDVDTDDELVIAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHCEEF*
Ga0115011_1082387523300009593MarineMKKFTLIDIITMLGIAASILLVLMIASGCSMKFYKTPKDVRQCCERVSAHAAEMEKFARYCKVAVFLATSENTKAVGSGVRKSARQAADVCKFVFRVETDEELVSAGDNQDYYKVRSYIITKPDANGGWLHPNCDPAEIHCEG
Ga0115011_1100560423300009593MarineMKKYNLIDMVTTLGIIASILLVLMIVFGSGCSLKFYKETPEQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAKEAVNICKFVYKVETDADLLAAGDHHDYYRVRSYVITESDLNGGWINPGCDPAEIHCEGD*
Ga0115011_1129737313300009593MarineMKKITTHEVVTYLGIAATILLILMYATGCSMKFYKESPAEVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEI
Ga0098056_100978533300010150MarineMKKFTLIDIVTTLGIVASILLVLMIVFGSGCSMKFYKQSPADVRKCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRTYIYKDPRNNGGWNPPQCDPAEIHCEEF*
Ga0098056_105142223300010150MarineMKMKKLSTHDIVTGLGIAATILLMLAYATGCSMKLYKQSPADTRQCCERLNVHTTEMEKFNRYCKVALFLANSDSEKKKEVGSGVRKAARDAVNICKFVYAVETDDDLRAAGDEQAYYKVRSYILTEPETNGGWLHPECDPAEIHCEEF*
Ga0098061_135157613300010151MarineFTLIDIVTTLGIVASILLVLMIVFGSGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHCEEF*
Ga0098059_102568523300010153MarineMKKLTTHDVVTYLGIAATILLILTYATGCSMKFYKKSPEDVRRCCERVSLHQKEMDKFARYCKVALFLANSENKKEVGSGVRKGARDAVNICKFVFEVDTDKDLLAAGDDQQDYYKVRSYIIKDPDGGWYHPQCDPAEIHCEEF*
Ga0129324_1023644423300010368Freshwater To Marine Saline GradientLGIAASILLVLMIASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEMHCEGD*
Ga0151674_107492213300011252MarineMLGIAASILLVLMFASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVKTDADLLAAGDDHDYYRVRSYKITEPDLNGGWINPGCDPAEIHCEGD*
Ga0151675_108296113300011254MarineMKKFNLIDIVTMLGIASSILLLLMFASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITEPDLNGGWIKPNCDPAELHCEAD*
Ga0163110_1049248013300012928Surface SeawaterMKKLNLIDIITMLGVAATLLLMLMYATGCSMKFYKESAEDVRKCCERVSLHQKEMDKFVRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFNVNSDKDLLTAGDQQDYYKVRSYI
Ga0163180_1133517923300012952SeawaterMKKLNLIDIVTMAGIAASILLVLMFASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRRGAREAVNICKFVYKVETDEDLLAAGDDHDYHRVRSYVIT
Ga0163179_1001303043300012953SeawaterMKKFTLVDIITMVGIASSILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDDQQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF*
Ga0163179_1108112723300012953SeawaterMKKFTLIDVITMLGIAASILLVLMFASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDP
Ga0129327_1023909723300013010Freshwater To Marine Saline GradientMKKFNLIDIVTMLGIAASLLLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCNFVVDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF*
Ga0134299_106074113300014959MarineMKKFTLIDIVTMLGIAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLSAGDDQQDYYKVRSY
Ga0180120_1003566233300017697Freshwater To Marine Saline GradientMKKFTLIDIITMLGIAASILLVLMYASGCSMKFYKETPAQIQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEMHCEGD
Ga0180120_1003879543300017697Freshwater To Marine Saline GradientMKKFTLIDIITMLGIAASILLVLMIASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITE
Ga0180120_1044178513300017697Freshwater To Marine Saline GradientEKKMKKFTLIDIVTMLCIAASILLVLMFASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEMHCEGD
Ga0181369_109004623300017708MarineMKKLTTHEVVTYLGIAATVLLMLVYASGCSMKFYKETPAQIQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVEADADLLAAGDYHDYYRVRSYVITEPDLNGGWINPGCDPAEIHCEGD
Ga0181387_104245123300017709SeawaterSGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLTAGDDQQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181403_101818923300017710SeawaterMKKYNLIDIVTTLGIVASILLVLMIIFGSGCSMKFYKAPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181403_104234923300017710SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCSMKFYKESPAHVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYRITEPDLNGGWINPGCDPAELHCEAD
Ga0181412_102130923300017714SeawaterMKKFTLIDIITMVGIAASILLVLMFASGCSMKFYKAPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDDQQDYYKVRSYIYTKQDPSGGWHPPQCNPAEIHCEEF
Ga0181412_112705323300017714SeawaterFTLIDIITMLGIAASILLVLMFASGCSMKFYKTPKDVRQCCERVNAHADEMKKFVRYCKVAVFLANSENATAVGPGVKKAARQAVDVCKFVFRVESDKDLIAAGDAQEYYKVRSYIIKDPAQDPFWRRSLPCDPLQVTCEEF
Ga0181404_101380353300017717SeawaterMKMKKINTHEVVTYLGIAATILLMLTYASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAEIHCEGD
Ga0181404_110436013300017717SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCSMKFYKESPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVDTDEDLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAEIHCEGD
Ga0181383_106514623300017720SeawaterMKKFTLIDIITMVGIAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLTAGDDQQDYYKVRSYILPSPAQSGGWNPPLCDPTEIHCEEF
Ga0181383_119532513300017720SeawaterMKKLNLIDIVTMAGIAASILLVLMFASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSY
Ga0181388_107117613300017724SeawaterIITILGIVSTLVLMLMYTTGCSMKFYKQSPAEIQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDDHDYYRVRSYVITEPDLNGGWINPGCDPAEIHCEGD
Ga0181401_110757923300017727SeawaterMKKYNLIDIVTTLGIVASILLVLMIIFGSGCSMKFYKAPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDDQQDYYKVRSYIYTKQDSSGGWHP
Ga0181419_104689513300017728SeawaterTTGCSMKFYKQSPAEIQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAEIHCEGD
Ga0181419_105054523300017728SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCTMKFYKKSPEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181417_100990333300017730SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF
Ga0181417_101956913300017730SeawaterMKKFNLIDIITMLGIAASILLLLMYASGCSMKFYKQSPADVRKCCDRVNAHTKEMDKFNRYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVETDADLLAAGDRQDYYKVRSYVLPAPSDEPGSWNPPQC
Ga0181416_101065953300017731SeawaterMKKFTLIDIITMLGIAASILLVLMIASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWFKPNCDPAEIHCEGD
Ga0181416_104500613300017731SeawaterTRSSYGYVIRCCWVSQFRTKEKKMKKLNLIDIVTMAGIAASILLVLMFASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITEPDLNGGWINPGCDPAEIHCEGD
Ga0181416_117638423300017731SeawaterMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNG
Ga0181415_114559713300017732SeawaterMLGIAASILLVLMFASGCSMKFYKESPAAVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVDTDEDLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAEIHCEGD
Ga0181431_101433823300017735SeawaterMKKFNLIDIITMLGIAASILLLLMYASGCSMKFYKQSPADVRKCCDRVNAHTKEMDKFNRYCKVAFFLANSENKKEVGSGVRKGARDAVNVCKFVFDVETDADLLAAGDRQDYYKVRSYVLPAPSDEPGSWNPPQCDPAEIHCEEF
Ga0181431_112673613300017735SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCTMKFYKKSPEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYI
Ga0187218_101583733300017737SeawaterMKKFTLIDIVTMVGIAASILLVLMFTSGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF
Ga0181428_100330973300017738SeawaterMKKFNLIDIITMLGIAASILLLLMYASGCSMKFYKQSPADVRKCCDRVNAHTKEMDKFNRYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVETDADLLAAGDRQDYYKVRSYVLPAPSDEPGSWNPPQCDPAEIHCEGF
Ga0181428_109000213300017738SeawaterMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKV
Ga0181428_111521923300017738SeawaterMLGIAASILLVLMFASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAEIHCEGD
Ga0181433_107774913300017739SeawaterMKKFTLIDIITMVGIASSILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNN
Ga0181418_110202823300017740SeawaterMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDDQQDYYKVRSYIY
Ga0181399_111413723300017742SeawaterMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181402_107922023300017743SeawaterMKKFTLIDIVTMAGIASSIILVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181402_111941823300017743SeawaterASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITEPDLNGGWINPGCDPAEIHCEGDXCGTMTIAIGWQLLPASL
Ga0181397_103999723300017744SeawaterMKKFTLIDIITMLGIAASILLVLMIASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAEIHCEGD
Ga0181397_108230523300017744SeawaterDIVTMVGIAASILLVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLTAGDDQQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181397_110718223300017744SeawaterMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAE
Ga0181427_104052233300017745SeawaterMKKFTLIDIVTMVGIASSILLVLMFASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITEPDLNGGWINPGCDPAEIHCEGDXCGTMTIAIGWQLLPASL
Ga0181405_100900363300017750SeawaterMKKFNLIDIITMLGIATSILLVLMFASGCSMKIYRKSPIDVRKCCERVSAHTQEMEKFNRYCKVALFLAKSENKSVGTGVRKGARDAVNVCKFVFGVKTDDELVIAGDEQEYQRVQTYILQPENEVGWRKKLDCDPQEFSCEEF
Ga0181405_101350733300017750SeawaterMAGIAASILLVLMFASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITEPDLNGGWINPGCDPAEIHCEGD
Ga0181405_114414423300017750SeawaterMKKFTLIDIITMVGIASSILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDDQQDYYKVRSYIYTKQDSSGGWHPPQCNPAEIHCEEF
Ga0181400_102884023300017752SeawaterMKKFTLIDIITMVGIASSILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVDTDKDLLTAGDDQQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181407_101213863300017753SeawaterMKKLNLIDIVTMAGIAASILLVLMFASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITEPDLNGGWINPGCDPAEIHCEGD
Ga0181407_105861423300017753SeawaterMKKFTLIDIITMVGIAASILLVLIFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLTAGDDQQDYYKVRSYILPSPAQSGGWNPPLCDPTEIHCEEF
Ga0181407_106115523300017753SeawaterTMLGIAASILLLLMYASGCSMKFYKQSPADVRKCCDRVNAHTKEMDKFNRYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVETDADLLAAGDRQDYYKVRSYVLPAPSDEPGSWNPPQCDPAEIHCEEF
Ga0181407_116876813300017753SeawaterMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDQQDYYKVRSYIVKDPYNNGGWHHPQ
Ga0181411_110470133300017755SeawaterMKKYNLIDIVTTLGIVASILLVLMIIFGSGCSMKFYKAPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDDQQDYYKVRS
Ga0181420_121805613300017757SeawaterKFNLIDIITMLGIATSILLVLMFASGCSMKIYRKSPIDVRKCCERVSAHTQEMEKFNRYCKVALFLAKSENKSVGTGVRKGARDAVNVCKFVFGVKTDDELVIAGDEQEYQRVQTYILQPENEVGWRKKLDCDPQEFSCEEF
Ga0181409_107929323300017758SeawaterMKKFTLIDIITMLGIAASILLVLMIASGCSMKFYKQSPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAEIHCEGD
Ga0181409_111361713300017758SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCTMKFYKKSPEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEE
Ga0181409_118902523300017758SeawaterAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLTAGDDQQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181414_109322823300017759SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDDQPDYYKVRSYILPSPAQSGGWNPPLCDPT
Ga0181414_117383323300017759SeawaterMKKFTLIDIVTMAGIASSIILVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMNKFARYCKVALFLANSENKKEVGSGVRKGARDAVDICKFVYDVKTDSDLLSAGDRQDYYKVRSYIYKDPRNNGGWNPPQCDPAE
Ga0181408_103245513300017760SeawaterMLGIAASILLVLMFASGCSMKFYKESPAAVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVDTDEDLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEIHCEGD
Ga0181408_107295513300017760SeawaterIAASILLVLMFASGCSMKIYRKSPIDVRKCCERVSAHTQEMEKFNRYCKVALFLAKSENKSVGTGVRKGARDAVNVCKFVFGVKTDDELVIAGDEQEYQRVQTYILQPENEVGWRKKLDCDPQEFSCEEF
Ga0181410_102889513300017763SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCTMKFYKKSPEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWN
Ga0181410_109195913300017763SeawaterIMKKFTLIDIITMLGIAASILLVLMIASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITEPDLNGGWINPGCDPAEIHCEGD
Ga0181385_100961223300017764SeawaterMKKFNLLDIITMLGVASAILVMLMYATGCSMKFYKETPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEIHCEGD
Ga0181385_102237443300017764SeawaterGCTMKFYKKSSEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDDQQDYYKVRSYILPSPAQSGGWNPPLCDPTEIHCEEF
Ga0181385_104492323300017764SeawaterMKKLNLIDIITMLGVAATLLLMLMYATGCSMKFYKESAEDVRKCCERVSLHQQEMDKFVRYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFNVNSDKDLLTAGDQQDYYKVRSYILTEPDANGGWIRPNCDPAEIHCEEF
Ga0181385_107842513300017764SeawaterATILLMLTYASGCSMKFYKQSPEQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAEIHCEGD
Ga0181385_108677823300017764SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCSMKIYRKSPIDVRKCCERVSAHTQEMEKFNRYCKVALFLAKSENKSVGTGVRKGARDAVNVCKFVFGVKTDDELVIAGDEQEYQRVQTYILQPENEVGWRKKLDCDPQEFSCEEF
Ga0181413_100774613300017765SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEE
Ga0181413_119871923300017765SeawaterMKKFTLIDIITMVGIAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDDQQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0187220_100787933300017768SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAEIHCEGD
Ga0187220_102079723300017768SeawaterMKKFTLIDIITMVGIASSILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLTAGDDQQDYYKVRSYILPSPAQSGGWNPPLCDPTEIHCEEF
Ga0187220_116747323300017768SeawaterMKKLNLIDIVTMAGIAASILLVLMFASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVSNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITEPDLNGGWINPGCDPAEIHCEGD
Ga0187220_125152823300017768SeawaterMKKFTLIDIVTMAGIAASILLVLMYASGCSMKFYKESPADVRKCCERVNAHVQEMEKFNRYCKVALFLARGDNKKKIGSGVKKAAREAVEVCKFVYRVDSDDDLLASGDEQDYYRVRSYLIEDPRNEATGWMRMGCDPAE
Ga0187217_128894613300017770SeawaterMKKYNLIDIVTTLGIVASILLVLMIVFGSGCSMKFYKQSPADVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNF
Ga0181430_115551813300017772SeawaterMKKFTLIDIITMVGIAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFEVTTDKDLLSAGDDQQDYYKVRSYIYKDPRNNGGWNPPQCDP
Ga0181430_119702123300017772SeawaterIDIITMLGIAASILLLLMYASGCSMKFYKQSPADVRKCCDRVNAHTKEMDKFNRYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVETDADLLAAGDRQDYYKVRSYVLPAPSDEPGSWNPPQCDPAEIHCEEF
Ga0181386_104250233300017773SeawaterASGCTMKFYKKSPEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181386_105012953300017773SeawaterMKKFNLIDIITMLGIAASILLLLMYASGCSMKFYKQSPADVRKCCDRVNAHTKEMDKFNRYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVETDADLLAAGDRQDYYKVRSYVLPAPSDEPGSWNPPQCDPAEIH
Ga0181386_108295923300017773SeawaterMKKINTYEVVTYLGIAATILLMLTYASGCSMKFYKQSPEQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEIHCEGD
Ga0181386_109145443300017773SeawaterMKKFNLIDIITMLGIAASILLVLMFASGCSMKIYRKSPIDVRKCCERVSAHTQEMEKFNRYCKVALFLAKSENKSVGTGVRKGARDAVNVCKFVFGVKTDDELVIAGDEQEYQRVQTYILQPENEVG
Ga0181386_124586313300017773SeawaterMKKFNLIDIITMVGIAASILLVLMFSTGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDDQQDYYKV
Ga0181432_101011023300017775SeawaterMKKFNTIEVVIFVSILACLVLLLTAGCSMKLTRNSAADVRKCCDRVSAHTKEMDKFNRYCKVALFLANSENKKEVGSGVRKGARDAVNICKFVFDVETDEDLLAAGDEQDYYKVRSYIIKSPDGNGGWVHPQCDPADMHCEEF
Ga0181394_105380523300017776SeawaterMKKLNLIDIVTMAGIAASILLVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181395_105385523300017779SeawaterMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181395_127012123300017779SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCSMKFYKTPKDVRQCCERVNAHADEMKKFVRYCKVAVFLANSENATAVGPGVKKAARQAVDVCKFVFRVESDKDLIAAGDAQEYYKVRSYII
Ga0181423_101677343300017781SeawaterMLGIAASILLLLMYASGCSMKFYKQSPADVRKCCDRVNAHTKEMDKFNRYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVETDADLLAAGDRQDYYKVRSYVLPAPSDEPGSWNPPQCDPAEIHCEEF
Ga0181423_117177413300017781SeawaterMAGIASSIILVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMNKFARYCKVALFLANSENKKEVGSGVRKGARDAVDICKFVYDVKTDSDLLSAGDRQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0181423_124789213300017781SeawaterLLVLMIASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYMITEPDLNGGWINPGCDPAEIHCEGD
Ga0206125_10000134383300020165SeawaterMKKFNLIDIITMLGIAASILLILMFASGCSMKFYKKSTEDVRKCCERVSLHQKQMAQFTRYCKVALFLANSENKKEVGNGVRKGARDAVNVCKFVFGVDSDEDLLAAGDRQDYYKVRSYIYTKDDPSGRWHPPQCDPAEIHCEEF
Ga0206125_1001401823300020165SeawaterMKKYNQNDVITLLGIVATILVILTYATGCSMKLYKNSPSDVRKCCDRVNAHTKEMDKFNRYCKVALFLANSENKKEVGTGIRKGARDAVNICKFVFDVDTDEELLAAGDRQDYYKVRTYILPIDPASGGWNPPQCDPAEIHCEEF
Ga0206125_1004659113300020165SeawaterKMKNFNLIDIVTMLGIASSILLLLMFASGCSMKFYKESPAQIQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEMHCEGD
Ga0206125_1004953623300020165SeawaterMKKFTLIDIVTMLGIAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLSAGDDQQDYYKVRSYILPSPAQSGGWNPPLCDPAEIHCEEF
Ga0206124_1005175243300020175SeawaterMKKFTLIDIVTMLGIAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLSAGDDQQDYYKVR
Ga0206124_1023726323300020175SeawaterMLGIAASILLVLMFASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDDHDYYRVRSYRITEPDLNGGWINPGCDPAEIHCEGD
Ga0211659_1002460753300020404MarineMKKINLFDVITPVGIVSSVLLLLMFASGCSMKFYKNSPEDVRKCCERVNAHVEEMAKFNRYCKVAVFLANSENTKAVGAGVRKGARDAVKVCKFVFGVETDQELISAGDQQEYYRVRSYIITEPDPNGFWIRPNCDPAEIHCEEF
Ga0211521_1001505043300020428MarineMKKFTLIDIITMLGIAASILLVMMFASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAELHCEAD
Ga0211521_1002066733300020428MarineMKKFTLVDIITMVGIASSILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDDQQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0211576_1000613333300020438MarineMKKFTLIDIITMLGIAASILLVLMFASGCSMKFYKTPKDVRQCCERVNAHADEMKKFVRYCKVAVFLANSENATAVGPGVKKAARQAVDVCKFVFRVESDKDLIAAGDAQEYYKVRSYIIKDPAQDPFWRRSLPCDPLQVTCEEF
Ga0211576_1031905113300020438MarineMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0211576_1056023913300020438MarineMKKFTLIDIITMLGIAASILLVLMFASGCSMKFYKESPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYRITEPDLNGGWINPGCDPAELHCEAD
Ga0206126_1007922443300020595SeawaterMKKFNLIDIVTMLGIASSILLLLMFASGCSMKFYKESPAQIQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEMHCEGD
Ga0206123_1003127353300021365SeawaterMKNFNLIDIVTMLGIASSILLLLMFASGCSMKFYKESPAQIQNCCDRVSAVNKEMDKFNRYCKIALFLSNSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEMHCEGD
Ga0206123_1030700213300021365SeawaterMKKFTLIDIVTMLGIAASILLVLMFASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLAKSENKKEVGRGIRKGAREAVNICKFVYKVDTDEDLLAAGDHHDYYRVRSYIMTEPEASGGWIRPNCDPAEIHCEGD
Ga0222718_1008346033300021958Estuarine WaterMKKFTLIDIVTMAGIAASILLVLMFASGCSMKFYKKSPTDVRKCCERVNAHVQEMEKFNRYCKVALFLARGDNKKEIGSGVKKAAREAVDVCKFVYQVESDDDLLASGDEQDYYRVRSYLIEDPRNEATGWMRMACDPAEIHCEEF
Ga0212022_101091913300022164AqueousMKKFNLIDIVTMLGIAASLLLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRS
Ga0196887_101058453300022178AqueousMKKFNLIDIVTMLGIAASLLLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF
(restricted) Ga0233438_1014311943300024255SeawaterMKKFTLIDIVTMLGIAASILLVLMFASGCSMKFYKESPAQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVKTDADLLAAGDHHDYYRVRSYVITEPDLNGGWINPGCDPAEMHCEGD
Ga0208012_100400053300025066MarineMKRFTTLDVVTLVGILACLLLVLMSGCSLKFNKKSPADIRHCCDRVSAHTREMEKFNRYCKVALFLSTSKNTKAVGSGVRQGARDVVKICKFVFNVQTDEELVAAGDEQEYYKVRSYILPSPYNGGWNHPLCDPSDVHCEEF
Ga0209535_1000545323300025120MarineMKKFTLIDIVTMAGIASSIILVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMNKFARYCKVALFLANSENKKEVGSGVRKGARDAVDICKFVYDVKTDSDLLSAGDRQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0209535_101363333300025120MarineMKKFTLIDIITMVGIASSILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF
Ga0209348_104394833300025127MarineMKKFNLIDVVTLVGIISSILLILMFASGCAMKMKFYEQSPADVRKCCERVSLHQKEMEKFNRYCKVALFLANSEKSKNIGSGVRKGARDAVNVCKFVFGVKTDAELVAAGDEQEYQRVQTFITLPEDEMGFRKTLDCDPQEFSCEEF
Ga0209348_106320013300025127MarineMKKFTLIDMVTMLGMAATLLLMLVYATGCSMKFYKTPKDVRQCCERVSAHTQEMEKFARYCKVAVFLATSENTKAVGSGVRKSARQAADVCKFVFRVETDEELVSAGDAQEYYKVRSYIFTDPDLNGGWIHPDCDPAEIHCEEF
Ga0208919_103620013300025128MarineMKKYNLIDIVTTLGIVASILLVLMIVFGSGCSMKFYKQSPADVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRTYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0209128_104537833300025131MarineMKRFTTLDVVTLVGILACLLLVLMSGCSLKFNKKSPADIRHCCDRVSAHTREMEKFNRYCKVALFLSTSKNTKAVGSGVRKGARDVVKICKFVFNVQTDEELVAAGDEQEYYKVRSYILPSPDNGGWNHPLCDPSDVHCEEF
Ga0208299_119581723300025133MarineMGVGYAIRYGRHPKEETMKRFTTIDFVTIIGIIASLLLVLGVGGCSLKFYKTPEDVRNCCDRVNAYAEEMEKFVRYCKVAVFLANSENTKAVGPAVKKGARQAVDVCKFVFQVKTDEDLIAAGDTQEYYKVRSYIIKNPSEEG
Ga0208299_119848523300025133MarineMKKFTLIDIVTTLGIVASILLVLMIVFGSGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHCEEF
Ga0209336_1000279233300025137MarineMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF
Ga0209756_110400113300025141MarineMKKLTTHDVVTYLGIAATILLILTYATGCSLKYFKNSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHCEEF
Ga0209337_100517393300025168MarineMKKFTLIDIVTMLGIASTIVVMLMYTTGCSMKFYKESPAAVQNCCDRVSAVNKEMDKFNRYCKIALFLANSENKKEVGNGIRKGAREAVNICKFVYKVETDDDLLAAGDHHDYHRVRSYVITEPDLNGGWINPGCDPAEIHCEGD
Ga0209337_107075233300025168MarineMKNLTTHEVVTYLGIASSILLVLMLVSGCSMKFYKTPKDVRQCCERVSAHTEEMEKFNRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFGVKTDDELVSAGDKQEYYRVRSYVLPESDLRQGWIRPNCDPAEIHCEEF
Ga0209337_118208423300025168MarineMKKFNEIEVPWCVTILGILACIALLFTPGCSMKFYKKSPIDVRQCCDRVSAHTKEMEKFNRYCKVALFLANSENSKNVGSGVRKGARDAVNICKFVFGVKTDEELVTAGDEQEYQRVQTYILLPENEMGWRKTLDCDPEQPSCEEF
Ga0208148_105220933300025508AqueousIVTMLGIAASLLLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF
Ga0208134_105880823300025652AqueousVTMLGIAASLLLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPLCDPAEIHCEEF
Ga0209532_116673513300025696Pelagic MarineMKKFTLIDIVTMLGIAASILLVLMFASGCSMKFYKQSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGSGVRKGARDAVNICKFVFDVDTDKDLLSAGDDQQDYYKVRSYILPSPAQSGGWNPPLCDPAEI
Ga0209193_104718323300025816Pelagic MarineMKKFTLIDIITMLGIAASILLVLMYASGCSMKFYKETPAQIQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDDHDYYRVRSYRITEPDLNGGWINPGCDPAEIHCEGD
Ga0209603_129296023300025849Pelagic MarineMKKFTLIDIITMLGIAASILLVLMYASGCSMKFYKETPAQIQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNEKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDDHDYYRVRSYRITEPDLNGGWINPGCDPAEI
Ga0208407_113277423300026257MarineMKKLTTHDVVTYLGIAATILLILTYATGCSMKFYKKSSEDVRRCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHCEEF
Ga0207992_101329013300026263MarineVLMIVFGSGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHCEEF
Ga0208766_118225913300026269MarineATGCSLKYFKNSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFDVDTDKDLLTAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHCEEF
Ga0209404_1003824913300027906MarineMKKLNTYEVVSYLGIAASILLLLMFASGCSLKYFKNSPEDVRKCCERVSLHTKEMDKFARYCKVALFLASSENTKEVGSGVRKGARDAVNVCKFVFDVDTDDELVIAGDQQDYYKVRTYIIKDPNHEEQGGWYHPQCDPAEMHCEEF
Ga0209404_1062409923300027906MarineMKKYNLIDMVTTLGIIASILLVLMIVFGSGCSLKFYKETPEQVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAKEAVNICKFVYKVETDADLLAAGDHHDYYRVRSYVITESDLNGGWINPGCDPAEIHCEGD
Ga0209404_1091682513300027906MarineMKKITTHEVVTYLGIAATILLILMYATGCSMKFYKESPAEVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYVITEPDLNGGWI
Ga0183755_105331423300029448MarineMKKFTLIDIITMAGIAASILLVLMFASGCSMKFYKKAPADVRQCCDRVSAHTEEMEKFNRYCKVALFLANSENSKEVGSGVRKGARDAVNVCKFVFGVKTDDELVTAGDEQEYYRVRSYILKEPDLNQGWIRPNCDPAEIHCEEF
Ga0307488_1056229923300031519Sackhole BrineNNIMKKFNLIDIITMLGIAASILLVLMIASGCSMKFYKQSPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDEDLLAAGDHHDYYRVRSYVITEPDLNGGWIKPNCDPAEIHCEGD
Ga0302132_1025242723300031605MarineLVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMNKFARYCKVALFLANSENKKEVGSGVRKGARDAVDICKFVYDVKTDSDLLSAGDRQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0315328_1062987913300031757SeawaterLGIVSTLVLMLMYTTGCSMKFYKQSPAEIQNCCDRVSAVNKEMDKFNRYCKIALFLANSKNKKEVGNGIRKGAREAVNICKFVYKVETDTDLLAAGDHHDYYRVRSYVITEPDLNGGWINPNCDPAEIHCEGD
Ga0315322_1010093533300031766SeawaterMKKLTTHDVVTYLGIAATILLILTYATGCSMKFYKKSPEDVRRCCERVSLHQKEMDKFARYCKVALFLANSENKKEVGSGVRKGARDAVNICKFVFEVDTDKDLLAAGDDQQDYYKVRSYIIKDPDGGWYHPQCDPAEIHCEEF
Ga0315331_1029527113300031774SeawaterMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0315326_1025776023300031775SeawaterMKKFNLIDIITMLGIAASILLLLMYASGCSMKFYKQSPADVRKCCDRVNAHTKEMDKFNRYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVETDADLLAAGDRQDYYKVRSYVLPAPSDEPGSWNPPQCDPAEIHCEEF
Ga0315320_1060323113300031851SeawaterVLMFASGCSMKFYKESPADVQNCCDRVSAVNKEMDKFNRYCKIALFLANSDNKKEVGNGIRKGAREAVNICKFVYKVETDADLLAAGDHHDYYRVRSYRITEPDLNGGWINPGCDPAELHCEAD
Ga0315316_1001835213300032011SeawaterTHDVVTYLGIAATILLILTYATGCSMKFYKKSPEDVRRCCERVSLHQKEMDKFARYCKVALFLANSENKKEVGSGVRKGARDAVNICKFVFEVDTDKDLLAAGDDQQDYYKVRSYIIKDPDGGWYHPQCDPAEIHCEEF
Ga0315327_1029227823300032032SeawaterMKKFTLIDIVTMVGIAASILLVLMFASGCSMKFYKKSPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENTKEVGTGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEI
Ga0315327_1057698123300032032SeawaterMKMKKLSTHDIVTGLGIAATILLMLSYATGCSMKLYKQSAADTRQCCERLSVHTTEMEKFNRYCKVALFLANSDSEKKKEVGSGVRKAARDAVNICKFVYAVETDDDLRAAGDEQAYYKVRSYILTEPETNGGWLHPQCDPAEIHCEEF
Ga0315330_1013467643300032047SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSY
Ga0315315_1001876123300032073SeawaterMKKFTLIDIITMLGIAASILLVLMFASGCTMKFYKKSSEDVRKCCERVSLHQKEMDKFTRYCKVALFLANSENTKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDHQDYYKVRSYIYKDPRNNGGWNPPQCDPAEIHCEEF
Ga0315315_1012472343300032073SeawaterMKKYNLIDIVTTLGIVASILLVLMIIFGSGCSMKFYKAPEDVRKCCERVSLHQKEMDKFARYCKVALFLANSENKKEVGSGVRKGARDAVNVCKFVFDVTTDKDLLSAGDDQQDYYKVRSYIYTKQDSSGGWHPPQCNPAEIHCEEF


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.