| Basic Information | |
|---|---|
| Family ID | F026082 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 199 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LKHLVTPAGMGESFHVLVASKGVEKEKVEGLSGLNFGRQNI |
| Number of Associated Samples | 167 |
| Number of Associated Scaffolds | 199 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.50 % |
| % of genes near scaffold ends (potentially truncated) | 97.99 % |
| % of genes from short scaffolds (< 2000 bps) | 88.94 % |
| Associated GOLD sequencing projects | 160 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (69.849 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.055 % of family members) |
| Environment Ontology (ENVO) | Unclassified (27.638 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.271 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 23.19% β-sheet: 0.00% Coil/Unstructured: 76.81% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 199 Family Scaffolds |
|---|---|---|
| PF00892 | EamA | 23.62 |
| PF02737 | 3HCDH_N | 22.11 |
| PF00725 | 3HCDH | 7.54 |
| PF09832 | DUF2059 | 4.52 |
| PF00293 | NUDIX | 3.52 |
| PF10415 | FumaraseC_C | 2.51 |
| PF13432 | TPR_16 | 2.51 |
| PF02636 | Methyltransf_28 | 2.01 |
| PF02452 | PemK_toxin | 2.01 |
| PF07883 | Cupin_2 | 1.51 |
| PF02687 | FtsX | 1.01 |
| PF00005 | ABC_tran | 1.01 |
| PF09976 | TPR_21 | 1.01 |
| PF02684 | LpxB | 0.50 |
| PF13365 | Trypsin_2 | 0.50 |
| PF12710 | HAD | 0.50 |
| PF01584 | CheW | 0.50 |
| PF04014 | MazE_antitoxin | 0.50 |
| PF01568 | Molydop_binding | 0.50 |
| PF02518 | HATPase_c | 0.50 |
| PF00069 | Pkinase | 0.50 |
| PF12876 | Cellulase-like | 0.50 |
| PF01012 | ETF | 0.50 |
| PF14534 | DUF4440 | 0.50 |
| PF02321 | OEP | 0.50 |
| PF13414 | TPR_11 | 0.50 |
| PF13581 | HATPase_c_2 | 0.50 |
| PF02368 | Big_2 | 0.50 |
| PF14559 | TPR_19 | 0.50 |
| PF07238 | PilZ | 0.50 |
| PF07075 | DUF1343 | 0.50 |
| PF00135 | COesterase | 0.50 |
| PF03576 | Peptidase_S58 | 0.50 |
| PF00903 | Glyoxalase | 0.50 |
| PF01420 | Methylase_S | 0.50 |
| PF00106 | adh_short | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 199 Family Scaffolds |
|---|---|---|---|
| COG1250 | 3-hydroxyacyl-CoA dehydrogenase | Lipid transport and metabolism [I] | 29.65 |
| COG0287 | Prephenate dehydrogenase | Amino acid transport and metabolism [E] | 22.11 |
| COG0677 | UDP-N-acetyl-D-mannosaminuronate dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 22.11 |
| COG2084 | 3-hydroxyisobutyrate dehydrogenase or related beta-hydroxyacid dehydrogenase | Lipid transport and metabolism [I] | 22.11 |
| COG1748 | Saccharopine dehydrogenase, NADP-dependent | Amino acid transport and metabolism [E] | 22.11 |
| COG1004 | UDP-glucose 6-dehydrogenase | Cell wall/membrane/envelope biogenesis [M] | 22.11 |
| COG0240 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 22.11 |
| COG1565 | SAM-dependent methyltransferase, MidA family | General function prediction only [R] | 2.01 |
| COG2337 | mRNA-degrading endonuclease MazF, toxin component of the MazEF toxin-antitoxin module | Defense mechanisms [V] | 2.01 |
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 2.01 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 1.01 |
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 1.01 |
| COG0763 | Lipid A disaccharide synthetase | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG2025 | Electron transfer flavoprotein, alpha subunit FixB | Energy production and conversion [C] | 0.50 |
| COG0732 | Restriction endonuclease S subunit | Defense mechanisms [V] | 0.50 |
| COG2086 | Electron transfer flavoprotein, alpha and beta subunits | Energy production and conversion [C] | 0.50 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.50 |
| COG3876 | Exo-beta-N-acetylmuramidase YbbC/NamZ, DUF1343 family | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 69.85 % |
| Unclassified | root | N/A | 30.15 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000156|NODE_c0727458 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7095 | Open in IMG/M |
| 3300004631|Ga0058899_11439859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300005176|Ga0066679_10236919 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1173 | Open in IMG/M |
| 3300005184|Ga0066671_10101694 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1595 | Open in IMG/M |
| 3300005347|Ga0070668_100411227 | All Organisms → cellular organisms → Bacteria | 1157 | Open in IMG/M |
| 3300005436|Ga0070713_100073285 | All Organisms → cellular organisms → Bacteria | 2898 | Open in IMG/M |
| 3300005447|Ga0066689_10017241 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3460 | Open in IMG/M |
| 3300005534|Ga0070735_10014648 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5838 | Open in IMG/M |
| 3300005538|Ga0070731_10228509 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1235 | Open in IMG/M |
| 3300005538|Ga0070731_10285126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Terriglobales bacterium | 1097 | Open in IMG/M |
| 3300005538|Ga0070731_10344590 | Not Available | 990 | Open in IMG/M |
| 3300005541|Ga0070733_10002691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 12431 | Open in IMG/M |
| 3300005542|Ga0070732_10057497 | All Organisms → cellular organisms → Bacteria | 2254 | Open in IMG/M |
| 3300005542|Ga0070732_10380606 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300005547|Ga0070693_100278297 | All Organisms → cellular organisms → Bacteria | 1119 | Open in IMG/M |
| 3300005547|Ga0070693_101656568 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300005557|Ga0066704_10058671 | All Organisms → cellular organisms → Bacteria | 2449 | Open in IMG/M |
| 3300005566|Ga0066693_10022950 | All Organisms → cellular organisms → Bacteria | 1909 | Open in IMG/M |
| 3300005602|Ga0070762_10028643 | All Organisms → cellular organisms → Bacteria | 2961 | Open in IMG/M |
| 3300005764|Ga0066903_100164084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3229 | Open in IMG/M |
| 3300005884|Ga0075291_1055324 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300005921|Ga0070766_10805476 | Not Available | 640 | Open in IMG/M |
| 3300006034|Ga0066656_10421421 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 866 | Open in IMG/M |
| 3300006047|Ga0075024_100304702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 782 | Open in IMG/M |
| 3300006102|Ga0075015_100499164 | Not Available | 700 | Open in IMG/M |
| 3300006174|Ga0075014_100307732 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 837 | Open in IMG/M |
| 3300006174|Ga0075014_100412083 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 739 | Open in IMG/M |
| 3300006176|Ga0070765_100277150 | All Organisms → cellular organisms → Bacteria | 1544 | Open in IMG/M |
| 3300006176|Ga0070765_100338221 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1397 | Open in IMG/M |
| 3300006176|Ga0070765_101103091 | Not Available | 750 | Open in IMG/M |
| 3300006176|Ga0070765_101526989 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300006354|Ga0075021_10820006 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 602 | Open in IMG/M |
| 3300006794|Ga0066658_10474557 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 681 | Open in IMG/M |
| 3300006797|Ga0066659_10343227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1155 | Open in IMG/M |
| 3300006800|Ga0066660_10716129 | Not Available | 820 | Open in IMG/M |
| 3300006800|Ga0066660_11661445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300007982|Ga0102924_1216609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 816 | Open in IMG/M |
| 3300009038|Ga0099829_10972680 | Not Available | 704 | Open in IMG/M |
| 3300009101|Ga0105247_10210867 | All Organisms → cellular organisms → Bacteria | 1310 | Open in IMG/M |
| 3300009143|Ga0099792_10776032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 626 | Open in IMG/M |
| 3300009519|Ga0116108_1112117 | All Organisms → cellular organisms → Bacteria | 821 | Open in IMG/M |
| 3300009552|Ga0116138_1061849 | Not Available | 1060 | Open in IMG/M |
| 3300009683|Ga0116224_10341370 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300009683|Ga0116224_10654080 | Not Available | 503 | Open in IMG/M |
| 3300009698|Ga0116216_10776449 | Not Available | 575 | Open in IMG/M |
| 3300010329|Ga0134111_10099959 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300010343|Ga0074044_10580065 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 732 | Open in IMG/M |
| 3300010358|Ga0126370_10371366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
| 3300010360|Ga0126372_11296594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 757 | Open in IMG/M |
| 3300010360|Ga0126372_12345188 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 584 | Open in IMG/M |
| 3300010375|Ga0105239_10032475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → Acidobacterium ailaaui | 5735 | Open in IMG/M |
| 3300010376|Ga0126381_100949885 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1239 | Open in IMG/M |
| 3300010379|Ga0136449_100610639 | Not Available | 1856 | Open in IMG/M |
| 3300010397|Ga0134124_12059490 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300012096|Ga0137389_11483358 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 574 | Open in IMG/M |
| 3300012206|Ga0137380_10911062 | Not Available | 755 | Open in IMG/M |
| 3300012212|Ga0150985_102252191 | Not Available | 739 | Open in IMG/M |
| 3300012285|Ga0137370_10330885 | Not Available | 914 | Open in IMG/M |
| 3300012356|Ga0137371_10318521 | All Organisms → cellular organisms → Bacteria | 1210 | Open in IMG/M |
| 3300012359|Ga0137385_10709716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 840 | Open in IMG/M |
| 3300012361|Ga0137360_10476063 | All Organisms → cellular organisms → Bacteria | 1061 | Open in IMG/M |
| 3300012924|Ga0137413_11161876 | Not Available | 614 | Open in IMG/M |
| 3300012925|Ga0137419_11229859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 628 | Open in IMG/M |
| 3300012929|Ga0137404_11661447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300012930|Ga0137407_10287678 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1500 | Open in IMG/M |
| 3300012948|Ga0126375_11766720 | Not Available | 539 | Open in IMG/M |
| 3300014165|Ga0181523_10737277 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300014201|Ga0181537_10015815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5433 | Open in IMG/M |
| 3300014493|Ga0182016_10732417 | Not Available | 553 | Open in IMG/M |
| 3300014501|Ga0182024_12745036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 526 | Open in IMG/M |
| 3300014658|Ga0181519_10485473 | Not Available | 761 | Open in IMG/M |
| 3300014839|Ga0182027_11944734 | All Organisms → cellular organisms → Bacteria | 565 | Open in IMG/M |
| 3300014968|Ga0157379_10171683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1957 | Open in IMG/M |
| 3300017822|Ga0187802_10255851 | Not Available | 678 | Open in IMG/M |
| 3300017924|Ga0187820_1142010 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 718 | Open in IMG/M |
| 3300017925|Ga0187856_1137830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 931 | Open in IMG/M |
| 3300017933|Ga0187801_10140139 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300017933|Ga0187801_10472771 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300017943|Ga0187819_10203934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1166 | Open in IMG/M |
| 3300017955|Ga0187817_11120710 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300017959|Ga0187779_10259611 | Not Available | 1102 | Open in IMG/M |
| 3300017972|Ga0187781_10518148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300017974|Ga0187777_11334607 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300017975|Ga0187782_11659116 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 505 | Open in IMG/M |
| 3300017994|Ga0187822_10062239 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1073 | Open in IMG/M |
| 3300017999|Ga0187767_10340951 | Not Available | 524 | Open in IMG/M |
| 3300018006|Ga0187804_10480858 | Not Available | 557 | Open in IMG/M |
| 3300018021|Ga0187882_1369037 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300018035|Ga0187875_10578625 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300018064|Ga0187773_11041199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300018085|Ga0187772_11424787 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300018088|Ga0187771_10936418 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300018090|Ga0187770_10093922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 2229 | Open in IMG/M |
| 3300018090|Ga0187770_10646833 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300018090|Ga0187770_10888216 | Not Available | 715 | Open in IMG/M |
| 3300019879|Ga0193723_1023371 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1887 | Open in IMG/M |
| 3300020022|Ga0193733_1090867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 854 | Open in IMG/M |
| 3300020579|Ga0210407_11340183 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300020580|Ga0210403_10239783 | Not Available | 1488 | Open in IMG/M |
| 3300020583|Ga0210401_11062703 | All Organisms → cellular organisms → Bacteria → Nitrospirae → unclassified Nitrospirae → Nitrospirae bacterium | 668 | Open in IMG/M |
| 3300021168|Ga0210406_10995295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 624 | Open in IMG/M |
| 3300021168|Ga0210406_11320139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 519 | Open in IMG/M |
| 3300021180|Ga0210396_11112808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 664 | Open in IMG/M |
| 3300021181|Ga0210388_10371927 | All Organisms → cellular organisms → Bacteria | 1257 | Open in IMG/M |
| 3300021403|Ga0210397_10447191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 972 | Open in IMG/M |
| 3300021407|Ga0210383_10236851 | All Organisms → cellular organisms → Bacteria | 1565 | Open in IMG/M |
| 3300021420|Ga0210394_10035728 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4426 | Open in IMG/M |
| 3300021420|Ga0210394_10146617 | All Organisms → cellular organisms → Bacteria | 2049 | Open in IMG/M |
| 3300021420|Ga0210394_10790086 | Not Available | 829 | Open in IMG/M |
| 3300021420|Ga0210394_10887092 | Not Available | 776 | Open in IMG/M |
| 3300021433|Ga0210391_10645332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300021433|Ga0210391_10707236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 789 | Open in IMG/M |
| 3300021433|Ga0210391_11473677 | Not Available | 522 | Open in IMG/M |
| 3300021439|Ga0213879_10252447 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300021445|Ga0182009_10011386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3101 | Open in IMG/M |
| 3300021474|Ga0210390_10077966 | All Organisms → cellular organisms → Bacteria | 2744 | Open in IMG/M |
| 3300021477|Ga0210398_10471611 | Not Available | 1023 | Open in IMG/M |
| 3300021478|Ga0210402_10280865 | All Organisms → cellular organisms → Bacteria | 1540 | Open in IMG/M |
| 3300021479|Ga0210410_10585336 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300022721|Ga0242666_1017652 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
| 3300023250|Ga0224544_1017838 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300025506|Ga0208937_1102557 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300025812|Ga0208457_1073001 | Not Available | 665 | Open in IMG/M |
| 3300025921|Ga0207652_11270121 | Not Available | 639 | Open in IMG/M |
| 3300025928|Ga0207700_11530937 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300025981|Ga0207640_11164822 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 684 | Open in IMG/M |
| 3300026004|Ga0208416_1014282 | Not Available | 622 | Open in IMG/M |
| 3300026067|Ga0207678_11018969 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300026116|Ga0207674_11199233 | Not Available | 729 | Open in IMG/M |
| 3300026317|Ga0209154_1019700 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3172 | Open in IMG/M |
| 3300026527|Ga0209059_1065570 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300026552|Ga0209577_10516450 | Not Available | 784 | Open in IMG/M |
| 3300027567|Ga0209115_1067190 | Not Available | 817 | Open in IMG/M |
| 3300027745|Ga0209908_10071453 | Not Available | 810 | Open in IMG/M |
| 3300027745|Ga0209908_10102327 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300027825|Ga0209039_10032062 | All Organisms → cellular organisms → Bacteria | 2523 | Open in IMG/M |
| 3300027829|Ga0209773_10250182 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300027853|Ga0209274_10416573 | Not Available | 694 | Open in IMG/M |
| 3300027853|Ga0209274_10622907 | Not Available | 558 | Open in IMG/M |
| 3300027882|Ga0209590_10160950 | All Organisms → cellular organisms → Bacteria | 1399 | Open in IMG/M |
| 3300027884|Ga0209275_10149383 | All Organisms → cellular organisms → Bacteria | 1237 | Open in IMG/M |
| 3300027889|Ga0209380_10676173 | Not Available | 594 | Open in IMG/M |
| 3300027895|Ga0209624_10117257 | All Organisms → cellular organisms → Bacteria | 1746 | Open in IMG/M |
| 3300027895|Ga0209624_10268018 | Not Available | 1136 | Open in IMG/M |
| 3300027898|Ga0209067_10442540 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Chromatiales → unclassified Chromatiales → Chromatiales bacterium | 732 | Open in IMG/M |
| 3300027908|Ga0209006_11174967 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 601 | Open in IMG/M |
| 3300027908|Ga0209006_11426664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300027908|Ga0209006_11511542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300028047|Ga0209526_10300194 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300028381|Ga0268264_11305795 | All Organisms → cellular organisms → Bacteria | 736 | Open in IMG/M |
| 3300028748|Ga0302156_10148919 | Not Available | 1139 | Open in IMG/M |
| 3300028776|Ga0302303_10063948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1405 | Open in IMG/M |
| 3300028780|Ga0302225_10548205 | Not Available | 538 | Open in IMG/M |
| 3300028792|Ga0307504_10147225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 796 | Open in IMG/M |
| 3300028819|Ga0307296_10711252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 549 | Open in IMG/M |
| 3300028828|Ga0307312_10251344 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300028906|Ga0308309_10226455 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1553 | Open in IMG/M |
| 3300028906|Ga0308309_10969795 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300029913|Ga0311362_10815418 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300029917|Ga0311326_10299774 | Not Available | 816 | Open in IMG/M |
| 3300029999|Ga0311339_10566960 | Not Available | 1138 | Open in IMG/M |
| 3300030053|Ga0302177_10385255 | Not Available | 736 | Open in IMG/M |
| 3300030058|Ga0302179_10016766 | All Organisms → cellular organisms → Bacteria | 3627 | Open in IMG/M |
| 3300030659|Ga0316363_10187414 | Not Available | 868 | Open in IMG/M |
| 3300030737|Ga0302310_10692276 | Not Available | 531 | Open in IMG/M |
| 3300031028|Ga0302180_10152989 | All Organisms → cellular organisms → Bacteria | 1277 | Open in IMG/M |
| 3300031128|Ga0170823_11160495 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 696 | Open in IMG/M |
| 3300031234|Ga0302325_11310673 | Not Available | 951 | Open in IMG/M |
| 3300031236|Ga0302324_103488886 | Not Available | 510 | Open in IMG/M |
| 3300031249|Ga0265339_10315590 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 742 | Open in IMG/M |
| 3300031474|Ga0170818_114872542 | Not Available | 646 | Open in IMG/M |
| 3300031708|Ga0310686_100258749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 649 | Open in IMG/M |
| 3300031708|Ga0310686_101145375 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
| 3300031708|Ga0310686_106838697 | Not Available | 823 | Open in IMG/M |
| 3300031720|Ga0307469_10409149 | Not Available | 1161 | Open in IMG/M |
| 3300031754|Ga0307475_10727588 | Not Available | 790 | Open in IMG/M |
| 3300031788|Ga0302319_11258994 | Not Available | 678 | Open in IMG/M |
| 3300031820|Ga0307473_11082677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300031823|Ga0307478_10120051 | All Organisms → cellular organisms → Bacteria | 2059 | Open in IMG/M |
| 3300031823|Ga0307478_11489134 | All Organisms → cellular organisms → Bacteria | 560 | Open in IMG/M |
| 3300031912|Ga0306921_11253212 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 823 | Open in IMG/M |
| 3300031962|Ga0307479_10543661 | All Organisms → cellular organisms → Bacteria | 1144 | Open in IMG/M |
| 3300032035|Ga0310911_10602040 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 638 | Open in IMG/M |
| 3300032180|Ga0307471_101554359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300032180|Ga0307471_103544000 | Not Available | 552 | Open in IMG/M |
| 3300032205|Ga0307472_101493691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 659 | Open in IMG/M |
| 3300032515|Ga0348332_10082352 | Not Available | 514 | Open in IMG/M |
| 3300032515|Ga0348332_13146402 | Not Available | 754 | Open in IMG/M |
| 3300032515|Ga0348332_14294152 | All Organisms → cellular organisms → Bacteria | 2794 | Open in IMG/M |
| 3300032896|Ga0335075_10270842 | Not Available | 1932 | Open in IMG/M |
| 3300032898|Ga0335072_10130348 | All Organisms → cellular organisms → Bacteria | 3135 | Open in IMG/M |
| 3300032955|Ga0335076_10384225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1289 | Open in IMG/M |
| 3300033004|Ga0335084_10699138 | All Organisms → cellular organisms → Bacteria | 1033 | Open in IMG/M |
| 3300033158|Ga0335077_10509846 | Not Available | 1271 | Open in IMG/M |
| 3300033402|Ga0326728_10285488 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1525 | Open in IMG/M |
| 3300033405|Ga0326727_10398209 | Not Available | 1266 | Open in IMG/M |
| 3300033412|Ga0310810_10894797 | Not Available | 781 | Open in IMG/M |
| 3300034124|Ga0370483_0047978 | Not Available | 1340 | Open in IMG/M |
| 3300034819|Ga0373958_0222309 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 503 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.06% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.53% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 6.03% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.53% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 4.52% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.52% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 4.52% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.02% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.02% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.52% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.02% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.51% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.51% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.51% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.01% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.01% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 2.01% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.51% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.51% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 1.51% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.00% |
| Thawing Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.50% |
| Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Bulk Soil | 0.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.50% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.50% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.50% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.50% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.50% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.50% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.50% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.50% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.50% |
| Sugar Cane Bagasse Incubating Bioreactor | Engineered → Solid Waste → Grass → Composting → Bioreactor → Sugar Cane Bagasse Incubating Bioreactor | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000156 | Sugar cane bagasse incubating bioreactor microbial communities from Sao Carlos, Brazil, that are aerobic and semianaerobic | Engineered | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
| 3300005534 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005884 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014658 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaG | Environmental | Open in IMG/M |
| 3300014839 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021439 | Vellozia epidendroides bulk soil microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - BS_R03 | Environmental | Open in IMG/M |
| 3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025812 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026004 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_80N_302 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027567 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027745 | Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2M | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027895 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028748 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300028780 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029917 | I_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030058 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030737 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Host-Associated | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| NODE_07274583 | 3300000156 | Sugar Cane Bagasse Incubating Bioreactor | VTPAGMGESFHVLVASKVVAGEKVQRLAGLNFGR* |
| Ga0058899_114398592 | 3300004631 | Forest Soil | VALQLKHLVTPAGVGESFHVLVASKGVDAEKVSRLSGLGFGRR* |
| Ga0066679_102369192 | 3300005176 | Soil | KVTLQLKHLVTPVGMGESFHVLLASKKVDVQKVAGLSGMAFARS* |
| Ga0066671_101016941 | 3300005184 | Soil | VGLQLKHLVTPAGMGENFRVLIASKAVDHERVGGLSGLSFVSSRL* |
| Ga0070668_1004112271 | 3300005347 | Switchgrass Rhizosphere | LKHLVTPAGMGESFHVLVASKGVDSEQVANLSGMSFARSRL* |
| Ga0070713_1000732851 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | HLVTPAGMGESFHVLVASKGIAEDKVTSLAGLSFGTRQPKR* |
| Ga0066689_100172411 | 3300005447 | Soil | QLKHLVTPAGMGESFHGLLASKKVDAQKVTELSGMAFAKS* |
| Ga0070735_100146481 | 3300005534 | Surface Soil | TPAGMGETFHVLVASKGVNEEKIAALSGLTFGKTKS* |
| Ga0070731_102285093 | 3300005538 | Surface Soil | LQLKHLITPTGMGESFHVFIASKDIDTVHVSRLSGLMFGKTARP* |
| Ga0070731_102851262 | 3300005538 | Surface Soil | KVALQLKHLVTPAGMGESFHVLIASKESEAEQASRLAGLSFGLR* |
| Ga0070731_103445901 | 3300005538 | Surface Soil | GMGESFHVLVASKGIEEEKVAALAGLNFGSNRGLGKK* |
| Ga0070733_1000269110 | 3300005541 | Surface Soil | VTPAGMGESFHVLVASKGVDEEKVRAMSGLSFGRI* |
| Ga0070732_100574974 | 3300005542 | Surface Soil | GENFHVLVASKGVIEGKVQQLSGLSFGRRDLRGG* |
| Ga0070732_103806061 | 3300005542 | Surface Soil | LQLKHLVTPAGMGESFHVMVASRGIEAEKAETLAGLNFGATVKRG* |
| Ga0070693_1002782972 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LVTPAGMGESFHVLVASKGVDSGQVANLSGMSFARSRLQA* |
| Ga0070693_1016565681 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | LQLKHLVTPAGMGETFHVLVASKGVSAEQINGLSGLKFGRQ* |
| Ga0066704_100586713 | 3300005557 | Soil | PAGMGESFHVLLASKGVDEAMVAKLAGMSFTKAQP* |
| Ga0066693_100229504 | 3300005566 | Soil | TPAGMGESFQVLVASKGAAEEEVQQLSGLSFGRRGLRGG* |
| Ga0070762_100286431 | 3300005602 | Soil | AGMGESFHVLLASKRVDTAKVTELSGLTFGKTAQL* |
| Ga0066903_1001640843 | 3300005764 | Tropical Forest Soil | KHLVTPAGMGESFHVLVASKGVDSERVASLSGLSFGKRAHAVIAQPT* |
| Ga0075291_10553242 | 3300005884 | Rice Paddy Soil | ALQLKHLITPAGMGESFHVLLASKGVEAERVRRLAGLNFGKQL* |
| Ga0070766_108054762 | 3300005921 | Soil | HLVTPAGMGESFQVLIASTGVQQESVKSLSGLSFGRDAFVP* |
| Ga0066656_104214213 | 3300006034 | Soil | VALQLKHLVTPAGMGESFHVLLASKGVDEAMVAKLAGMSFTKAQP* |
| Ga0075024_1003047022 | 3300006047 | Watersheds | VTPAGMGESFQVLVAAKAVDAEQVAGLSGLSFARSRL* |
| Ga0075015_1004991641 | 3300006102 | Watersheds | LQLKHLVTPAGMGESFHVLVASKGVEAERVAKLSGLSFGRRG* |
| Ga0075014_1003077321 | 3300006174 | Watersheds | ALQLKHLVTPAGMGENFQVLLSSREVPSARVAALSGPSFGVESK* |
| Ga0075014_1004120831 | 3300006174 | Watersheds | QLKHLVTPAGMGESFHVLVGSKGVDAEKASALVGMSFGKR* |
| Ga0070765_1002771504 | 3300006176 | Soil | LKHLVTPEGMGENFQVLIASRDVDAKKIAGLSGLSFGSS* |
| Ga0070765_1003382211 | 3300006176 | Soil | QLKHLVTPAGMGESFHVLVASKGVEKEKVEGLSGLNFGRQNI* |
| Ga0070765_1011030911 | 3300006176 | Soil | VTPAGMGESFQVLIASKGVEQERIRSLSGLNFGRDR* |
| Ga0070765_1015269891 | 3300006176 | Soil | QLKHLVTPAGMGESFHVLVASKGVEKEKVEGLSGLNFGRRNI* |
| Ga0075021_108200062 | 3300006354 | Watersheds | TPAGMGESFHVLVATKGLAPSQVEGLSGLSFARSRL* |
| Ga0066658_104745571 | 3300006794 | Soil | LVTPAGMGESFHGLLASKKVDAQKVTELSGMAFAKS* |
| Ga0066659_103432272 | 3300006797 | Soil | RMPQERAKVARQLKLLVTPEGIGESVHGLLASKKVDEQKVTELSGMAFAKS* |
| Ga0066660_107161291 | 3300006800 | Soil | GMGESFQVLIASRGVEQEKIESLSGLNFGRKKIAR* |
| Ga0066660_116614451 | 3300006800 | Soil | LKHLVTAAGMGESFHVLVASKGVEKEKIAGLAGLSFGRRI* |
| Ga0102924_12166091 | 3300007982 | Iron-Sulfur Acid Spring | LQLKHLITPAGMGESFHVLVAAKGINAELVSKLSGLTFGKMTRL* |
| Ga0099829_109726801 | 3300009038 | Vadose Zone Soil | KHLVTPAGMGESFHVLVASKGVAPERVRALSGLSFGKSRP* |
| Ga0105247_102108671 | 3300009101 | Switchgrass Rhizosphere | LVTPAGMGESFHVLVAAKNVAPQQVEGLSGLSFSKSRL* |
| Ga0099792_107760321 | 3300009143 | Vadose Zone Soil | QLKHLVTPAGMGESFQVLVGAKAVHAERVAGLSGLLFARSRLNNA* |
| Ga0116108_11121172 | 3300009519 | Peatland | ALQLKHLVTPVGMGENFQVLIASRAIDPRKIAALSGLSFGAT* |
| Ga0116138_10618492 | 3300009552 | Peatland | LKHLVTPAGMGESFHVLITAKGVEHEKMESLSGLSFGRRPLAR* |
| Ga0116224_103413701 | 3300009683 | Peatlands Soil | AKVALQLKHLVTPEGMGENFRVMIASRGIDPEKVAALSGLSFGNSA* |
| Ga0116224_106540801 | 3300009683 | Peatlands Soil | GMGEIFHVLIASNGIEQEKVSRLAGMSFGRKARIT* |
| Ga0116216_107764492 | 3300009698 | Peatlands Soil | AGMGESFQVLIASKGVEKEKAGALAALSFGRGTAAR* |
| Ga0134111_100999592 | 3300010329 | Grasslands Soil | LVTPAGMGESFHVLVASKGIDADRSSTLRGLNFSKER* |
| Ga0074044_105800652 | 3300010343 | Bog Forest Soil | VTPEGMGENFQVLIASRAIDRKRVAALSGLSFGSSA* |
| Ga0126370_103713662 | 3300010358 | Tropical Forest Soil | LQLKHLVTPAGMGEAFHVLVLTKRVDEQAARRLSGFSFAI* |
| Ga0126372_112965942 | 3300010360 | Tropical Forest Soil | QLKHLVTPAGMGESFHALVASKGVDLEKVGQLSGLNFGRSIVR* |
| Ga0126372_123451881 | 3300010360 | Tropical Forest Soil | KAKVALQLKHLVTPAGVGETFHVMVASKGVEVLVAEKLSGLSFGVTG* |
| Ga0105239_100324759 | 3300010375 | Corn Rhizosphere | LKHLVTPAGMGESFQVMVASKGIDPELVRKLNGLSFGTRNR* |
| Ga0126381_1009498851 | 3300010376 | Tropical Forest Soil | PAGMGETFHVLLASKGVDAEKAEQLSGLGFGKKSSVGPKRGQGETN* |
| Ga0136449_1006106394 | 3300010379 | Peatlands Soil | ALQLKHLVTPAGMGESFHVLIASKGIEKGKVAALAGLSFGCKLWGT* |
| Ga0134124_120594902 | 3300010397 | Terrestrial Soil | LKHLVTPAGLGESFHVMVASKGIDAEIVAKFSGLSFGKHNG* |
| Ga0137389_114833581 | 3300012096 | Vadose Zone Soil | LQLKHLVTPAGMGESFQVMIASKGVEQERVESLSGLNFGRD |
| Ga0137380_109110621 | 3300012206 | Vadose Zone Soil | GMGESFHVLVASKGIEIEKATTLAGLSFGTRLERRP* |
| Ga0150985_1022521912 | 3300012212 | Avena Fatua Rhizosphere | ALQLKHLVTPAGMGESFHVLLASKGIEAEKVSGLAGLNFGMRNPRAN* |
| Ga0137370_103308851 | 3300012285 | Vadose Zone Soil | MGESFYVLLASKGIEAEKVSGLAGLNFGMRNLRAN* |
| Ga0137371_103185211 | 3300012356 | Vadose Zone Soil | LVTPAGMGESFHVLVATKGIDADRSSTLLGLNFSKKC* |
| Ga0137385_107097161 | 3300012359 | Vadose Zone Soil | QLKHLVTPAGMGESFHVLVVSKGIDPDRASTLMGLNFSKKR* |
| Ga0137360_104760632 | 3300012361 | Vadose Zone Soil | QLKHLVTPAGIGESFHVLVAAKNIDNELVAGLSGLSFARSRL* |
| Ga0137413_111618761 | 3300012924 | Vadose Zone Soil | LVTPAGMGESFQVMVASKGIEKEKMAALAGLSFGRRL* |
| Ga0137419_112298592 | 3300012925 | Vadose Zone Soil | LITPAGMGESFHVLIASKGIEAEKVTALAGLSFGRR* |
| Ga0137404_116614471 | 3300012929 | Vadose Zone Soil | TPAGMGESFHVLVVSKGIDPDRASTLMGLNFSKKR* |
| Ga0137407_102876783 | 3300012930 | Vadose Zone Soil | ALQLKHLVTPAGMGESFHVMIASKGVNPSAIAKLSGLSFGKSSSGA* |
| Ga0126375_117667201 | 3300012948 | Tropical Forest Soil | KVALQLKQLVTPAGMGETFHVLVASKGVPMDATEQLRGLSFGKSQIFSEQT* |
| Ga0181523_107372771 | 3300014165 | Bog | QLKHLVTPEGMGENFRVMIASRGIDPKKVAALSGLSFGSIA* |
| Ga0181537_100158158 | 3300014201 | Bog | VTPAGMGESFQVLIASKGVNEEKVAALAGLNFGRRS* |
| Ga0182016_107324172 | 3300014493 | Bog | QLKHLVTPAGMGESFQVLIASKGIERKRVDSLSGLNFGRLMRSNREPSL* |
| Ga0182024_127450362 | 3300014501 | Permafrost | TPAGMGETFHVLIASKGIESEKVAELSGLMFGKTAYS* |
| Ga0181519_104854732 | 3300014658 | Bog | TPAGMGESFQVLVASKGVEDEKVAGLAGLNFGRRHSPSCF* |
| Ga0182027_119447341 | 3300014839 | Fen | AGMGESFQVLVGSKGIAAEKVSGLSGLCFGKEHG* |
| Ga0157379_101716833 | 3300014968 | Switchgrass Rhizosphere | QLKHLITPAGMGESFHVMVGSKGLDPTAVAKLGGLSFGR* |
| Ga0187802_102558512 | 3300017822 | Freshwater Sediment | ALQLKHLVTPAGMGESFHVLIASKGIDDDKVTALAGLNFGRIKSAR |
| Ga0187820_11420101 | 3300017924 | Freshwater Sediment | TPAGMGETFHVLIASKGINPKKIAQLSGLTFGKPKP |
| Ga0187856_11378301 | 3300017925 | Peatland | LQLKHLVTPEGMGENFQVLIASRAIDRKRVAALSGLSFGSSA |
| Ga0187801_101401393 | 3300017933 | Freshwater Sediment | LQLKHLVTPAGMGESFHVLVASKGVEKKVAAELSGLSFGKSRL |
| Ga0187801_104727712 | 3300017933 | Freshwater Sediment | ITPAGMGENFHVLVGSKGIDRQGEQSLSGLNFGRNARYSYK |
| Ga0187819_102039341 | 3300017943 | Freshwater Sediment | HLVTPEGMGENFQVLIASRAVDPKKVAALSGLSFGSGA |
| Ga0187817_111207101 | 3300017955 | Freshwater Sediment | HLVTPDGMGENFQVLIASRAVDAKKIASLSGLNFGSRA |
| Ga0187779_102596112 | 3300017959 | Tropical Peatland | LQLKHLVTPAGMGETFDVLVMARGVEKEKTRQLGGLRFAR |
| Ga0187781_105181481 | 3300017972 | Tropical Peatland | ALQLKHLISPTGMGETFHVLVSSRGVEAGRVATLSGLQFGKGV |
| Ga0187777_113346071 | 3300017974 | Tropical Peatland | HLVTPAGMGESFRVLVAAKNLDPGRVASLSGLSFAKSKA |
| Ga0187782_116591161 | 3300017975 | Tropical Peatland | KWGTRETKVALQLKHLVTPAGMGESFHVLVASKGIDAEKVSLLAGMGFGRR |
| Ga0187822_100622392 | 3300017994 | Freshwater Sediment | KVALQLKHLVTPSGMGETFHVLVGSKGVDPEMVSSLSGLCFGVDR |
| Ga0187767_103409512 | 3300017999 | Tropical Peatland | LQLKHLVTPAGMGETLQVLVMTKGVERERVCELRGLRFGR |
| Ga0187804_104808582 | 3300018006 | Freshwater Sediment | VTPAGMGESFHVLVASKSVQQGQVANLAGLTFGKSQP |
| Ga0187882_13690371 | 3300018021 | Peatland | ALQLKHLVTPVGMGENFQVLIANRAIDPRKIAALSGLSFGAT |
| Ga0187875_105786251 | 3300018035 | Peatland | KVALQLKHLATPAGMGETFQVLLASRGIDAGKVSGVSGLRFTY |
| Ga0187773_110411991 | 3300018064 | Tropical Peatland | KHLVTPAGMGETFQVLMMSKGVEREKAGLGGLRFGR |
| Ga0187772_114247872 | 3300018085 | Tropical Peatland | VTPAGLGESFHVMVAGKGVKLKESAKLSGLNFGKGRP |
| Ga0187771_109364182 | 3300018088 | Tropical Peatland | AQVALQLKHLVTPAGLGETFHVLVANKGVDSDKVSALSGLGFGQSRSEPQ |
| Ga0187770_100939223 | 3300018090 | Tropical Peatland | QLKHLITPEGMGETFHVLLASKGVARKQTVTLSGLNFGKRREDSQQR |
| Ga0187770_106468331 | 3300018090 | Tropical Peatland | LKHLITPEGMGETFHVLLASRGVAGEKVTGLSGLSFGKQRLGHAG |
| Ga0187770_108882161 | 3300018090 | Tropical Peatland | LQLKHLVTPAGMGETVSVLVMAKGVDKEKTAGLSGLGWPAGR |
| Ga0193723_10233713 | 3300019879 | Soil | KHLVTPAGMGESFHVLVTTKGLAPSQVEGLSGLSFAKSRR |
| Ga0193733_10908672 | 3300020022 | Soil | KHLVTPAGMGENFHVLLAAKGVDAEDLAGLSGLSFANKS |
| Ga0210407_113401832 | 3300020579 | Soil | KVALQLKHLITPEGMGENFRVLIASRAADPDKVIALSGLTFAGGPITRASE |
| Ga0210403_102397833 | 3300020580 | Soil | TPAGMGESFHVLVASKGVEKEKVEGLSGLNFGRRNI |
| Ga0210401_110627031 | 3300020583 | Soil | GMGESFHVLVASKNVDPSSVAKLSGLSFGKSLLPES |
| Ga0210406_109952951 | 3300021168 | Soil | LKHLVTPAGMGESFHVLVASKGVEKEKVEGLSGLNFGRQNI |
| Ga0210406_113201391 | 3300021168 | Soil | KHLVTPAGMGESFHALVASKGVDAGRVAGLSGLMFGMTKS |
| Ga0210396_111128081 | 3300021180 | Soil | VTPAGMGENFHVLVGSKRVDPVMVARLSGLSFGKSRLWQPAAQER |
| Ga0210388_103719271 | 3300021181 | Soil | PAGMGESFHVLVGSKGINNDQASAMAGLSFGRRRVATPPI |
| Ga0210397_104471912 | 3300021403 | Soil | KVALQLKHLITPTGMGESFHVLIASKGIDTERVSRLSGLTFGKTARP |
| Ga0210383_102368513 | 3300021407 | Soil | HLITPTGMGESFHVLIASKGIDTERVSRLSGLTFGKTARP |
| Ga0210394_100357285 | 3300021420 | Soil | VALQLKHLVTPEGMGESFQVLVASKGISAELVSKLSGLTFGKTTSP |
| Ga0210394_101466171 | 3300021420 | Soil | LKHLVTPAGMGESFHVLIASKGIEEVRVSTLAGLNFGRSR |
| Ga0210394_107900861 | 3300021420 | Soil | LKHLVTPAGIGESFQVLIASKGIGLERVESLSGLKFGHRR |
| Ga0210394_108870921 | 3300021420 | Soil | AGMGESFHVLVASKEVAREGIDSLSGLNFGRGPVTR |
| Ga0210391_106453321 | 3300021433 | Soil | HLVTPSGMGENFHVLVASKNVDPSKVAQLCGLNFGKSRS |
| Ga0210391_107072362 | 3300021433 | Soil | LVTPAGMGESFHVLVAAKGVTAKVVSKLSGLTFGKTTSP |
| Ga0210391_114736771 | 3300021433 | Soil | LVTPAGMGESFQVLIANKGIQAEKVSAFSGLNFGRKS |
| Ga0213879_102524471 | 3300021439 | Bulk Soil | HLVTPAGLGETFHVLVASKGVHPDTVSALSGLSFGRPSPPNDIGNVP |
| Ga0182009_100113865 | 3300021445 | Soil | KHLITPAGMGESFHVLLASKGIEAERVSGLAGLNFGMRNLREN |
| Ga0210390_100779661 | 3300021474 | Soil | PEGMGESFQVLVASKGISAELVSKLSGLTFGKTTRP |
| Ga0210398_104716112 | 3300021477 | Soil | TPAGMGESFHVLVASKGIEEEKTITLAGLNFGRARKHSSS |
| Ga0210402_102808651 | 3300021478 | Soil | LKHLVTPAGMGESFRVMVASKGINKKQLSKLSGLSFGKPPAL |
| Ga0210410_105853361 | 3300021479 | Soil | KHLITPTGMGESFHVLIASKDIDTERVSRLSGLMFGKTARP |
| Ga0242666_10176521 | 3300022721 | Soil | KHLVTPAGMGESFHVLAGYKGIAKEKVESLAGVSFGKTVR |
| Ga0224544_10178381 | 3300023250 | Soil | PIGMGENFRVLMASRGMDPGKVTALSGLSFGSGSE |
| Ga0208937_11025571 | 3300025506 | Peatland | KVALQLKHLVTPEGMGENFRVMIASRGIDPKKVAALSGLSFGSIA |
| Ga0208457_10730011 | 3300025812 | Peatland | HLVTPAGLGESFHVLIGSKGVEPEKMESLSGLNFGRRSIAR |
| Ga0207652_112701211 | 3300025921 | Corn Rhizosphere | KHLVTPAGMGESFHVLVASKGVAEEEVQQLSGLSFGRRDLRGC |
| Ga0207700_115309372 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | LQLKHLVTPAGMGETFQVLVASKDVPFESVENLSGLSFAKS |
| Ga0207640_111648222 | 3300025981 | Corn Rhizosphere | LVTPAGMGESFQVMVASKGIDPELVRKLNGLSFGTRNR |
| Ga0208416_10142821 | 3300026004 | Rice Paddy Soil | ALQLKHLITPAGMGESFHVLLASKGVEAERVRRLAGLNFGKQL |
| Ga0207678_110189691 | 3300026067 | Corn Rhizosphere | LVTPAGMGETFHVLVASKGVSAEPITGLSGLKFGRQ |
| Ga0207674_111992332 | 3300026116 | Corn Rhizosphere | KHLVTPAGMGESFQVLVASKGAAEEEVQQLSGLSFGRRDLRGG |
| Ga0209154_10197001 | 3300026317 | Soil | LQLKHLVTPAGMGENFHVLLAAKGIDAKNLAGLSGLSFANSRQRGA |
| Ga0209059_10655703 | 3300026527 | Soil | ALQLKHLVTPAGMGESFHVLVASKGIDADRASTLLGLNFSKKC |
| Ga0209577_105164501 | 3300026552 | Soil | QLKHLVAPAGMDESFHVLVASKEVEKDKVASLAGLEFGAKARVT |
| Ga0209115_10671901 | 3300027567 | Forest Soil | LKHLVTPAGMGESFHVLVASNGVEAEKVSALSGLNFGRR |
| Ga0209908_100714532 | 3300027745 | Thawing Permafrost | GMGESFHVLLASKGVEQERIESLSGLNFGHRQIAR |
| Ga0209908_101023271 | 3300027745 | Thawing Permafrost | TPAGMGETFQVLVASKGVGVEEVANLSGLSFSRGPR |
| Ga0209039_100320625 | 3300027825 | Bog Forest Soil | ALQLKHLVTPAGMGESFHVLIASKGIEEKRTTSLSGVNFGRRQIAAEHC |
| Ga0209773_102501821 | 3300027829 | Bog Forest Soil | PAGLGESFHVLVASKGVTREQVANLSGLAFGSTKPGNKE |
| Ga0209274_104165732 | 3300027853 | Soil | MGESFQVMVASKGIEPEKVSALAGLGFGARTIEKRT |
| Ga0209274_106229071 | 3300027853 | Soil | LVTPAGMGESLHVLVASKGIEEEKVSSLAGLNFARRVVT |
| Ga0209590_101609503 | 3300027882 | Vadose Zone Soil | GLQLKHLVTPAGMGESFQVLVGAKAVHAERVAGLSGLLFARRRLNNA |
| Ga0209275_101493831 | 3300027884 | Soil | GMGESFQVLIASKGVEQERMESLSGLSFGRKVNRGSN |
| Ga0209380_106761732 | 3300027889 | Soil | VALQLKHLVTPAGMGESFQVLIASTGVQQESVKSLSGLSFGRDAFVP |
| Ga0209624_101172573 | 3300027895 | Forest Soil | LKHLVTPAGMGESFHVLVASKGIDQERASTLTGFGFGRKPETV |
| Ga0209624_102680181 | 3300027895 | Forest Soil | TPAGMGESFHVLVASEGIEREKAAAVSGLSFGANQLRR |
| Ga0209067_104425402 | 3300027898 | Watersheds | LKYLVTPAGMGESFHVLVASRGVAADRVAGLSGLRYLRD |
| Ga0209006_111749671 | 3300027908 | Forest Soil | PAGMGESFHVLVASKGVEKEKVEGLSGLNFGRQNI |
| Ga0209006_114266641 | 3300027908 | Forest Soil | LITPEGMGESFQVLVASKGVDLAAVEGLSGLSFGNKRE |
| Ga0209006_115115421 | 3300027908 | Forest Soil | PAGMGESFHVLVASKGVEKEKVEGLSGLNFGRRNI |
| Ga0209526_103001942 | 3300028047 | Forest Soil | KVALQLKHLLAPAGMGESFHVLVATKGLAPSQVEGWSGVSFAKSRL |
| Ga0268264_113057951 | 3300028381 | Switchgrass Rhizosphere | LKHLVTPAGLGESFHVMVASKGIDAEIVAKFSGLSFGKHNG |
| Ga0302156_101489191 | 3300028748 | Bog | VTPAGMGESFQVLIASKGMEKEKAAGLSGLNFGHKPTLSP |
| Ga0302303_100639483 | 3300028776 | Palsa | LVTPIGMGENFRVLMASRGMDPGKVTALSGLSFGSDSE |
| Ga0302225_105482051 | 3300028780 | Palsa | ITPAGMGESFHVLVASKGIAEEKAATLAGLNFGRRSTGGAKP |
| Ga0307504_101472252 | 3300028792 | Soil | VTPAGMGESYQVLVASKDIDPEDVATLSGLSFARSRT |
| Ga0307296_107112522 | 3300028819 | Soil | APEGMGESFRVLVASKGVDVANVSVLAGLSFGRTRRD |
| Ga0307312_102513441 | 3300028828 | Soil | VALQLKHLIAPEGMGESFRVLVASKGVDVANVSVLAGLSFGRTRRD |
| Ga0308309_102264553 | 3300028906 | Soil | VTPAGMGESFHVLVASKGVEKEKVEGLSGLNFGRQNI |
| Ga0308309_109697951 | 3300028906 | Soil | LKHLVTPEGMGENFQVLIASRDVDAKKIAGLSGLSFGSS |
| Ga0311362_108154181 | 3300029913 | Bog | LVTPSGMGENFQVFIATRGVNPNKVASLSGLSFGAS |
| Ga0311326_102997741 | 3300029917 | Bog | LQLKHLVTPAGMGESFQVLIASKGMEKEKAAGLSGLNFGHKPTLSP |
| Ga0311339_105669602 | 3300029999 | Palsa | LQLKHLVTPAGMGESFHVLLASKGVEQERIDSLSGLNFGRRQIAR |
| Ga0302177_103852551 | 3300030053 | Palsa | LQLKHLVTPAGMGESFHVLLASKGVDQERIESLSGLNFGHRQIAR |
| Ga0302179_100167661 | 3300030058 | Palsa | QLKHLVTPAGMGESFQVLIASKGIEEEKVSALSGLSFGRSQ |
| Ga0316363_101874142 | 3300030659 | Peatlands Soil | LKHLVTPAGMGEMFQVLVMSKGVDREKTAGLDGLRFAGRGVAGR |
| Ga0302310_106922761 | 3300030737 | Palsa | ALQLKHLVTPAGMGESFQVLIASKGVGQEKVSELAGLSFGRDPTRE |
| Ga0302180_101529893 | 3300031028 | Palsa | LKHLITPAGMGENFRVLMASRGMAAEKLSALGGLSFGNRSKV |
| Ga0170823_111604951 | 3300031128 | Forest Soil | PVGMGESFHVLIASKDINLEQVSTLSGLRFGKPACL |
| Ga0302325_113106731 | 3300031234 | Palsa | ALQLKHLVTPAGMGESFQVLIASKGVEQEKVSELAGLSFGRDATRE |
| Ga0302324_1034888861 | 3300031236 | Palsa | LKHLVTPAGMGESFQVLIASKGVEQEKVSELAGLSFGRDATRE |
| Ga0265339_103155901 | 3300031249 | Rhizosphere | HLVTPAGMGESFHVLLASKGVEKEKVSTLAGLSFGKNARIS |
| Ga0170818_1148725422 | 3300031474 | Forest Soil | LQLKHLVTPAGMGESFHVLVASKGIEEVRARSLAGLSFGRAKDRA |
| Ga0310686_1002587491 | 3300031708 | Soil | LKHLVTPAGMGESFHVLVASKGIKTEKVAALSGLTFGKTAS |
| Ga0310686_1011453751 | 3300031708 | Soil | KHLVTPAGMGESFHVLVASKGIEKEKAARLAGLSFGRK |
| Ga0310686_1068386972 | 3300031708 | Soil | QLKHLVTPAGMGESFHVLIASKGVAQESVKSLSGFSFGHKTTLR |
| Ga0307469_104091492 | 3300031720 | Hardwood Forest Soil | LKHLVTPAGMGESFHVFVASKGIEAEKAAALAGLSFGRTAQSRAFLG |
| Ga0307475_107275882 | 3300031754 | Hardwood Forest Soil | QLKHLVTPAGMGETFHLLVASKGVARDKVERLSGLSFGTR |
| Ga0302319_112589942 | 3300031788 | Bog | QLKHLVTPAGMGETFQVLLASKGVEKEKAAALSGLNFGHKPALSP |
| Ga0307473_110826772 | 3300031820 | Hardwood Forest Soil | PAGMGENFHVLVGSKRVDPEMVARLSGLSFGKSRLWQPAAQER |
| Ga0307478_101200514 | 3300031823 | Hardwood Forest Soil | VTPAGMGESFHVLLGSKGIDKEKVSKLAGLSFGTSPSPLE |
| Ga0307478_114891342 | 3300031823 | Hardwood Forest Soil | AKVALQLKHLVTPVGMGETFQVLIASRAIDPKKIAALSGLSFESG |
| Ga0306921_112532122 | 3300031912 | Soil | LQLKHLVTPAGMGESFRVLVGSKGVEAGWNLSGLGFGVA |
| Ga0307479_105436613 | 3300031962 | Hardwood Forest Soil | KVALQLKHLVTPVGMGETFQVLIASRAIDPKKIAALSGLSFESG |
| Ga0310911_106020401 | 3300032035 | Soil | KHLVTPAGMGEIFHVLVASKGLDRETVEGLSGLRFGKSRDGVPAG |
| Ga0307471_1015543592 | 3300032180 | Hardwood Forest Soil | ALQLMHLVTPAGMGESFHVWIASKDVDAEQVSGLSGLGFGKQ |
| Ga0307471_1035440002 | 3300032180 | Hardwood Forest Soil | KHLVTPAGMGESFHVLMASKGVEKEKVGKLSGLNFGRAPRST |
| Ga0307472_1014936912 | 3300032205 | Hardwood Forest Soil | HLVTPAGMGENFQVLVASKGVAAARVAGLSGLSFARSRLQGI |
| Ga0348332_100823521 | 3300032515 | Plant Litter | QLKHLVTPAGMGESFHVLVASKGVQQEAIDSLSGLCFGRRQIAR |
| Ga0348332_131464022 | 3300032515 | Plant Litter | GMGESFQVLITSKGIERERVESLSGLNFGRKSIAR |
| Ga0348332_142941525 | 3300032515 | Plant Litter | GMGESFQVLIASKGIEQEKVESLSGLNFGRKPIAH |
| Ga0335075_102708424 | 3300032896 | Soil | TPAGMGESFHVLVASKGIDPNRVSELSGLSFGRRYR |
| Ga0335072_101303486 | 3300032898 | Soil | LKHLVTPAGMGESFHVLVASKRIEAQKVAQLAGLSFGRTRV |
| Ga0335076_103842252 | 3300032955 | Soil | LKHLVTPAGMGESFLVLVGSKGVGPELKLSGLGFGINEL |
| Ga0335084_106991381 | 3300033004 | Soil | PAGLGETFHVLVASKAVARDQVATLGGLTFGNRPI |
| Ga0335077_105098462 | 3300033158 | Soil | KHLVTPAGMGESFDVLVMAKGINKQNLENLSGLRFAR |
| Ga0326728_102854883 | 3300033402 | Peat Soil | KVALQLKQLVTPAGMGETFHALISSKGIADEKVAGLSGLSFGKTKS |
| Ga0326727_103982093 | 3300033405 | Peat Soil | QLKNLVTPAGMGEVFQVLLMRRGVEKEQALQLSGMRYGRG |
| Ga0310810_108947972 | 3300033412 | Soil | HLVTPAGMGESFHVLVASKGVAEEKVQQLSGLSFGRRDLRGG |
| Ga0370483_0047978_1202_1339 | 3300034124 | Untreated Peat Soil | LQLKHLVTPAGMGESFQVLVASKGVEQEKVSELAGLSFGRDATRR |
| Ga0373958_0222309_3_113 | 3300034819 | Rhizosphere Soil | TPAGMGESFHVLVASKGVDSQQVANLSGMSFARSRL |
| ⦗Top⦘ |