Basic Information | |
---|---|
Family ID | F025891 |
Family Type | Metagenome |
Number of Sequences | 199 |
Average Sequence Length | 42 residues |
Representative Sequence | ALLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD |
Number of Associated Samples | 32 |
Number of Associated Scaffolds | 199 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 1.02 % |
% of genes near scaffold ends (potentially truncated) | 97.49 % |
% of genes from short scaffolds (< 2000 bps) | 76.88 % |
Associated GOLD sequencing projects | 32 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (52.764 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens (93.970 % of family members) |
Environment Ontology (ENVO) | Unclassified (100.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Fungus → Fungus corpus (93.970 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 54.29% β-sheet: 0.00% Coil/Unstructured: 45.71% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 199 Family Scaffolds |
---|---|---|
PF00078 | RVT_1 | 7.54 |
PF00385 | Chromo | 6.03 |
PF00665 | rve | 4.52 |
PF03732 | Retrotrans_gag | 2.01 |
PF08284 | RVP_2 | 2.01 |
PF13650 | Asp_protease_2 | 1.01 |
PF09337 | zf-H2C2 | 0.50 |
PF13976 | gag_pre-integrs | 0.50 |
COG ID | Name | Functional Category | % Frequency in 199 Family Scaffolds |
---|---|---|---|
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 4.52 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 4.52 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 4.52 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 4.52 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 52.76 % |
All Organisms | root | All Organisms | 47.24 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300011394|Ga0153970_1004550 | Not Available | 2956 | Open in IMG/M |
3300011394|Ga0153970_1006945 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2297 | Open in IMG/M |
3300011394|Ga0153970_1011161 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota | 1738 | Open in IMG/M |
3300011394|Ga0153970_1018205 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricineae | 1296 | Open in IMG/M |
3300011394|Ga0153970_1024552 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota | 1066 | Open in IMG/M |
3300011394|Ga0153970_1026945 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1001 | Open in IMG/M |
3300011394|Ga0153970_1038072 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus | 776 | Open in IMG/M |
3300011394|Ga0153970_1047499 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 652 | Open in IMG/M |
3300011394|Ga0153970_1049392 | Not Available | 632 | Open in IMG/M |
3300011394|Ga0153970_1050466 | Not Available | 621 | Open in IMG/M |
3300011394|Ga0153970_1060518 | Not Available | 537 | Open in IMG/M |
3300011394|Ga0153970_1061565 | Not Available | 530 | Open in IMG/M |
3300011396|Ga0153960_1008874 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2139 | Open in IMG/M |
3300011396|Ga0153960_1011041 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1901 | Open in IMG/M |
3300011396|Ga0153960_1029955 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 1058 | Open in IMG/M |
3300011396|Ga0153960_1058091 | Not Available | 676 | Open in IMG/M |
3300011396|Ga0153960_1082744 | Not Available | 531 | Open in IMG/M |
3300011401|Ga0153984_1001941 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 4284 | Open in IMG/M |
3300011401|Ga0153984_1006983 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Psathyrellaceae → Coprinopsis → Coprinopsis cinerea | 2473 | Open in IMG/M |
3300011401|Ga0153984_1008746 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2225 | Open in IMG/M |
3300011401|Ga0153984_1010297 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2059 | Open in IMG/M |
3300011401|Ga0153984_1022139 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 1405 | Open in IMG/M |
3300011401|Ga0153984_1032998 | Not Available | 1132 | Open in IMG/M |
3300011401|Ga0153984_1051028 | Not Available | 882 | Open in IMG/M |
3300011401|Ga0153984_1053054 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiaceae → Moniliophthora → Moniliophthora roreri | 863 | Open in IMG/M |
3300011401|Ga0153984_1070064 | Not Available | 735 | Open in IMG/M |
3300011401|Ga0153984_1086792 | Not Available | 651 | Open in IMG/M |
3300011401|Ga0153984_1101113 | Not Available | 598 | Open in IMG/M |
3300011401|Ga0153984_1101810 | Not Available | 595 | Open in IMG/M |
3300011401|Ga0153984_1134015 | Not Available | 512 | Open in IMG/M |
3300011401|Ga0153984_1137566 | Not Available | 505 | Open in IMG/M |
3300012054|Ga0154007_1001842 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 4701 | Open in IMG/M |
3300012054|Ga0154007_1002186 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae | 4367 | Open in IMG/M |
3300012054|Ga0154007_1003170 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 3684 | Open in IMG/M |
3300012054|Ga0154007_1006380 | Not Available | 2495 | Open in IMG/M |
3300012054|Ga0154007_1008739 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus | 2032 | Open in IMG/M |
3300012054|Ga0154007_1012368 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1564 | Open in IMG/M |
3300012054|Ga0154007_1015466 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Strophariaceae → Galerina → Galerina marginata → Galerina marginata CBS 339.88 | 1308 | Open in IMG/M |
3300012054|Ga0154007_1017899 | Not Available | 1155 | Open in IMG/M |
3300012054|Ga0154007_1021526 | Not Available | 982 | Open in IMG/M |
3300012054|Ga0154007_1022298 | Not Available | 952 | Open in IMG/M |
3300012054|Ga0154007_1022398 | Not Available | 948 | Open in IMG/M |
3300012054|Ga0154007_1025813 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 831 | Open in IMG/M |
3300012054|Ga0154007_1027525 | Not Available | 783 | Open in IMG/M |
3300012054|Ga0154007_1042464 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Tulasnellaceae → Tulasnella → Tulasnella calospora → Tulasnella calospora MUT 4182 | 530 | Open in IMG/M |
3300012054|Ga0154007_1043967 | Not Available | 513 | Open in IMG/M |
3300012057|Ga0153995_1001483 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 5753 | Open in IMG/M |
3300012057|Ga0153995_1002757 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae | 4358 | Open in IMG/M |
3300012057|Ga0153995_1006903 | All Organisms → cellular organisms → Eukaryota | 2629 | Open in IMG/M |
3300012057|Ga0153995_1015003 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota | 1537 | Open in IMG/M |
3300012057|Ga0153995_1022545 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus | 1115 | Open in IMG/M |
3300012057|Ga0153995_1024021 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1061 | Open in IMG/M |
3300012057|Ga0153995_1031204 | Not Available | 859 | Open in IMG/M |
3300012057|Ga0153995_1035122 | Not Available | 777 | Open in IMG/M |
3300012057|Ga0153995_1041542 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 674 | Open in IMG/M |
3300012057|Ga0153995_1051250 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales | 563 | Open in IMG/M |
3300012057|Ga0153995_1056570 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Tulasnellaceae → Tulasnella → Tulasnella calospora → Tulasnella calospora MUT 4182 | 517 | Open in IMG/M |
3300012057|Ga0153995_1056668 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 516 | Open in IMG/M |
3300012059|Ga0153991_1004333 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricineae | 3551 | Open in IMG/M |
3300012059|Ga0153991_1007145 | Not Available | 2642 | Open in IMG/M |
3300012059|Ga0153991_1012175 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1916 | Open in IMG/M |
3300012059|Ga0153991_1017084 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1558 | Open in IMG/M |
3300012059|Ga0153991_1022050 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricineae | 1322 | Open in IMG/M |
3300012059|Ga0153991_1029024 | All Organisms → cellular organisms → Eukaryota | 1092 | Open in IMG/M |
3300012059|Ga0153991_1029104 | Not Available | 1090 | Open in IMG/M |
3300012059|Ga0153991_1044562 | Not Available | 789 | Open in IMG/M |
3300012059|Ga0153991_1045807 | Not Available | 773 | Open in IMG/M |
3300012059|Ga0153991_1049555 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 726 | Open in IMG/M |
3300012059|Ga0153991_1057934 | Not Available | 637 | Open in IMG/M |
3300012059|Ga0153991_1076622 | Not Available | 503 | Open in IMG/M |
3300012069|Ga0153965_1004693 | Not Available | 3634 | Open in IMG/M |
3300012069|Ga0153965_1007586 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2820 | Open in IMG/M |
3300012069|Ga0153965_1015059 | Not Available | 1868 | Open in IMG/M |
3300012069|Ga0153965_1016591 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Psathyrellaceae → Coprinopsis → Coprinopsis cinerea | 1756 | Open in IMG/M |
3300012069|Ga0153965_1040589 | Not Available | 898 | Open in IMG/M |
3300012069|Ga0153965_1041426 | Not Available | 882 | Open in IMG/M |
3300012069|Ga0153965_1054166 | Not Available | 692 | Open in IMG/M |
3300012069|Ga0153965_1054940 | Not Available | 683 | Open in IMG/M |
3300012070|Ga0153963_1000162 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 10360 | Open in IMG/M |
3300012070|Ga0153963_1002622 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Psathyrellaceae → Coprinopsis → Coprinopsis cinerea | 3696 | Open in IMG/M |
3300012070|Ga0153963_1004214 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Marasmiineae | 2951 | Open in IMG/M |
3300012070|Ga0153963_1004467 | Not Available | 2873 | Open in IMG/M |
3300012070|Ga0153963_1007388 | Not Available | 2234 | Open in IMG/M |
3300012070|Ga0153963_1019119 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1322 | Open in IMG/M |
3300012070|Ga0153963_1022087 | Not Available | 1210 | Open in IMG/M |
3300012070|Ga0153963_1031898 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae | 949 | Open in IMG/M |
3300012070|Ga0153963_1056840 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 632 | Open in IMG/M |
3300012071|Ga0153983_1002618 | All Organisms → cellular organisms → Eukaryota | 4401 | Open in IMG/M |
3300012071|Ga0153983_1017541 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1412 | Open in IMG/M |
3300012071|Ga0153983_1026534 | Not Available | 1096 | Open in IMG/M |
3300012071|Ga0153983_1059413 | Not Available | 629 | Open in IMG/M |
3300012071|Ga0153983_1075941 | Not Available | 527 | Open in IMG/M |
3300012073|Ga0153979_1020347 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1531 | Open in IMG/M |
3300012073|Ga0153979_1024720 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1366 | Open in IMG/M |
3300012073|Ga0153979_1026949 | Not Available | 1294 | Open in IMG/M |
3300012073|Ga0153979_1031998 | Not Available | 1159 | Open in IMG/M |
3300012073|Ga0153979_1072323 | Not Available | 635 | Open in IMG/M |
3300012073|Ga0153979_1073725 | Not Available | 626 | Open in IMG/M |
3300012076|Ga0153971_1002327 | All Organisms → cellular organisms → Eukaryota | 4416 | Open in IMG/M |
3300012076|Ga0153971_1018219 | Not Available | 1438 | Open in IMG/M |
3300012076|Ga0153971_1026368 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 1141 | Open in IMG/M |
3300012076|Ga0153971_1026537 | Not Available | 1136 | Open in IMG/M |
3300012076|Ga0153971_1043499 | Not Available | 820 | Open in IMG/M |
3300012078|Ga0153999_1078776 | Not Available | 599 | Open in IMG/M |
3300012083|Ga0154000_1003905 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae | 4362 | Open in IMG/M |
3300012083|Ga0154000_1029920 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1430 | Open in IMG/M |
3300012083|Ga0154000_1039865 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1186 | Open in IMG/M |
3300012083|Ga0154000_1042877 | Not Available | 1128 | Open in IMG/M |
3300012083|Ga0154000_1061489 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus | 872 | Open in IMG/M |
3300012083|Ga0154000_1073434 | Not Available | 765 | Open in IMG/M |
3300012083|Ga0154000_1075234 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Leucoagaricus → unclassified Leucoagaricus → Leucoagaricus sp. SymC.cos | 751 | Open in IMG/M |
3300012083|Ga0154000_1076661 | Not Available | 740 | Open in IMG/M |
3300012083|Ga0154000_1087324 | Not Available | 671 | Open in IMG/M |
3300012083|Ga0154000_1103901 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 589 | Open in IMG/M |
3300012083|Ga0154000_1129932 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya | 502 | Open in IMG/M |
3300012119|Ga0153988_1003641 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 3674 | Open in IMG/M |
3300012119|Ga0153988_1007554 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricineae | 2349 | Open in IMG/M |
3300012119|Ga0153988_1040388 | Not Available | 686 | Open in IMG/M |
3300012119|Ga0153988_1055405 | Not Available | 531 | Open in IMG/M |
3300012119|Ga0153988_1056300 | Not Available | 524 | Open in IMG/M |
3300012119|Ga0153988_1059578 | Not Available | 501 | Open in IMG/M |
3300012120|Ga0153998_1007576 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricineae | 2354 | Open in IMG/M |
3300012120|Ga0153998_1019227 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Strophariaceae → Galerina → Galerina marginata → Galerina marginata CBS 339.88 | 1306 | Open in IMG/M |
3300012120|Ga0153998_1035441 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 818 | Open in IMG/M |
3300012120|Ga0153998_1040833 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 724 | Open in IMG/M |
3300012120|Ga0153998_1053171 | Not Available | 572 | Open in IMG/M |
3300012120|Ga0153998_1055578 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Tulasnellaceae → Tulasnella → Tulasnella calospora → Tulasnella calospora MUT 4182 | 549 | Open in IMG/M |
3300012123|Ga0153968_1004831 | Not Available | 2852 | Open in IMG/M |
3300012123|Ga0153968_1007745 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2148 | Open in IMG/M |
3300012123|Ga0153968_1012651 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1605 | Open in IMG/M |
3300012123|Ga0153968_1013087 | All Organisms → cellular organisms → Eukaryota | 1573 | Open in IMG/M |
3300012123|Ga0153968_1016225 | Not Available | 1382 | Open in IMG/M |
3300012123|Ga0153968_1033143 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 850 | Open in IMG/M |
3300012126|Ga0153997_1028440 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Strophariaceae → Galerina → Galerina marginata → Galerina marginata CBS 339.88 | 1030 | Open in IMG/M |
3300012126|Ga0153997_1036966 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus → Agaricus bisporus var. burnettii | 821 | Open in IMG/M |
3300012126|Ga0153997_1038815 | Not Available | 786 | Open in IMG/M |
3300012126|Ga0153997_1042076 | Not Available | 731 | Open in IMG/M |
3300012126|Ga0153997_1053645 | Not Available | 591 | Open in IMG/M |
3300012126|Ga0153997_1059102 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Cantharellales → Tulasnellaceae → Tulasnella → Tulasnella calospora → Tulasnella calospora MUT 4182 | 544 | Open in IMG/M |
3300012126|Ga0153997_1064900 | Not Available | 503 | Open in IMG/M |
3300012130|Ga0153964_1017620 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1321 | Open in IMG/M |
3300012130|Ga0153964_1063403 | Not Available | 542 | Open in IMG/M |
3300012131|Ga0153994_1007216 | Not Available | 2489 | Open in IMG/M |
3300012135|Ga0153982_1026203 | Not Available | 1119 | Open in IMG/M |
3300012135|Ga0153982_1043432 | Not Available | 772 | Open in IMG/M |
3300012136|Ga0153985_1030898 | Not Available | 1050 | Open in IMG/M |
3300012136|Ga0153985_1053956 | Not Available | 699 | Open in IMG/M |
3300012136|Ga0153985_1062627 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Tricholomatineae → Lyophyllaceae → Termitomyces → unclassified Termitomyces → Termitomyces sp. J132 | 621 | Open in IMG/M |
3300012139|Ga0153961_1000948 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 7266 | Open in IMG/M |
3300012139|Ga0153961_1005997 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 2778 | Open in IMG/M |
3300012139|Ga0153961_1020474 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1310 | Open in IMG/M |
3300012139|Ga0153961_1025097 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 1134 | Open in IMG/M |
3300012139|Ga0153961_1027982 | Not Available | 1050 | Open in IMG/M |
3300012139|Ga0153961_1040966 | Not Available | 803 | Open in IMG/M |
3300012139|Ga0153961_1044753 | Not Available | 756 | Open in IMG/M |
3300012141|Ga0153958_1006053 | Not Available | 3315 | Open in IMG/M |
3300012141|Ga0153958_1021293 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricineae | 1520 | Open in IMG/M |
3300012141|Ga0153958_1056417 | Not Available | 739 | Open in IMG/M |
3300012144|Ga0153996_1002464 | Not Available | 6892 | Open in IMG/M |
3300012144|Ga0153996_1002955 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 6065 | Open in IMG/M |
3300012144|Ga0153996_1011175 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 2518 | Open in IMG/M |
3300012144|Ga0153996_1019875 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1715 | Open in IMG/M |
3300012144|Ga0153996_1041174 | Not Available | 1016 | Open in IMG/M |
3300012144|Ga0153996_1057176 | Not Available | 783 | Open in IMG/M |
3300012144|Ga0153996_1061590 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 737 | Open in IMG/M |
3300012144|Ga0153996_1065099 | Not Available | 704 | Open in IMG/M |
3300012144|Ga0153996_1065503 | Not Available | 700 | Open in IMG/M |
3300012144|Ga0153996_1073199 | Not Available | 637 | Open in IMG/M |
3300012144|Ga0153996_1087069 | Not Available | 549 | Open in IMG/M |
3300012169|Ga0153990_1021032 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1455 | Open in IMG/M |
3300012169|Ga0153990_1033222 | Not Available | 1173 | Open in IMG/M |
3300012169|Ga0153990_1040069 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 1069 | Open in IMG/M |
3300012169|Ga0153990_1056073 | Not Available | 894 | Open in IMG/M |
3300012169|Ga0153990_1057360 | Not Available | 884 | Open in IMG/M |
3300012169|Ga0153990_1065320 | Not Available | 822 | Open in IMG/M |
3300012169|Ga0153990_1116988 | Not Available | 594 | Open in IMG/M |
3300012180|Ga0153974_1023774 | Not Available | 1320 | Open in IMG/M |
3300012180|Ga0153974_1032462 | Not Available | 1132 | Open in IMG/M |
3300012180|Ga0153974_1037615 | Not Available | 1055 | Open in IMG/M |
3300012180|Ga0153974_1075440 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales | 752 | Open in IMG/M |
3300012180|Ga0153974_1081040 | Not Available | 727 | Open in IMG/M |
3300012180|Ga0153974_1136248 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 571 | Open in IMG/M |
3300012674|Ga0153962_1045364 | Not Available | 700 | Open in IMG/M |
3300012674|Ga0153962_1059179 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetes incertae sedis → Polyporales | 561 | Open in IMG/M |
3300012998|Ga0157362_1210561 | Not Available | 607 | Open in IMG/M |
3300012999|Ga0157363_1125868 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 986 | Open in IMG/M |
3300013000|Ga0157360_1002665 | Not Available | 6519 | Open in IMG/M |
3300013000|Ga0157360_1012374 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes → Agaricomycetidae → Agaricales → Agaricaceae → Agaricus → Agaricus bisporus | 2812 | Open in IMG/M |
3300013000|Ga0157360_1097401 | Not Available | 934 | Open in IMG/M |
3300013000|Ga0157360_1175397 | Not Available | 692 | Open in IMG/M |
3300013000|Ga0157360_1234326 | Not Available | 594 | Open in IMG/M |
3300013001|Ga0157365_10168865 | Not Available | 706 | Open in IMG/M |
3300013001|Ga0157365_10277407 | Not Available | 545 | Open in IMG/M |
3300013002|Ga0157364_1026466 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Agaricomycotina → Agaricomycetes | 5358 | Open in IMG/M |
3300013002|Ga0157364_1066067 | Not Available | 2327 | Open in IMG/M |
3300013002|Ga0157364_1121374 | Not Available | 1234 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 93.97% |
Fungus Garden | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Fungus Garden | 6.03% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300011394 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA054 MetaG | Host-Associated | Open in IMG/M |
3300011396 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL044 MetaG | Host-Associated | Open in IMG/M |
3300011401 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA068 MetaG | Host-Associated | Open in IMG/M |
3300012054 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC091 MetaG | Host-Associated | Open in IMG/M |
3300012057 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC079 MetaG | Host-Associated | Open in IMG/M |
3300012059 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC075 MetaG | Host-Associated | Open in IMG/M |
3300012069 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL049 MetaG | Host-Associated | Open in IMG/M |
3300012070 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL047 MetaG | Host-Associated | Open in IMG/M |
3300012071 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA067 MetaG | Host-Associated | Open in IMG/M |
3300012073 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA063 MetaG | Host-Associated | Open in IMG/M |
3300012076 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA055 MetaG | Host-Associated | Open in IMG/M |
3300012078 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC083 MetaG | Host-Associated | Open in IMG/M |
3300012083 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC084 MetaG | Host-Associated | Open in IMG/M |
3300012119 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC072 MetaG | Host-Associated | Open in IMG/M |
3300012120 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC082 MetaG | Host-Associated | Open in IMG/M |
3300012123 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA052 MetaG | Host-Associated | Open in IMG/M |
3300012126 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC081 MetaG | Host-Associated | Open in IMG/M |
3300012130 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL048 MetaG | Host-Associated | Open in IMG/M |
3300012131 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC078 MetaG | Host-Associated | Open in IMG/M |
3300012135 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA066 MetaG | Host-Associated | Open in IMG/M |
3300012136 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA069 MetaG | Host-Associated | Open in IMG/M |
3300012139 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL045 MetaG | Host-Associated | Open in IMG/M |
3300012141 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL042 MetaG | Host-Associated | Open in IMG/M |
3300012144 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC080 MetaG | Host-Associated | Open in IMG/M |
3300012169 | Attine ant fungus gardens microbial communities from North Carolina, USA - TSNC074 MetaG | Host-Associated | Open in IMG/M |
3300012180 | Attine ant fungus gardens microbial communities from Georgia, USA - TSGA058 MetaG | Host-Associated | Open in IMG/M |
3300012674 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL046 MetaG | Host-Associated | Open in IMG/M |
3300012998 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM3 | Host-Associated | Open in IMG/M |
3300012999 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta sexdens ASBM1 | Host-Associated | Open in IMG/M |
3300013000 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta laevigata ALBM1 | Host-Associated | Open in IMG/M |
3300013001 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta sexdens ASBM3 | Host-Associated | Open in IMG/M |
3300013002 | Fungus gardens microbial communities from leaf cutter ant in Ribeir?o Preto, State of S?o Paulo, Brazil - Atta sexdens ASBM2 | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0153970_10045505 | 3300011394 | Attine Ant Fungus Gardens | SSRALLEGRSIRNPIRGAWASVYEVYVVVVTAATLLLELDAQVHD* |
Ga0153970_10069454 | 3300011394 | Attine Ant Fungus Gardens | PSRALLEGRSIRYPIRGTWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153970_10111611 | 3300011394 | Attine Ant Fungus Gardens | ALLEGRSIRYPIRGTWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153970_10182051 | 3300011394 | Attine Ant Fungus Gardens | EGRSIRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153970_10245522 | 3300011394 | Attine Ant Fungus Gardens | RSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHN* |
Ga0153970_10269452 | 3300011394 | Attine Ant Fungus Gardens | ALLEGRSVRNLIRGTWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153970_10380721 | 3300011394 | Attine Ant Fungus Gardens | SRALLEGRSVRYPIRGAWASVYEVYVAVVTATTLLLELDAQVHD* |
Ga0153970_10474991 | 3300011394 | Attine Ant Fungus Gardens | ALLEGRSVRNLIRGAWASVYEAYVAVVTAATLLLELNTQVHD* |
Ga0153970_10493921 | 3300011394 | Attine Ant Fungus Gardens | ALLEGRSIRYLIRGAWASVYEAYVVVVTAATLLLELDAQVHD* |
Ga0153970_10504661 | 3300011394 | Attine Ant Fungus Gardens | SLSPPSQALLEGRSIRYLIRGAWASVYEAYVVVVTAATLLLKLDAQVHD* |
Ga0153970_10605182 | 3300011394 | Attine Ant Fungus Gardens | ALLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHN* |
Ga0153970_10615652 | 3300011394 | Attine Ant Fungus Gardens | ALLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153960_10088744 | 3300011396 | Attine Ant Fungus Gardens | RALLEGRSIRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153960_10110411 | 3300011396 | Attine Ant Fungus Gardens | LLEGRSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153960_10299552 | 3300011396 | Attine Ant Fungus Gardens | EGRSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHN* |
Ga0153960_10580912 | 3300011396 | Attine Ant Fungus Gardens | ALLEGRSVRYPIRGTWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153960_10827442 | 3300011396 | Attine Ant Fungus Gardens | ALLEGRSVRYPIRGTWASVYEAYVAVVTAATLLLKLDA* |
Ga0153984_10019411 | 3300011401 | Attine Ant Fungus Gardens | GRSVRNLIRGTWASVYEAYVVVVTAATLLLELDTQVHD* |
Ga0153984_10069831 | 3300011401 | Attine Ant Fungus Gardens | LEGRSIRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153984_10087461 | 3300011401 | Attine Ant Fungus Gardens | LLEGRSVRYPIRGTWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153984_10102971 | 3300011401 | Attine Ant Fungus Gardens | IRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153984_10221392 | 3300011401 | Attine Ant Fungus Gardens | RNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153984_10329983 | 3300011401 | Attine Ant Fungus Gardens | LEGRSVRNLIWGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153984_10510281 | 3300011401 | Attine Ant Fungus Gardens | LPPSRALLEGKSIRNPIQGTWASVYEAYVAVVTATTLLLELDAQVHD* |
Ga0153984_10530541 | 3300011401 | Attine Ant Fungus Gardens | VRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153984_10700641 | 3300011401 | Attine Ant Fungus Gardens | EGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153984_10867921 | 3300011401 | Attine Ant Fungus Gardens | ALLEGRSVRYPIRGAWASVYEAYVAVVIAATLLLELNAQVHD* |
Ga0153984_11011131 | 3300011401 | Attine Ant Fungus Gardens | LRALLEGRSIRYLIWGAWASVYEVYVAVVTAATLLLELDA |
Ga0153984_11018101 | 3300011401 | Attine Ant Fungus Gardens | IRYPIRGAWASVYEVYVAVVTAATLLLKLDAQVHD* |
Ga0153984_11340152 | 3300011401 | Attine Ant Fungus Gardens | RYLIRGTWASIYEAYVAVVTAATLLLELDAQVHD* |
Ga0153984_11375661 | 3300011401 | Attine Ant Fungus Gardens | LLEGRSVRNLIRGAWASVYEAYVAVVTAATLLLELNTQVHD* |
Ga0154007_10018427 | 3300012054 | Attine Ant Fungus Gardens | EGRSVRYPIRGTWASVYEAYVVVVTAATLLLELDAQVHD* |
Ga0154007_10021869 | 3300012054 | Attine Ant Fungus Gardens | FLPSRALLEGRSVRYPIRGTWASVYEVYVAVVTAATLLLELNAQVHD* |
Ga0154007_10031705 | 3300012054 | Attine Ant Fungus Gardens | SSRALLEGRSVRNLIRGAWASIYEAYVAVVTAATLLLELDTQVHD* |
Ga0154007_10063804 | 3300012054 | Attine Ant Fungus Gardens | FLPSRALLEGRSVRYPIRGTWASVYEVYVAVVTAATLLLELDTQVHD* |
Ga0154007_10087392 | 3300012054 | Attine Ant Fungus Gardens | LSSFPSSRALLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0154007_10123681 | 3300012054 | Attine Ant Fungus Gardens | GRSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0154007_10154662 | 3300012054 | Attine Ant Fungus Gardens | RALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0154007_10178991 | 3300012054 | Attine Ant Fungus Gardens | RSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0154007_10215261 | 3300012054 | Attine Ant Fungus Gardens | EGRSVRYPIRGTWASVYEMYVAVVTAATLLLELDAQVHD* |
Ga0154007_10222981 | 3300012054 | Attine Ant Fungus Gardens | RALLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0154007_10223981 | 3300012054 | Attine Ant Fungus Gardens | LSSFSPSRALLEGRSVRYPMRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0154007_10258131 | 3300012054 | Attine Ant Fungus Gardens | RALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVYD* |
Ga0154007_10275251 | 3300012054 | Attine Ant Fungus Gardens | ALLEGRSIRYPIRGTWASVYEAYVAVVTAATLLLELDARVHD* |
Ga0154007_10424642 | 3300012054 | Attine Ant Fungus Gardens | PPSRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0154007_10439671 | 3300012054 | Attine Ant Fungus Gardens | EGRSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153995_10014831 | 3300012057 | Attine Ant Fungus Gardens | SVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153995_10027579 | 3300012057 | Attine Ant Fungus Gardens | SRALLEGRSVRYPIRGTWASVYEVYVAVVTAATLLLELNAQVHD* |
Ga0153995_10069031 | 3300012057 | Attine Ant Fungus Gardens | RALLEGRSVRNLIRGTWASIYEAYVAVVTAATLLLELDTQVHD* |
Ga0153995_10150032 | 3300012057 | Attine Ant Fungus Gardens | PSRALLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153995_10225454 | 3300012057 | Attine Ant Fungus Gardens | ALLEGRSVRNLIRGAWASVYEAYVVVVTAATLLLELDTQVHD* |
Ga0153995_10240212 | 3300012057 | Attine Ant Fungus Gardens | LEGRSVRYPIRGTWASVYEAYVAVVTAATLLLKLDAQVHN* |
Ga0153995_10312041 | 3300012057 | Attine Ant Fungus Gardens | RHPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153995_10351223 | 3300012057 | Attine Ant Fungus Gardens | LEGRSIRYPIRGTWASVYEAYVAVVTAATLLLELDARVHD* |
Ga0153995_10415421 | 3300012057 | Attine Ant Fungus Gardens | VRYPIRGTWASVYEMYVAVVTAATLLLELDAQVHD* |
Ga0153995_10512501 | 3300012057 | Attine Ant Fungus Gardens | GRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153995_10565701 | 3300012057 | Attine Ant Fungus Gardens | LLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153995_10566682 | 3300012057 | Attine Ant Fungus Gardens | SRALLEGRSVRNLIRGAWASVYEAYVVVVTAATLLLELDTQVHD* |
Ga0153991_10043331 | 3300012059 | Attine Ant Fungus Gardens | SIRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153991_10071451 | 3300012059 | Attine Ant Fungus Gardens | EGRSVRYLIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153991_10121751 | 3300012059 | Attine Ant Fungus Gardens | FLPSRALLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLKLDAQVHD* |
Ga0153991_10170845 | 3300012059 | Attine Ant Fungus Gardens | RSIRYPIRGTWASVYEAYVVVVTAATLLLELDTQVHD* |
Ga0153991_10220502 | 3300012059 | Attine Ant Fungus Gardens | SFPSSRALLEGRSIRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153991_10290243 | 3300012059 | Attine Ant Fungus Gardens | PLGALLEGRSVRYPIWGAWASVYEVYVAVVTATTLLLELDAQVHD* |
Ga0153991_10291041 | 3300012059 | Attine Ant Fungus Gardens | ALLEGRSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153991_10445621 | 3300012059 | Attine Ant Fungus Gardens | IRYPIRGTWASVYEAYVVVVTAATLLLELDTQVHD* |
Ga0153991_10458071 | 3300012059 | Attine Ant Fungus Gardens | SSFPPSRALLEGRSVRYLIWGAWASVYEAYVVVVTAATLLLELDAQVHD* |
Ga0153991_10495551 | 3300012059 | Attine Ant Fungus Gardens | LLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153991_10579341 | 3300012059 | Attine Ant Fungus Gardens | RYPIWGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153991_10766221 | 3300012059 | Attine Ant Fungus Gardens | GRSIRYPIRGTWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153965_10046931 | 3300012069 | Attine Ant Fungus Gardens | LEGRSIRNPIRGAWASVYEVYVVVVTAATLLLELDAQVHD* |
Ga0153965_10075861 | 3300012069 | Attine Ant Fungus Gardens | PLRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHN* |
Ga0153965_10081793 | 3300012069 | Attine Ant Fungus Gardens | LLSLRALLEGKSIGNLIWDAWASVYEVYVAVVTATTLLLKLGT* |
Ga0153965_10150591 | 3300012069 | Attine Ant Fungus Gardens | EGRSVRNLIRGAWASVYEAYVAVVTATTLLLELDTQVHD* |
Ga0153965_10165914 | 3300012069 | Attine Ant Fungus Gardens | FPSSRALLEGRSVRNLIWGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153965_10405891 | 3300012069 | Attine Ant Fungus Gardens | EGRSIRYPIRGTWASVYEVYVAVVTAVTLLLELDAQVHD* |
Ga0153965_10414261 | 3300012069 | Attine Ant Fungus Gardens | SSFPPSRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153965_10541661 | 3300012069 | Attine Ant Fungus Gardens | ALLEGRSVRNLIRGAWASVYEAYVAVVTATTLLLELDTQVHN* |
Ga0153965_10549401 | 3300012069 | Attine Ant Fungus Gardens | EGRSVRNLIRGAWVSVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153965_10563771 | 3300012069 | Attine Ant Fungus Gardens | MLLSSRALLEGETIDNLIWDTWASVYEVYVAVVTATTLLLKL |
Ga0153963_10001621 | 3300012070 | Attine Ant Fungus Gardens | LLSSRALLEGKSIRNLIRGAWASVYEAYVVVVTAATLLLKLDAQVHD* |
Ga0153963_10026228 | 3300012070 | Attine Ant Fungus Gardens | SSRALLEGRSVRNLIQGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153963_10042144 | 3300012070 | Attine Ant Fungus Gardens | LLEGRSIRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153963_10044674 | 3300012070 | Attine Ant Fungus Gardens | LEGRSIRYPIRGAWASVYEVYVAVVTAATLLLKLDAQVHD* |
Ga0153963_10073882 | 3300012070 | Attine Ant Fungus Gardens | LSLFLPLRALLEGRSIRNLIQGAWASVYEAYVVVVTAATLLPELDA* |
Ga0153963_10191193 | 3300012070 | Attine Ant Fungus Gardens | RSVRYLIWGAWASVYEAYVVVVTAATLLLELDAQVHD* |
Ga0153963_10220872 | 3300012070 | Attine Ant Fungus Gardens | RNLIRGAWASVYEVYVAVVTAATLLLELDTQVHD* |
Ga0153963_10318983 | 3300012070 | Attine Ant Fungus Gardens | EEKSVRNPIRGAWASIYEAYIVVVTATTLLLELDAQVHD* |
Ga0153963_10568401 | 3300012070 | Attine Ant Fungus Gardens | VRNLIRGAWASVYEAYVAVVTAATLLLELNTQVHD* |
Ga0153983_10026181 | 3300012071 | Attine Ant Fungus Gardens | RSIRNLIRGTWASVYEAYVAVVTATTLLLKLNTQVHD* |
Ga0153983_10175411 | 3300012071 | Attine Ant Fungus Gardens | SVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153983_10265341 | 3300012071 | Attine Ant Fungus Gardens | SSRALLEGRSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153983_10594132 | 3300012071 | Attine Ant Fungus Gardens | LEGRSVRYPIRGAWASIYEAYVAVVTAATLLLELNAQVHD* |
Ga0153983_10759412 | 3300012071 | Attine Ant Fungus Gardens | LSSFPPSRALLEGRSVRYLIRGAWASVYEAYVAVVTAATLLLELDAQVHN* |
Ga0153979_10203476 | 3300012073 | Attine Ant Fungus Gardens | SVRYPVRGAWASVYEVYVAVVTAATLLLELDAQVYD* |
Ga0153979_10247201 | 3300012073 | Attine Ant Fungus Gardens | PSRALLEGRSVRYLIWGAWASVYEAYVVVVTAATLLLELDAQVHD* |
Ga0153979_10269493 | 3300012073 | Attine Ant Fungus Gardens | LEGRSIRYPIRGTWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153979_10319981 | 3300012073 | Attine Ant Fungus Gardens | SSFPSSRALLEGRSVRNLIWGAWASVYEAYVAVVTAATLLLKLDTQVHD* |
Ga0153979_10723231 | 3300012073 | Attine Ant Fungus Gardens | EGRSVRYPIWGAWASVYEVYVAVVTAATLLLELDAQVYD* |
Ga0153979_10737251 | 3300012073 | Attine Ant Fungus Gardens | FPPSRALLEGRSVRYLIRGAWASVYEAYVAVVTAATLLLKLDAQVYD* |
Ga0153971_10023277 | 3300012076 | Attine Ant Fungus Gardens | SRALLEGRSIRNLIRGTWASVYEAYVAVVTATTLLLELNTQVHD* |
Ga0153971_10182191 | 3300012076 | Attine Ant Fungus Gardens | ALLEGRSIRYPIRGTWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153971_10263681 | 3300012076 | Attine Ant Fungus Gardens | LLEGRSIRYPIRGTWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153971_10265371 | 3300012076 | Attine Ant Fungus Gardens | LLEGRSVRNLIWGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153971_10434991 | 3300012076 | Attine Ant Fungus Gardens | LLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHN* |
Ga0153999_10787761 | 3300012078 | Attine Ant Fungus Gardens | LLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLKLDAQVHD* |
Ga0154000_10039059 | 3300012083 | Attine Ant Fungus Gardens | PSRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELNAQVHD* |
Ga0154000_10299201 | 3300012083 | Attine Ant Fungus Gardens | LLEGRSVRYPIRGAWASVYEVYVVVVTAATLLLELNAQVHD* |
Ga0154000_10398652 | 3300012083 | Attine Ant Fungus Gardens | ALLEGRSVRYPIRGTWASVYEAYVAVVTAATLLLKLDAQVHN* |
Ga0154000_10428771 | 3300012083 | Attine Ant Fungus Gardens | LLEGRSVRYPIRGAWASIYEAYVGVVTAAILLLELDAQVHD* |
Ga0154000_10614891 | 3300012083 | Attine Ant Fungus Gardens | LLEGRSVRYLIRGAWASVYEAYVAVVTAATLLLKLDAQVHD* |
Ga0154000_10734341 | 3300012083 | Attine Ant Fungus Gardens | GRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0154000_10752341 | 3300012083 | Attine Ant Fungus Gardens | PSRALLEGRSVRYPIRGTWASVYEAYVAVVTAATLLLKLDAQVHD* |
Ga0154000_10766612 | 3300012083 | Attine Ant Fungus Gardens | RALLEGKSVRNPIWGTWASVYEAYVAVVIAATLLLELDAQVHN* |
Ga0154000_10873241 | 3300012083 | Attine Ant Fungus Gardens | RSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHN* |
Ga0154000_11039012 | 3300012083 | Attine Ant Fungus Gardens | RYPIRGAWASVYEVYVVVVTAATLLLELDAQVHH* |
Ga0154000_11299321 | 3300012083 | Attine Ant Fungus Gardens | SSRALLEGRSVRNLIRGAWASVYEAYVVVVTAATLLLELDTQVHD* |
Ga0153988_10036416 | 3300012119 | Attine Ant Fungus Gardens | ALLEGRSVRNLIRGAWASIYEAYVAVVTAATLLLELDTQVHD* |
Ga0153988_10075541 | 3300012119 | Attine Ant Fungus Gardens | IRYPIRGTWASVYEAYVAVVTAATLLLELDARVHD* |
Ga0153988_10403881 | 3300012119 | Attine Ant Fungus Gardens | VRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153988_10554051 | 3300012119 | Attine Ant Fungus Gardens | ALLEGRSVRYLIWGAWASVYEAYVVVVTAATLLLELDAQVHD* |
Ga0153988_10563001 | 3300012119 | Attine Ant Fungus Gardens | SVRYPIRGTWASVYEAYVVVVTAATLLLELDAQVHD* |
Ga0153988_10595781 | 3300012119 | Attine Ant Fungus Gardens | GRSVRYPIRGAWASVYEAYVAVVTAATLLLKLDAQVHD* |
Ga0153998_10075761 | 3300012120 | Attine Ant Fungus Gardens | RSIRYPIRGTWASVYEAYVAVVTAATLLLELDARVHD* |
Ga0153998_10192272 | 3300012120 | Attine Ant Fungus Gardens | ALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153998_10354411 | 3300012120 | Attine Ant Fungus Gardens | GRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVYD* |
Ga0153998_10408332 | 3300012120 | Attine Ant Fungus Gardens | ALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHN* |
Ga0153998_10531712 | 3300012120 | Attine Ant Fungus Gardens | LLFSRALLEGKSVRNLIWGAWASVYEVYVAVVTATTLLLKLGA* |
Ga0153998_10555782 | 3300012120 | Attine Ant Fungus Gardens | SVLSSFPPSRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153968_10048316 | 3300012123 | Attine Ant Fungus Gardens | VRYLIQGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153968_10077454 | 3300012123 | Attine Ant Fungus Gardens | PPSRALLEGRSIRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153968_10126511 | 3300012123 | Attine Ant Fungus Gardens | RALLEGRSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153968_10130871 | 3300012123 | Attine Ant Fungus Gardens | ALLEGRSIRYPIRGTWASVYEAYVVVVTAATLLLELDTQVHD* |
Ga0153968_10162251 | 3300012123 | Attine Ant Fungus Gardens | PSRALLEGRSIRYPIRGTWASVYEAYVAVVTAATLLLELNAQVHD* |
Ga0153968_10331432 | 3300012123 | Attine Ant Fungus Gardens | RNLIRGAWASVYEAYVAVVTAATLLLELDTQVHN* |
Ga0153997_10284401 | 3300012126 | Attine Ant Fungus Gardens | PSRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153997_10369662 | 3300012126 | Attine Ant Fungus Gardens | EGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVYD* |
Ga0153997_10388151 | 3300012126 | Attine Ant Fungus Gardens | SRALLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153997_10420761 | 3300012126 | Attine Ant Fungus Gardens | LFLPSRALLEGRSVRYPIQGAWASVYEVYVAVVTATTLLLELDAQVHD |
Ga0153997_10536452 | 3300012126 | Attine Ant Fungus Gardens | SVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153997_10591022 | 3300012126 | Attine Ant Fungus Gardens | LSSFPPSRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153997_10649001 | 3300012126 | Attine Ant Fungus Gardens | SRALLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLKLDAQVHD* |
Ga0153964_10176203 | 3300012130 | Attine Ant Fungus Gardens | SVRYLIWGAWASVYEAYVVVVTAATLLLELDAQVHD* |
Ga0153964_10634032 | 3300012130 | Attine Ant Fungus Gardens | FPSSRALLEGRSVRYPIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153994_10072161 | 3300012131 | Attine Ant Fungus Gardens | PSRALLEGRSVRYPIRGTWASVYEVYVAVVTAATLLLELDTQVHD* |
Ga0153982_10262031 | 3300012135 | Attine Ant Fungus Gardens | RALLEGRSVRYLIWGAWASVYEAYVVVVTAATLLLELDAQVHD* |
Ga0153982_10434321 | 3300012135 | Attine Ant Fungus Gardens | LSSRALLEGRSIRNLIRGAWASVYEVYVVVVTAATLLLKLDAQVHD* |
Ga0153985_10123401 | 3300012136 | Attine Ant Fungus Gardens | SLRALLEGKSIGNLIWDAWASVYEVYVAVVTATTLLLKLGT* |
Ga0153985_10308981 | 3300012136 | Attine Ant Fungus Gardens | PSRALLEGRSIRYPIRGAWASVYEVYVAVVTAATLLLKLDAQVHD* |
Ga0153985_10539561 | 3300012136 | Attine Ant Fungus Gardens | LDHVVVLSSFLSSRALLEGRSVRYPIRGTWASVYEAYVVVVTAATLLLELD |
Ga0153985_10626272 | 3300012136 | Attine Ant Fungus Gardens | LLEGRSIRNLIRGTWASVYEAYVAVVTATTLLLELNTQVHD* |
Ga0153961_100094812 | 3300012139 | Attine Ant Fungus Gardens | LLEGRSIRYPIWGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153961_10059971 | 3300012139 | Attine Ant Fungus Gardens | GRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHN* |
Ga0153961_10204741 | 3300012139 | Attine Ant Fungus Gardens | RALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDTQVHD* |
Ga0153961_10250972 | 3300012139 | Attine Ant Fungus Gardens | SIRNPIRGAWASVYEVYVVVVTAATLLLELDAQVHD* |
Ga0153961_10279822 | 3300012139 | Attine Ant Fungus Gardens | VLSLFPPLRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDA* |
Ga0153961_10409661 | 3300012139 | Attine Ant Fungus Gardens | LRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQ |
Ga0153961_10447531 | 3300012139 | Attine Ant Fungus Gardens | SVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVRD* |
Ga0153958_10060531 | 3300012141 | Attine Ant Fungus Gardens | RSIRNPIRGAWASVYEVYVVVVTAATLLLELDAQVHD* |
Ga0153958_10212931 | 3300012141 | Attine Ant Fungus Gardens | LPLRALLEGRSIRYPIRGAWASVYEVYVAVVTAATLLLKLNAQVHD* |
Ga0153958_10564171 | 3300012141 | Attine Ant Fungus Gardens | ALLEGRSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVRD* |
Ga0153996_10024641 | 3300012144 | Attine Ant Fungus Gardens | ALLEGRSVRYLIRGAWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153996_10029555 | 3300012144 | Attine Ant Fungus Gardens | SRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153996_10111751 | 3300012144 | Attine Ant Fungus Gardens | ALLEGRSVRYLIRGTWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153996_10198751 | 3300012144 | Attine Ant Fungus Gardens | PSRALLEGRSVRYPIRGTWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153996_10411741 | 3300012144 | Attine Ant Fungus Gardens | RNLIRGAWASIYEEYVAVVTAATLLLELNTQVHD* |
Ga0153996_10571763 | 3300012144 | Attine Ant Fungus Gardens | ALLEGRSVRNLIRGAWASVYEAYVAVVTAATLLLKLDTQVHD* |
Ga0153996_10615902 | 3300012144 | Attine Ant Fungus Gardens | RNPIWGTWASVYEAYVAVVTAATLLLELDAQVHN* |
Ga0153996_10650991 | 3300012144 | Attine Ant Fungus Gardens | RALLEGRSVRYLIRGAWASVYEAYVMVVTAATLLLELDAQVYD* |
Ga0153996_10655031 | 3300012144 | Attine Ant Fungus Gardens | LFPPSRALLEGRSVRYPIRGAWASVYEVYVAVVTAATLLLKLD |
Ga0153996_10731991 | 3300012144 | Attine Ant Fungus Gardens | ALLEGRSVRYPIWGTWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0153996_10870691 | 3300012144 | Attine Ant Fungus Gardens | ALLEGRSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHN* |
Ga0153990_10210324 | 3300012169 | Attine Ant Fungus Gardens | SRALLEGRSVRNLIRGAWASVYEAYVAVVTAATLLLELDTQVHD* |
Ga0153990_10332222 | 3300012169 | Attine Ant Fungus Gardens | LPSRALLEGRSIRYPIRGAWASIYEAYVVVVTATTLLLELDAQVHD* |
Ga0153990_10400693 | 3300012169 | Attine Ant Fungus Gardens | SSRALLEGRSIRNLIWGAWASVYEAYVAVVTAATLLLELDTQVYD* |
Ga0153990_10560731 | 3300012169 | Attine Ant Fungus Gardens | RALLEGRSVRYPIRGAWASIYEVYVAVVTAATLLLELDAQVHD* |
Ga0153990_10573601 | 3300012169 | Attine Ant Fungus Gardens | IRYPIRGTWASVYEVYVAVVTAATLLLELDAQVHN* |
Ga0153990_10653202 | 3300012169 | Attine Ant Fungus Gardens | RYLIRGTWASIYEAYVAVVTAATLLLELNAQVYD* |
Ga0153990_11169882 | 3300012169 | Attine Ant Fungus Gardens | RYPIRGAWASVYEVYVAVVTAATLLLKLDAQVHD* |
Ga0153974_10237741 | 3300012180 | Attine Ant Fungus Gardens | RSVRYPIRGAWASIYEAYVAVVTAATLLLELDAQVHD* |
Ga0153974_10324621 | 3300012180 | Attine Ant Fungus Gardens | PSRALLEGRSIRYPIRGAWASIYEAYVVVVTATTLLLELDAQVHD* |
Ga0153974_10376151 | 3300012180 | Attine Ant Fungus Gardens | RYPIRGAWASVYEVYVAVVTAATLLLELDAQVHN* |
Ga0153974_10754402 | 3300012180 | Attine Ant Fungus Gardens | RALLEGRSVRYLIRGAWASVHEAYVAVVTAATLLLELDAQVHD* |
Ga0153974_10810401 | 3300012180 | Attine Ant Fungus Gardens | LLEGRSVRYLIRGAWASVYEVYVAVVTAATLLLELDAQVHD* |
Ga0153974_11362481 | 3300012180 | Attine Ant Fungus Gardens | ALLEGRSIRYPIRGAWASVYEVYVVVVTAATLLLELDAQVHD* |
Ga0153962_10453643 | 3300012674 | Attine Ant Fungus Gardens | ALLEGRSIRNLIRGAWASVYEVYVAVVTAATLLLELNTQVHD* |
Ga0153962_10591792 | 3300012674 | Attine Ant Fungus Gardens | SVLSSFPPLGALLEGRSVRYPIWGAWASVYEVYVAVVTATTLLLELDAQVYD* |
Ga0157362_12105611 | 3300012998 | Fungus Garden | EGRSIRNPIRGAWVSVYEAYVAVVTAATLLLELDTQVHN* |
Ga0157363_11258684 | 3300012999 | Fungus Garden | ALSLFPPSRALLEGRSVRNPIWGTWVSVYEAYVAVVTAATLLLKLDTQVHN* |
Ga0157360_10026652 | 3300013000 | Fungus Garden | MKFVTLPSSRALLERKSIGNLIRGTWASVYEAYVMVVTAAILLLKLDAQVHD* |
Ga0157360_10123741 | 3300013000 | Fungus Garden | MDPIRGAWASVYEAYIVVVTAATLLLELDAQVHD* |
Ga0157360_10974011 | 3300013000 | Fungus Garden | RALLEGRSFRNLIRSAWASVYEAYVAVVIAATLLLELGTQVHN* |
Ga0157360_11753971 | 3300013000 | Fungus Garden | LPSSRALLEGKFIRNSIRGTWASVYEAYVAVVTAATLLLELDAQVHD* |
Ga0157360_12343261 | 3300013000 | Fungus Garden | EGRSIRNTIQGAWASVYEAYVAVVTAATLLLKLGAQVHN* |
Ga0157365_101688652 | 3300013001 | Fungus Garden | SALSSFPPSRALLEGRSVGNLIRGAWVSVYETYVAVVTAATLLLELDTQVHD* |
Ga0157365_102774071 | 3300013001 | Fungus Garden | PLRALLEGRSVRNPIRGAWASVYKAYIVVVIAATLLLELDA* |
Ga0157364_10264667 | 3300013002 | Fungus Garden | LEGRSIRYPIRGAWASVYEVYVAVIAAATLLLELDAQVHD* |
Ga0157364_10660672 | 3300013002 | Fungus Garden | LEGKSIRYPIQGTWESIYEAYVAVVTATTLLLELDAQVHD* |
Ga0157364_11213743 | 3300013002 | Fungus Garden | LSLLPSSRALLEGKSIRNLIQSTWASVYEVYVAVVIAATLLLELDAQVHD* |
⦗Top⦘ |