| Basic Information | |
|---|---|
| Family ID | F025885 |
| Family Type | Metagenome |
| Number of Sequences | 200 |
| Average Sequence Length | 41 residues |
| Representative Sequence | MSDNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Number of Associated Samples | 164 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.50 % |
| % of genes near scaffold ends (potentially truncated) | 15.50 % |
| % of genes from short scaffolds (< 2000 bps) | 79.00 % |
| Associated GOLD sequencing projects | 152 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.39 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (79.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (18.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 49.28% β-sheet: 0.00% Coil/Unstructured: 50.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.39 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF12867 | DinB_2 | 33.00 |
| PF07857 | TMEM144 | 14.50 |
| PF06800 | Sugar_transport | 13.50 |
| PF13472 | Lipase_GDSL_2 | 2.50 |
| PF13620 | CarboxypepD_reg | 2.50 |
| PF13618 | Gluconate_2-dh3 | 2.00 |
| PF11528 | DUF3224 | 1.50 |
| PF07676 | PD40 | 1.00 |
| PF14905 | OMP_b-brl_3 | 1.00 |
| PF00355 | Rieske | 1.00 |
| PF04264 | YceI | 1.00 |
| PF13426 | PAS_9 | 1.00 |
| PF00775 | Dioxygenase_C | 0.50 |
| PF08281 | Sigma70_r4_2 | 0.50 |
| PF13360 | PQQ_2 | 0.50 |
| PF09335 | SNARE_assoc | 0.50 |
| PF01408 | GFO_IDH_MocA | 0.50 |
| PF02447 | GntP_permease | 0.50 |
| PF01245 | Ribosomal_L19 | 0.50 |
| PF01266 | DAO | 0.50 |
| PF04397 | LytTR | 0.50 |
| PF02882 | THF_DHG_CYH_C | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG4975 | Glucose uptake protein GlcU | Carbohydrate transport and metabolism [G] | 13.50 |
| COG2353 | Polyisoprenoid-binding periplasmic protein YceI | General function prediction only [R] | 1.00 |
| COG2610 | H+/gluconate symporter GntT or related permease, GntP/DsdX family | Carbohydrate transport and metabolism [G] | 1.00 |
| COG0190 | 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase | Coenzyme transport and metabolism [H] | 0.50 |
| COG0335 | Ribosomal protein L19 | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0398 | Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 family | Function unknown [S] | 0.50 |
| COG0586 | Membrane integrity protein DedA, putative transporter, DedA/Tvp38 family | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG0686 | Alanine dehydrogenase (includes sporulation protein SpoVN) | Amino acid transport and metabolism [E] | 0.50 |
| COG1238 | Uncharacterized membrane protein YqaA, VTT domain | Function unknown [S] | 0.50 |
| COG3485 | Protocatechuate 3,4-dioxygenase beta subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 79.00 % |
| Unclassified | root | N/A | 21.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2088090004|P1_DRAFT_NODE_311315_len_3949_cov_13_065840 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 3999 | Open in IMG/M |
| 2124908044|A5_c1_ConsensusfromContig46130 | All Organisms → cellular organisms → Bacteria | 1353 | Open in IMG/M |
| 2140918007|ConsensusfromContig56311 | All Organisms → cellular organisms → Bacteria | 4949 | Open in IMG/M |
| 2162886012|MBSR1b_contig_8365174 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 809 | Open in IMG/M |
| 2170459004|F62QY1Z01C50W3 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300000878|AL9A1W_1014717 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1502 | Open in IMG/M |
| 3300000880|AL20A1W_1048813 | All Organisms → cellular organisms → Bacteria | 1453 | Open in IMG/M |
| 3300000887|AL16A1W_10005864 | Not Available | 534 | Open in IMG/M |
| 3300000956|JGI10216J12902_101874105 | All Organisms → cellular organisms → Bacteria | 3361 | Open in IMG/M |
| 3300001305|C688J14111_10122567 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 795 | Open in IMG/M |
| 3300001361|A30PFW6_1115112 | Not Available | 532 | Open in IMG/M |
| 3300001417|JGI20196J14858_1018936 | Not Available | 581 | Open in IMG/M |
| 3300001538|A10PFW1_12292818 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 767 | Open in IMG/M |
| 3300001565|A35518A_1042693 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1198 | Open in IMG/M |
| 3300001686|C688J18823_10008475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6635 | Open in IMG/M |
| 3300002907|JGI25613J43889_10112178 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 694 | Open in IMG/M |
| 3300004114|Ga0062593_100484784 | Not Available | 1140 | Open in IMG/M |
| 3300004114|Ga0062593_103094144 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 532 | Open in IMG/M |
| 3300004156|Ga0062589_100752513 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 874 | Open in IMG/M |
| 3300005093|Ga0062594_103256687 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 509 | Open in IMG/M |
| 3300005175|Ga0066673_10170990 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300005178|Ga0066688_10055666 | All Organisms → cellular organisms → Bacteria | 2303 | Open in IMG/M |
| 3300005181|Ga0066678_10471375 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 835 | Open in IMG/M |
| 3300005184|Ga0066671_10941696 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 545 | Open in IMG/M |
| 3300005187|Ga0066675_11093249 | Not Available | 596 | Open in IMG/M |
| 3300005293|Ga0065715_10372002 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300005327|Ga0070658_10013738 | All Organisms → cellular organisms → Bacteria | 6498 | Open in IMG/M |
| 3300005336|Ga0070680_100994793 | Not Available | 724 | Open in IMG/M |
| 3300005337|Ga0070682_100113808 | Not Available | 1807 | Open in IMG/M |
| 3300005337|Ga0070682_100843143 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300005339|Ga0070660_100656784 | All Organisms → cellular organisms → Bacteria | 878 | Open in IMG/M |
| 3300005344|Ga0070661_100083826 | All Organisms → cellular organisms → Bacteria | 2355 | Open in IMG/M |
| 3300005434|Ga0070709_11038537 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300005437|Ga0070710_10417279 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300005440|Ga0070705_101714653 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
| 3300005446|Ga0066686_10576441 | Not Available | 765 | Open in IMG/M |
| 3300005451|Ga0066681_10465541 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300005518|Ga0070699_101268551 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005536|Ga0070697_100511494 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1051 | Open in IMG/M |
| 3300005536|Ga0070697_100540253 | All Organisms → cellular organisms → Bacteria | 1021 | Open in IMG/M |
| 3300005536|Ga0070697_101717503 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 561 | Open in IMG/M |
| 3300005544|Ga0070686_100923253 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005545|Ga0070695_100190184 | All Organisms → cellular organisms → Bacteria | 1460 | Open in IMG/M |
| 3300005546|Ga0070696_101451724 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 586 | Open in IMG/M |
| 3300005561|Ga0066699_10043651 | All Organisms → cellular organisms → Bacteria | 2705 | Open in IMG/M |
| 3300005566|Ga0066693_10043207 | All Organisms → cellular organisms → Bacteria | 1478 | Open in IMG/M |
| 3300005566|Ga0066693_10226755 | Not Available | 735 | Open in IMG/M |
| 3300005575|Ga0066702_10067160 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1972 | Open in IMG/M |
| 3300006876|Ga0079217_10167166 | All Organisms → cellular organisms → Bacteria | 1086 | Open in IMG/M |
| 3300006918|Ga0079216_10010799 | All Organisms → cellular organisms → Bacteria | 3108 | Open in IMG/M |
| 3300006954|Ga0079219_12234464 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300007255|Ga0099791_10137544 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1137 | Open in IMG/M |
| 3300007258|Ga0099793_10127368 | Not Available | 1195 | Open in IMG/M |
| 3300007258|Ga0099793_10256817 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300007265|Ga0099794_10424132 | Not Available | 696 | Open in IMG/M |
| 3300007788|Ga0099795_10067735 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1340 | Open in IMG/M |
| 3300007788|Ga0099795_10097261 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1150 | Open in IMG/M |
| 3300007821|Ga0104323_112108 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1237 | Open in IMG/M |
| 3300007821|Ga0104323_128682 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2596 | Open in IMG/M |
| 3300009012|Ga0066710_100180605 | All Organisms → cellular organisms → Bacteria | 2981 | Open in IMG/M |
| 3300009029|Ga0066793_10035387 | All Organisms → cellular organisms → Bacteria | 2793 | Open in IMG/M |
| 3300009029|Ga0066793_10791734 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 538 | Open in IMG/M |
| 3300009038|Ga0099829_10675508 | Not Available | 858 | Open in IMG/M |
| 3300009093|Ga0105240_10589521 | Not Available | 1225 | Open in IMG/M |
| 3300009137|Ga0066709_100392938 | All Organisms → cellular organisms → Bacteria | 1921 | Open in IMG/M |
| 3300009137|Ga0066709_100716086 | All Organisms → cellular organisms → Bacteria | 1441 | Open in IMG/M |
| 3300009143|Ga0099792_10099204 | All Organisms → cellular organisms → Bacteria | 1526 | Open in IMG/M |
| 3300009143|Ga0099792_10116469 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300009609|Ga0105347_1417041 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 579 | Open in IMG/M |
| 3300009678|Ga0105252_10258552 | All Organisms → cellular organisms → Bacteria | 764 | Open in IMG/M |
| 3300010044|Ga0126310_11018806 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 653 | Open in IMG/M |
| 3300010329|Ga0134111_10563192 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 507 | Open in IMG/M |
| 3300010399|Ga0134127_10636233 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1100 | Open in IMG/M |
| 3300011269|Ga0137392_10693747 | Not Available | 843 | Open in IMG/M |
| 3300011271|Ga0137393_11167269 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 654 | Open in IMG/M |
| 3300011991|Ga0120153_1006758 | All Organisms → cellular organisms → Bacteria | 3432 | Open in IMG/M |
| 3300011991|Ga0120153_1024358 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1321 | Open in IMG/M |
| 3300011998|Ga0120114_1058009 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 754 | Open in IMG/M |
| 3300012019|Ga0120139_1009967 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 2193 | Open in IMG/M |
| 3300012198|Ga0137364_10002131 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 9812 | Open in IMG/M |
| 3300012200|Ga0137382_11053825 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 582 | Open in IMG/M |
| 3300012201|Ga0137365_10172737 | Not Available | 1620 | Open in IMG/M |
| 3300012202|Ga0137363_10535316 | All Organisms → cellular organisms → Bacteria | 986 | Open in IMG/M |
| 3300012203|Ga0137399_10055141 | All Organisms → cellular organisms → Bacteria | 2908 | Open in IMG/M |
| 3300012207|Ga0137381_10954207 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 740 | Open in IMG/M |
| 3300012208|Ga0137376_11016296 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012210|Ga0137378_11861298 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 504 | Open in IMG/M |
| 3300012211|Ga0137377_10012369 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7248 | Open in IMG/M |
| 3300012211|Ga0137377_11316445 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 653 | Open in IMG/M |
| 3300012212|Ga0150985_109485942 | Not Available | 639 | Open in IMG/M |
| 3300012356|Ga0137371_10054448 | All Organisms → cellular organisms → Bacteria | 3095 | Open in IMG/M |
| 3300012683|Ga0137398_10127212 | All Organisms → cellular organisms → Bacteria | 1634 | Open in IMG/M |
| 3300012683|Ga0137398_10594783 | Not Available | 765 | Open in IMG/M |
| 3300012917|Ga0137395_10163188 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300012925|Ga0137419_10046558 | All Organisms → cellular organisms → Bacteria | 2773 | Open in IMG/M |
| 3300012927|Ga0137416_11481648 | Not Available | 616 | Open in IMG/M |
| 3300012958|Ga0164299_11240939 | Not Available | 566 | Open in IMG/M |
| 3300012989|Ga0164305_10502079 | All Organisms → cellular organisms → Bacteria | 954 | Open in IMG/M |
| 3300012989|Ga0164305_11513215 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 596 | Open in IMG/M |
| 3300012989|Ga0164305_12122769 | Not Available | 515 | Open in IMG/M |
| 3300013104|Ga0157370_11495551 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 607 | Open in IMG/M |
| 3300013105|Ga0157369_12271107 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 550 | Open in IMG/M |
| 3300013294|Ga0120150_1032098 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300013307|Ga0157372_10610904 | All Organisms → cellular organisms → Bacteria | 1271 | Open in IMG/M |
| 3300013503|Ga0120127_10000215 | All Organisms → cellular organisms → Bacteria | 13504 | Open in IMG/M |
| 3300013503|Ga0120127_10028183 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1036 | Open in IMG/M |
| 3300013764|Ga0120111_1002560 | All Organisms → cellular organisms → Bacteria | 6946 | Open in IMG/M |
| 3300014031|Ga0120173_1065167 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 522 | Open in IMG/M |
| 3300014052|Ga0120109_1072309 | Not Available | 787 | Open in IMG/M |
| 3300014056|Ga0120125_1103921 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 666 | Open in IMG/M |
| 3300014829|Ga0120104_1030480 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 982 | Open in IMG/M |
| 3300015162|Ga0167653_1076436 | Not Available | 548 | Open in IMG/M |
| 3300015190|Ga0167651_1009742 | All Organisms → cellular organisms → Bacteria | 2170 | Open in IMG/M |
| 3300015193|Ga0167668_1000126 | All Organisms → cellular organisms → Bacteria | 12494 | Open in IMG/M |
| 3300015195|Ga0167658_1029821 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1446 | Open in IMG/M |
| 3300015242|Ga0137412_10394849 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1071 | Open in IMG/M |
| 3300018027|Ga0184605_10143449 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300018076|Ga0184609_10167898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1015 | Open in IMG/M |
| 3300018482|Ga0066669_10019681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 3736 | Open in IMG/M |
| 3300019865|Ga0193748_1002198 | All Organisms → cellular organisms → Bacteria | 1385 | Open in IMG/M |
| 3300019868|Ga0193720_1006674 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1587 | Open in IMG/M |
| 3300019874|Ga0193744_1037446 | Not Available | 922 | Open in IMG/M |
| 3300019877|Ga0193722_1010825 | All Organisms → cellular organisms → Bacteria | 2320 | Open in IMG/M |
| 3300019879|Ga0193723_1042246 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300019879|Ga0193723_1080370 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 935 | Open in IMG/M |
| 3300019881|Ga0193707_1028583 | All Organisms → cellular organisms → Bacteria | 1826 | Open in IMG/M |
| 3300019881|Ga0193707_1119175 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300019882|Ga0193713_1054998 | All Organisms → cellular organisms → Bacteria | 1141 | Open in IMG/M |
| 3300019885|Ga0193747_1054476 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300019886|Ga0193727_1000869 | All Organisms → cellular organisms → Bacteria | 12279 | Open in IMG/M |
| 3300019886|Ga0193727_1026979 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1995 | Open in IMG/M |
| 3300019886|Ga0193727_1180882 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 542 | Open in IMG/M |
| 3300019887|Ga0193729_1016807 | All Organisms → cellular organisms → Bacteria | 3211 | Open in IMG/M |
| 3300019888|Ga0193751_1014039 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 4124 | Open in IMG/M |
| 3300019890|Ga0193728_1112754 | Not Available | 1242 | Open in IMG/M |
| 3300020001|Ga0193731_1109857 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300020002|Ga0193730_1085381 | All Organisms → cellular organisms → Bacteria | 889 | Open in IMG/M |
| 3300020012|Ga0193732_1001454 | All Organisms → cellular organisms → Bacteria | 4312 | Open in IMG/M |
| 3300020021|Ga0193726_1002367 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 12874 | Open in IMG/M |
| 3300020061|Ga0193716_1010469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 4773 | Open in IMG/M |
| 3300020202|Ga0196964_10625339 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
| 3300021080|Ga0210382_10190160 | Not Available | 890 | Open in IMG/M |
| 3300021363|Ga0193699_10017032 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 2630 | Open in IMG/M |
| 3300021363|Ga0193699_10030329 | All Organisms → cellular organisms → Bacteria | 2022 | Open in IMG/M |
| 3300021363|Ga0193699_10178344 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300021363|Ga0193699_10322121 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 644 | Open in IMG/M |
| 3300022756|Ga0222622_10760940 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300024330|Ga0137417_1158557 | All Organisms → cellular organisms → Bacteria | 1723 | Open in IMG/M |
| 3300025324|Ga0209640_10128507 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
| 3300025457|Ga0208850_1000009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 94761 | Open in IMG/M |
| 3300025579|Ga0207927_1047731 | Not Available | 1119 | Open in IMG/M |
| 3300025905|Ga0207685_10732455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300025909|Ga0207705_10115968 | All Organisms → cellular organisms → Bacteria | 1983 | Open in IMG/M |
| 3300025910|Ga0207684_10159641 | All Organisms → cellular organisms → Bacteria | 1941 | Open in IMG/M |
| 3300025912|Ga0207707_10403709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1173 | Open in IMG/M |
| 3300025917|Ga0207660_10533307 | Not Available | 954 | Open in IMG/M |
| 3300025921|Ga0207652_10259986 | All Organisms → cellular organisms → Bacteria | 1566 | Open in IMG/M |
| 3300025931|Ga0207644_10503490 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 999 | Open in IMG/M |
| 3300025949|Ga0207667_10126338 | All Organisms → cellular organisms → Bacteria | 2634 | Open in IMG/M |
| 3300026316|Ga0209155_1140305 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300026320|Ga0209131_1040218 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300026330|Ga0209473_1133150 | Not Available | 1023 | Open in IMG/M |
| 3300026331|Ga0209267_1134100 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300026538|Ga0209056_10262542 | Not Available | 1219 | Open in IMG/M |
| 3300026542|Ga0209805_1115509 | Not Available | 1272 | Open in IMG/M |
| 3300026548|Ga0209161_10176427 | Not Available | 1211 | Open in IMG/M |
| 3300027587|Ga0209220_1060374 | Not Available | 1009 | Open in IMG/M |
| 3300027587|Ga0209220_1080062 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 863 | Open in IMG/M |
| 3300027637|Ga0209818_1296237 | Not Available | 500 | Open in IMG/M |
| 3300027645|Ga0209117_1156958 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 592 | Open in IMG/M |
| 3300027651|Ga0209217_1079688 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 953 | Open in IMG/M |
| 3300027674|Ga0209118_1086539 | Not Available | 894 | Open in IMG/M |
| 3300027678|Ga0209011_1083009 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300027681|Ga0208991_1223650 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 540 | Open in IMG/M |
| 3300027681|Ga0208991_1225379 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 537 | Open in IMG/M |
| 3300027738|Ga0208989_10146467 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 794 | Open in IMG/M |
| 3300027903|Ga0209488_10110099 | All Organisms → cellular organisms → Bacteria | 2068 | Open in IMG/M |
| 3300027903|Ga0209488_10745395 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
| 3300028047|Ga0209526_10134643 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300028536|Ga0137415_10084795 | All Organisms → cellular organisms → Bacteria | 3025 | Open in IMG/M |
| 3300028709|Ga0307279_10061128 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 636 | Open in IMG/M |
| 3300028881|Ga0307277_10107763 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1186 | Open in IMG/M |
| 3300028881|Ga0307277_10355318 | Not Available | 653 | Open in IMG/M |
| 3300028885|Ga0307304_10551720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 531 | Open in IMG/M |
| 3300031740|Ga0307468_102105116 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 543 | Open in IMG/M |
| 3300031938|Ga0308175_100014976 | All Organisms → cellular organisms → Bacteria | 5991 | Open in IMG/M |
| 3300031938|Ga0308175_100324207 | All Organisms → cellular organisms → Bacteria | 1581 | Open in IMG/M |
| 3300031938|Ga0308175_101157780 | Not Available | 859 | Open in IMG/M |
| 3300031938|Ga0308175_101492361 | Not Available | 755 | Open in IMG/M |
| 3300031938|Ga0308175_102668675 | Not Available | 559 | Open in IMG/M |
| 3300031938|Ga0308175_102907004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 534 | Open in IMG/M |
| 3300031939|Ga0308174_10409591 | Not Available | 1093 | Open in IMG/M |
| 3300031939|Ga0308174_10563539 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300032074|Ga0308173_12038527 | Not Available | 541 | Open in IMG/M |
| 3300032180|Ga0307471_101551754 | Not Available | 819 | Open in IMG/M |
| 3300033412|Ga0310810_10007050 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 12769 | Open in IMG/M |
| 3300034268|Ga0372943_0018682 | Not Available | 3675 | Open in IMG/M |
| 3300034268|Ga0372943_0094762 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1746 | Open in IMG/M |
| 3300034384|Ga0372946_0153233 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS231 | 1101 | Open in IMG/M |
| 3300034384|Ga0372946_0271587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | 821 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 18.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 16.00% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 9.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.50% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.50% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.50% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2088090004 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1 | Environmental | Open in IMG/M |
| 2124908044 | Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5 | Environmental | Open in IMG/M |
| 2140918007 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_all | Environmental | Open in IMG/M |
| 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
| 3300000878 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000880 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001361 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illumina | Environmental | Open in IMG/M |
| 3300001417 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012 | Environmental | Open in IMG/M |
| 3300001538 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illumina | Environmental | Open in IMG/M |
| 3300001565 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-5cm-18A)- 1 week illumina new | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005187 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 | Environmental | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Environmental | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
| 3300006918 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009678 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300011991 | Permafrost microbial communities from Nunavut, Canada - A34_65cm_12M | Environmental | Open in IMG/M |
| 3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
| 3300012019 | Permafrost microbial communities from Nunavut, Canada - A7_5cm_12M | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013503 | Permafrost microbial communities from Nunavut, Canada - A23_5cm_12M | Environmental | Open in IMG/M |
| 3300013764 | Permafrost microbial communities from Nunavut, Canada - A28_35cm_6M | Environmental | Open in IMG/M |
| 3300014031 | Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25M | Environmental | Open in IMG/M |
| 3300014052 | Permafrost microbial communities from Nunavut, Canada - A23_35cm_12M | Environmental | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300015162 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015190 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface) | Environmental | Open in IMG/M |
| 3300015193 | Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream) | Environmental | Open in IMG/M |
| 3300015195 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
| 3300019868 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1 | Environmental | Open in IMG/M |
| 3300019874 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1 | Environmental | Open in IMG/M |
| 3300019877 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1 | Environmental | Open in IMG/M |
| 3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
| 3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020012 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1 | Environmental | Open in IMG/M |
| 3300020021 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1 | Environmental | Open in IMG/M |
| 3300020061 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025457 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025579 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026316 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes) | Environmental | Open in IMG/M |
| 3300026320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026330 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027637 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028709 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034384 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| P1_DRAFT_01012390 | 2088090004 | Soil | MSDNRREQQSSSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| A5_c1_00066380 | 2124908044 | Soil | MSDNRREQRSGSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS |
| A_all_C_00835670 | 2140918007 | Soil | MTDDRREQHSRSWLGLVLSDVQFWVPVAVLIGGLLVLRWIS |
| MBSR1b_0557.00006880 | 2162886012 | Miscanthus Rhizosphere | MTDNRRGEPSGSWLGLVLRDVQFWVPVAVLLAGLLVLRWISS |
| E4B_00035140 | 2170459004 | Grass Soil | MTDNRRGQTSGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS |
| AL9A1W_10147173 | 3300000878 | Permafrost | MSDDRREQNSGNWLDLVLRDVQFWVPVAVLAGGLLVLRWIS* |
| AL20A1W_10488132 | 3300000880 | Permafrost | MSDNRREQRSGSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS* |
| AL16A1W_100058642 | 3300000887 | Permafrost | MSDNRREQYSDSWLGLVLRDVQFWVPVAVLLGGLLVLRWIS* |
| JGI10216J12902_1018741055 | 3300000956 | Soil | MSEDRREQETSNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| C688J14111_101225672 | 3300001305 | Soil | MADDVEDKSGGWVGLVLRDAQFWVPVVVLVAGLLVLRWIS* |
| A30PFW6_11151121 | 3300001361 | Permafrost | EQYSDSWLGLVLRDVQFWVPVAVLLGGLLVLRWIS* |
| JGI20196J14858_10189362 | 3300001417 | Arctic Peat Soil | DNRREQQSSSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS* |
| A10PFW1_122928181 | 3300001538 | Permafrost | MSDNRREQHSGTWLGLVLRDVQFWVPVAVLLGGLLVLRWIS* |
| A35518A_10426932 | 3300001565 | Permafrost | MTDNRRGQTSSSWLGLVLRDIQFWVPVAVLVGGLLVLRWISS* |
| C688J18823_100084755 | 3300001686 | Soil | MSEDVEQKSGNWLGLVLRDAQFWVPVIVLAAGLLVLRWIS* |
| JGI25613J43889_101121782 | 3300002907 | Grasslands Soil | MSNNRREQHSGNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0062593_1004847842 | 3300004114 | Soil | MTTDSREQRRPHWWSLVLKDVQFWVPVAVLCAGLLVLGWIQ* |
| Ga0062593_1030941442 | 3300004114 | Soil | MSDNQREQPSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0062589_1007525132 | 3300004156 | Soil | MSNDRREQHSGNWLGLVLRDVQFWVPVAVLIGGLLVLRWIS* |
| Ga0062594_1032566871 | 3300005093 | Soil | MTDNRRGEPSGSWLGLVLRDVQFWVPVAVLLAGLLVLRWISS* |
| Ga0066673_101709902 | 3300005175 | Soil | MADNRRELQPHAWLGLVLRDVHFWVPVAVLVGGLLVLRWIS* |
| Ga0066688_100556664 | 3300005178 | Soil | MSDDRRERHSGSWAGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0066678_104713751 | 3300005181 | Soil | VNDRHQEQHTRGLLGLVLRDATFWIPVVVLIGGLLVLRWIR* |
| Ga0066671_109416962 | 3300005184 | Soil | MIDDRDRKSSNWLSLVLRDVQFWVPVAVLAAGLLVLRWIS* |
| Ga0066675_110932492 | 3300005187 | Soil | HAAERPMAEDSKQSSRSWLNLVLRDVQFWVPVAVLVAGLIVLRWIS* |
| Ga0065715_103720022 | 3300005293 | Miscanthus Rhizosphere | MTDDRGQRDGGWVSLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0070658_100137387 | 3300005327 | Corn Rhizosphere | MENVRREPASPGWISLVLRDVQFWVPVIVLAAGLLVLRWIS* |
| Ga0070680_1009947932 | 3300005336 | Corn Rhizosphere | MSEDSAHNSRSWLGLVLRDAQFWVPVAVLIAGLLVLRWIS* |
| Ga0070682_1001138082 | 3300005337 | Corn Rhizosphere | CQERGMTDNRRGEPSGSWLGLVLRDVQFWVPVAVLLAGLLVLRWISS* |
| Ga0070682_1008431432 | 3300005337 | Corn Rhizosphere | MTEDSEQNSRSWLSLALRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0070660_1006567842 | 3300005339 | Corn Rhizosphere | VSTMPDGRRGWLALVIRDVQFWVPVIVLAAGLLVLRWIS* |
| Ga0070661_1000838262 | 3300005344 | Corn Rhizosphere | MPDDRSEQPGSWINLVLQDLQFWVPVAVLVVGLIVLRWIS* |
| Ga0070709_110385372 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | MADDREQTSGWLSLVLRDVQFWVPVAVLAAGLIILRWIS* |
| Ga0070710_104172792 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEDSAHNSRSWLGLVLRDVQFWVPVAVLIAGLLVLRWIS* |
| Ga0070705_1017146531 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDNHREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0066686_105764412 | 3300005446 | Soil | MSDYRRERHSGSWAGLVLSDVQFWVPVAVLVAGLLVLRSIS* |
| Ga0066681_104655412 | 3300005451 | Soil | MSDDREHHTDSWLSLVLRDAQFWVPVAVLVAGLLVLRWIS* |
| Ga0070699_1012685512 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDDRDPQSGSWVSLVLHDVQFWVPVAVLVAGLLILRWIS* |
| Ga0070697_1005114941 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPDDRDPQSGSWVSLVLRDVQFWVPVAVLVAGLLILRWIS* |
| Ga0070697_1005402532 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MTDDREQSSRSWLSLVVRDVQFWVPVAVLIAGLLILRWIS* |
| Ga0070697_1017175032 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0070686_1009232532 | 3300005544 | Switchgrass Rhizosphere | MRDVREQNTGSWLGLVLRDAQFWVPVGVLVAGLLVLRWIS* |
| Ga0070695_1001901842 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MADDREHASGWLSLVLRDVQFWVPVAVLVAGLIILRWIS* |
| Ga0070696_1014517242 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MTEDSEQNSRSWLSLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0066699_100436514 | 3300005561 | Soil | MADDRKQVSASWLSLVLRDVQFWVPVAVLVAGLLILRWIS* |
| Ga0066693_100432073 | 3300005566 | Soil | MAEDSKQSSRSWLNLVLRDVQFWVPVAVLVAGLIVLRWIS* |
| Ga0066693_102267551 | 3300005566 | Soil | PKSSNWLGLVLRDVQFWVPVAVLAAGLLVLRWIS* |
| Ga0066702_100671602 | 3300005575 | Soil | MTDQREPDSRSWLSLVLSDVQFWVPVLVLVAGLLVLRWIS* |
| Ga0079217_101671662 | 3300006876 | Agricultural Soil | MPDARREQRSWLSVILTDIHFWVPVAVLAGGLLVLRWIS* |
| Ga0079216_100107991 | 3300006918 | Agricultural Soil | CPSTDYSRTSAMPDARREQRSWLSVILTDIHFWVPVAVLAGGLLVLRWIS* |
| Ga0079219_122344642 | 3300006954 | Agricultural Soil | VTEMPDGRRGWLALVIRDVQFWVPVIVLVAGLLVLRWIA* |
| Ga0099791_101375442 | 3300007255 | Vadose Zone Soil | MSINRREQHSGNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0099793_101273682 | 3300007258 | Vadose Zone Soil | MSDDRREQQSGSWLGLVLSDVQFWVPVAVLAGGLLVLRWIS* |
| Ga0099793_102568172 | 3300007258 | Vadose Zone Soil | MSNNRREQHSGNWLGLVLRDVQVWVPVAVLVAGLLVLRWIS* |
| Ga0099794_104241321 | 3300007265 | Vadose Zone Soil | MSDDRREQQSGSWLGLVLRDVQFWVPVAVLVGGLLVLRWIS* |
| Ga0099795_100677352 | 3300007788 | Vadose Zone Soil | MTDNRRGQTLGSWLGLVLRDVQFWVPVAVLVAGLLVLRWISS* |
| Ga0099795_100972613 | 3300007788 | Vadose Zone Soil | MADNRRGQTLGSWLGLVLRDVQFWVSVAVLVGGLLVLRWISS* |
| Ga0104323_1121082 | 3300007821 | Soil | MSDNRREQQSSSWLGLVLRDLQFWVPVAVLAAGLLVLRWIS* |
| Ga0104323_1286822 | 3300007821 | Soil | MSDDREQHSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS* |
| Ga0066710_1001806055 | 3300009012 | Grasslands Soil | MSDDRRDRHSASWASLVLRDAQFWVPVGVLVAGLLVLRWIS |
| Ga0066793_100353873 | 3300009029 | Prmafrost Soil | MSDNRREQQSSSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS* |
| Ga0066793_107917342 | 3300009029 | Prmafrost Soil | MNDHRPEQRSRHWLSLVLHDVQFWVPVAVLCGGLLVLAWIR* |
| Ga0099829_106755082 | 3300009038 | Vadose Zone Soil | MSDNRREQDSGSWLVLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0105240_105895212 | 3300009093 | Corn Rhizosphere | EPSGSWLGLVLRDVQFWVPVAVLLAGLLVLRWISS* |
| Ga0066709_1003929381 | 3300009137 | Grasslands Soil | RREQQSGSWLGLVLHDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0066709_1007160862 | 3300009137 | Grasslands Soil | MSDYRRERHSGSWAGLVLSDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0099792_100992042 | 3300009143 | Vadose Zone Soil | MTDNRRGQTLGSWLGLVLRDVQFWVPVTVLVGGLLVLRWISS* |
| Ga0099792_101164692 | 3300009143 | Vadose Zone Soil | MADNRRGQTSGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS* |
| Ga0105347_14170411 | 3300009609 | Soil | MSDDEQRDHWMYLVLRDVQFWVPVVVLIGGLLVLRWIG* |
| Ga0105252_102585522 | 3300009678 | Soil | MTNGSKPPHWLAQVVRDVQFWIPVVVLIAGLLVLRWIA* |
| Ga0126310_110188062 | 3300010044 | Serpentine Soil | MSDDDRAKQSGSWATLVLTDVHFWVPIAVLIAGLVVLRWVS* |
| Ga0134111_105631921 | 3300010329 | Grasslands Soil | MSEDRREQQSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0134127_106362332 | 3300010399 | Terrestrial Soil | MTDDRGQRDDGWVSLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0137392_106937472 | 3300011269 | Vadose Zone Soil | MSDNRREHDSGSWLVLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0137393_111672692 | 3300011271 | Vadose Zone Soil | MNDDWPQHRGRSWLSLVLRDVQFWVPVAVLCGGLLVLGWIS* |
| Ga0120153_10067583 | 3300011991 | Permafrost | MSDNRREHSGTWLGLVLRDVQFWVPVAVLLGGLLVLRWIS* |
| Ga0120153_10243581 | 3300011991 | Permafrost | MSDNRREQRSGSWLGLVLRDVQFWVPVAVLAAGLLVL |
| Ga0120114_10580092 | 3300011998 | Permafrost | MSDDREQHSDSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS* |
| Ga0120139_10099672 | 3300012019 | Permafrost | MSDNRREQQGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0137364_100021316 | 3300012198 | Vadose Zone Soil | MADNRREQQPHAWLGLVLRDVHFWVPVAVLLGGLLVLRWIS* |
| Ga0137382_110538252 | 3300012200 | Vadose Zone Soil | MTDNRRGQTSGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS* |
| Ga0137365_101727371 | 3300012201 | Vadose Zone Soil | MSDDRRDRHHGSWASLVLRDMQFWVPVAVLVAGLLVLRWIS* |
| Ga0137363_105353162 | 3300012202 | Vadose Zone Soil | MRINRREQHSGNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0137399_100551414 | 3300012203 | Vadose Zone Soil | MSNNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0137381_109542071 | 3300012207 | Vadose Zone Soil | MPDDREQASASKLSLVVRDVQFWVPVAVLVAGLLILRWIS |
| Ga0137376_110162961 | 3300012208 | Vadose Zone Soil | MSDNRREQQSGSWLGLVLRDVQFWVPVGVLVAGLLVLRWIS* |
| Ga0137378_118612982 | 3300012210 | Vadose Zone Soil | MPDDREQASASKLSLVVRDVQFWVPVAVLIVGLLVLRWIS* |
| Ga0137377_100123694 | 3300012211 | Vadose Zone Soil | MSDDRREQDSGSWLGLVMRDVQFWVPVAVLIGGLLVLRWIS* |
| Ga0137377_113164452 | 3300012211 | Vadose Zone Soil | LRADRQEKPMTDDRGQHTGGWVGLVLRDVQFWVPVAVLIVGLLVLRWIS* |
| Ga0150985_1094859422 | 3300012212 | Avena Fatua Rhizosphere | NAMSDDVEQNSGSWWRLVLRDAQFWVPVVVLVAGLLVLRWIS* |
| Ga0137371_100544482 | 3300012356 | Vadose Zone Soil | MSEDRHEQQSGGWLGLVIRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0137398_101272123 | 3300012683 | Vadose Zone Soil | MSDNHHVQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0137398_105947831 | 3300012683 | Vadose Zone Soil | PMTDNRRGPTLGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS* |
| Ga0137395_101631884 | 3300012917 | Vadose Zone Soil | MSDNHREQHSGSWLGLVLRDVQFWVPVAVLVAGLIVLRWIS* |
| Ga0137419_100465582 | 3300012925 | Vadose Zone Soil | MSDDRRDPQTGSRLGLVLRDVHFWVPVAVLVGGLLVLRWIS* |
| Ga0137416_114816481 | 3300012927 | Vadose Zone Soil | REQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS* |
| Ga0164299_112409392 | 3300012958 | Soil | MDDVRRERASPGWISLVLRDVQFWVPVVVLAAGLLVLRWIS* |
| Ga0164305_105020792 | 3300012989 | Soil | LRADHAEERTLTDNRSERPRGWPSLVLRDPQFWVPVVVLVAGLLVLRWIS* |
| Ga0164305_115132152 | 3300012989 | Soil | MRDVRDQKTGSWLGLVLRDAQFWVPVGVLIAGLLVLRWIS* |
| Ga0164305_121227691 | 3300012989 | Soil | MDDVRRERGSPGWISLVLRDVQFWVPIIVLAAGLLVLRWIS* |
| Ga0157370_114955512 | 3300013104 | Corn Rhizosphere | MTDNRRGEPSGSWLGLVLRDVQFWVPLAVLLAGLLVLRWISS* |
| Ga0157369_122711071 | 3300013105 | Corn Rhizosphere | MPMPDARRGWLSLVIRDVQFWVPVIVLAAGLVVLRWIS* |
| Ga0120150_10320982 | 3300013294 | Permafrost | MSDNHREQYSDSWLGLVLRDVQFWVPVAVLLGGLLVLRWIS* |
| Ga0157372_106109042 | 3300013307 | Corn Rhizosphere | MPDGRRGWLALVIRDVQFWVPVIVLAAGLLVLRWIS* |
| Ga0120127_1000021513 | 3300013503 | Permafrost | MSDDREQQSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS* |
| Ga0120127_100281833 | 3300013503 | Permafrost | MTDNRRGQTSGSWLGLVLRDIQFWVPVAVLVGGLLVLRWISS* |
| Ga0120111_10025608 | 3300013764 | Permafrost | MSDNRHKQHSGSRLGLVLRDVQFWVPVAVLLGGLLVLRWIS* |
| Ga0120173_10651672 | 3300014031 | Permafrost | MSDNRHKQHSGSWLGLVLRDVQFWVPVAVLLGGLLVLRWIS* |
| Ga0120109_10723091 | 3300014052 | Permafrost | MGDDREAHSGGWLGLVLRDVQFWVPVAVLAAGLLVLRWIS* |
| Ga0120125_11039212 | 3300014056 | Permafrost | MTDNRRGQTSGSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS* |
| Ga0120104_10304803 | 3300014829 | Permafrost | MSDDREQHSGSWLGLVLRDVQFWVPVAVLAGGLLV |
| Ga0167653_10764362 | 3300015162 | Glacier Forefield Soil | MSDDREQHSGWLGLVLRDVQFWVPVAVLGGGLIVLRWIS* |
| Ga0167651_10097421 | 3300015190 | Glacier Forefield Soil | SMSDDREQHSGWLGLVLRDVQFWVPVAVLGVGLLVLRWIS* |
| Ga0167668_10001267 | 3300015193 | Glacier Forefield Soil | MGDDRREQHSGSWLGLVVRDVQFWVPVAVLAGGLLVLRWIS* |
| Ga0167658_10298212 | 3300015195 | Glacier Forefield Soil | MSDDREQHSGSWLGLVLLDVQFWVPVAVLAGGLLVLRWIS* |
| Ga0137412_103948491 | 3300015242 | Vadose Zone Soil | MTDNRRGQTLGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS* |
| Ga0184605_101434492 | 3300018027 | Groundwater Sediment | MNDSREQSSPGWLSLVLHDVQFWVPLAVLLGGLLVLRWIS |
| Ga0184609_101678982 | 3300018076 | Groundwater Sediment | MRQSRGWLGLVMRDVQFWVPVAVLIGGLLVLQWIR |
| Ga0066669_100196815 | 3300018482 | Grasslands Soil | MAEDSKQSSRSWLNLVLRDVQFWVPVAVLVAGLIVLRWIS |
| Ga0193748_10021982 | 3300019865 | Soil | MSDDREQQSGNWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0193720_10066742 | 3300019868 | Soil | MSDDREQQSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0193744_10374461 | 3300019874 | Soil | MTDNRRGQTSGSWLGLVLRDVQFWVPIAVLAGGLLVLRWISS |
| Ga0193722_10108252 | 3300019877 | Soil | MADNRRGQTSGSWLGLVLRDVQFWVPIAVLVGGLLVLRWISS |
| Ga0193723_10422462 | 3300019879 | Soil | MSDDQLNDNRRERPSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0193723_10803702 | 3300019879 | Soil | MRQSRNWLKLILRDAQFWVPVAVLAGGLLVLQWMH |
| Ga0193707_10285832 | 3300019881 | Soil | MTDNRRGQTSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWISS |
| Ga0193707_11191752 | 3300019881 | Soil | MSDNQREERSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0193713_10549982 | 3300019882 | Soil | MTDNRRGQASGSWLGLVLRDVQFWVPVAVLAGGLVVLRWISS |
| Ga0193747_10544762 | 3300019885 | Soil | MSEDRREQHSGGWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0193727_10008697 | 3300019886 | Soil | MSDNQREKRSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0193727_10269792 | 3300019886 | Soil | MTDNRRGQTSGSWLSLVLRDVQFWVPVAVLAGGLLVLRWISS |
| Ga0193727_11808822 | 3300019886 | Soil | MSDDQLSDNRRERPSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0193729_10168075 | 3300019887 | Soil | MSNNRREQRSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0193751_10140397 | 3300019888 | Soil | MSDDRREHNSGNWLGLVLRDAQFWVPVAVLAGGLLVLRWIS |
| Ga0193728_11127541 | 3300019890 | Soil | TNNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0193731_11098572 | 3300020001 | Soil | MSDHQLSDNRREQPSGGWRRDVQCWVPVAVLVAGLLVLRWIS |
| Ga0193730_10853812 | 3300020002 | Soil | MSDHQLSDNRREQPSGGWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0193732_10014544 | 3300020012 | Soil | MADNRRGQTSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWISS |
| Ga0193726_100236710 | 3300020021 | Soil | MSDNQREQPSGNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0193716_10104695 | 3300020061 | Soil | MSKDHREQHSGSWLGLVLRDVQFWVPVAVLIAGLLVLRWIS |
| Ga0196964_106253392 | 3300020202 | Soil | MPPSPNEQHGRSWVGLVVRDAQFWVPVAVLIGGLLVLNWIQ |
| Ga0210382_101901601 | 3300021080 | Groundwater Sediment | EQSSPGWLSLVLHDVQFWVPLAVLLGGLLVLRWIS |
| Ga0193699_100170321 | 3300021363 | Soil | MTDNRRGQTSGSWLGLVLRDVQFWVPVAVLMGGLLVLRWIS |
| Ga0193699_100303292 | 3300021363 | Soil | MSDNLREHKSGSWLGLVLRDVQFWVPVAVLIGGLLVLRWIS |
| Ga0193699_101783442 | 3300021363 | Soil | MSDDRREQNSGSRLGLVMRDVQFWVPVAVLIGGLLVLRWIS |
| Ga0193699_103221212 | 3300021363 | Soil | MSDDREQHSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0222622_107609402 | 3300022756 | Groundwater Sediment | MGDNQRERPTGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0137417_11585572 | 3300024330 | Vadose Zone Soil | MSNNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0209640_101285073 | 3300025324 | Soil | MNDDRREQHSRNWLGIVLQDVHFWVPVVVLVGGLLVLQWIR |
| Ga0208850_100000913 | 3300025457 | Arctic Peat Soil | MSDNRREQQSSSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS |
| Ga0207927_10477311 | 3300025579 | Arctic Peat Soil | NRREQQSSSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS |
| Ga0207685_107324552 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | MSEDSAHNSRSWLGLVLRDAQFWVPVAVLIAGLLVLRWIS |
| Ga0207705_101159682 | 3300025909 | Corn Rhizosphere | MPMPDARRGWLSLVIRDVQFWVPVIVLAAGLVVLRWIS |
| Ga0207684_101596412 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MSDNHREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0207707_104037092 | 3300025912 | Corn Rhizosphere | MTEDSEQNSRSWLSLALRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0207660_105333072 | 3300025917 | Corn Rhizosphere | DSAHNSRSWLGLVLRDAQFWVPVAVLIAGLLVLRWIS |
| Ga0207652_102599862 | 3300025921 | Corn Rhizosphere | MPDDRSEQPGSWINLVLRDLQFWVPVAVLVVGLIVLRWIS |
| Ga0207644_105034903 | 3300025931 | Switchgrass Rhizosphere | MRDVREQNTGSWLGLVLRDAQFWVPVGVLVAGLLVLRWIS |
| Ga0207667_101263382 | 3300025949 | Corn Rhizosphere | MTDNRRGEPSGSWLGLVLRDVQFWVPLAVLLAGLLVLRWISS |
| Ga0209155_11403052 | 3300026316 | Soil | MIDDRDRKSSNWLSLVLRDVQFWVPVAVLAAGLLVLRWIS |
| Ga0209131_10402183 | 3300026320 | Grasslands Soil | MSNNRREQHSGNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0209473_11331502 | 3300026330 | Soil | MIDDRDPKSSNWLGLVLRDVQFWVPVAVLAAGLLVLRWIS |
| Ga0209267_11341002 | 3300026331 | Soil | MTDDREQSSRSWLSLVVRDVQFWVPVAVLIAGLLILRWIS |
| Ga0209056_102625422 | 3300026538 | Soil | MSDYRRERHSGSWAGLVLSDVQFWVPVAVLVAGLLVLRWIS |
| Ga0209805_11155091 | 3300026542 | Soil | MADDRKQVSASWLSLVLRDVQFWVPVAVLVAGLLILRWIS |
| Ga0209161_101764272 | 3300026548 | Soil | SDDRRDRHSASWASLVLRDAQFWVPVGVLVAGLLVLRWIS |
| Ga0209220_10603741 | 3300027587 | Forest Soil | EQYSGNWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0209220_10800622 | 3300027587 | Forest Soil | MSDDREQQTGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0209818_12962372 | 3300027637 | Agricultural Soil | MPDARREQRSWLSVILTDIHFWVPVAVLVGGLLVLR |
| Ga0209117_11569581 | 3300027645 | Forest Soil | MSDDREKDSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0209217_10796882 | 3300027651 | Forest Soil | MSDDREQHSGSWLGLVLRDVQFWVPVAVLAGGLLVL |
| Ga0209118_10865392 | 3300027674 | Forest Soil | MSDDRREQYSGNWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0209011_10830092 | 3300027678 | Forest Soil | MSDDRREQHSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0208991_12236502 | 3300027681 | Forest Soil | MSDDREQQSGGWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0208991_12253792 | 3300027681 | Forest Soil | MSDNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0208989_101464672 | 3300027738 | Forest Soil | MSDDRREQQPGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS |
| Ga0209488_101100992 | 3300027903 | Vadose Zone Soil | MTDNRRGHTLGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS |
| Ga0209488_107453952 | 3300027903 | Vadose Zone Soil | VSDDRRDQHTGSRLGLVLRDVHFWVPIAVLIGGLLVLRWIS |
| Ga0209526_101346432 | 3300028047 | Forest Soil | MNDNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0137415_100847952 | 3300028536 | Vadose Zone Soil | MSDDRREQQSGSWLGLVLSDVQFWVPVAVLAGGLLVLRWIS |
| Ga0307279_100611281 | 3300028709 | Soil | MSDDREQQSGNWLGLVLRDVQFWVPVAVLAGGLLVLRW |
| Ga0307277_101077633 | 3300028881 | Soil | MSDDRRDQHTDSRLGLVLRDVHFWVPVAVLVAGLLVLRWIS |
| Ga0307277_103553181 | 3300028881 | Soil | TMSDDRRDQHTDSRLGLVLRDVHFWVPVAVLVAGLLVLRWIS |
| Ga0307304_105517202 | 3300028885 | Soil | HQLSDNRREQPSGGWLGLVLRDVQFWVPVAVLVAGLLVLRWIS |
| Ga0307468_1021051162 | 3300031740 | Hardwood Forest Soil | MTDDRGQRDSGWVSLILRDAQFWVPVAVLVAGLLVLRWIS |
| Ga0308175_1000149764 | 3300031938 | Soil | MDVRRDSASPSWISLVLRDVQFWVPVVVLAAGLLVLRWIS |
| Ga0308175_1003242072 | 3300031938 | Soil | MDDNRRGHTSPAWFSLVLRDVQFWVPVIVLAAGLLVLRWIA |
| Ga0308175_1011577801 | 3300031938 | Soil | VTAVPNVDRWLTLVLRDVQFWVPVIVLAAGLLVLHWIS |
| Ga0308175_1014923611 | 3300031938 | Soil | MSADSHEQRRPHWWSLVLRDVQFWVPVAVLCGGLLVLGWIQ |
| Ga0308175_1026686752 | 3300031938 | Soil | MTDARRDAGSPGWIALVLRDVQFWVPVVVLTAGLLVLRWIS |
| Ga0308175_1029070041 | 3300031938 | Soil | MTTDSREQRRPHWWSLVLKDVQFWVPVAVLCAGLLVLGWIQ |
| Ga0308174_104095911 | 3300031939 | Soil | EAGSPGWIALVLRDVQFWVPVVVLTAGLLVLRWIS |
| Ga0308174_105635392 | 3300031939 | Soil | MPDGRRGWLALVIRDVQFWVPVIVLVAGLLVLRWIS |
| Ga0308173_120385272 | 3300032074 | Soil | MDDNRRGHISPAWFSLVLRDVQFWVPVIVLAAGLLV |
| Ga0307471_1015517541 | 3300032180 | Hardwood Forest Soil | MSDNRREQHSGSWLGLVLRDVQFWVPLAVLVAGLLVLRWIS |
| Ga0310810_1000705010 | 3300033412 | Soil | MTDNRSGQTSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWISS |
| Ga0372943_0018682_2223_2342 | 3300034268 | Soil | MGDDDRKRVSWLPVLLRDVQFWVPVAVLIGGLLVLRWIS |
| Ga0372943_0094762_782_934 | 3300034268 | Soil | LPADRDEEQTLTDNRSERPKSWPGLVLRDPQFWVPVAVLAAGLIVLRWIS |
| Ga0372946_0153233_89_211 | 3300034384 | Soil | MDDSRSEPKSSWVALVVRDVQFWVPVVVLAAGLVVLRWIA |
| Ga0372946_0271587_199_324 | 3300034384 | Soil | MDDSRRDSRSRSWLALVLSDIQFWVPVIVLVAGLLVLRWIA |
| ⦗Top⦘ |