NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F025885

Metagenome Family F025885

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025885
Family Type Metagenome
Number of Sequences 200
Average Sequence Length 41 residues
Representative Sequence MSDNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Number of Associated Samples 164
Number of Associated Scaffolds 200

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.50 %
% of genes near scaffold ends (potentially truncated) 15.50 %
% of genes from short scaffolds (< 2000 bps) 79.00 %
Associated GOLD sequencing projects 152
AlphaFold2 3D model prediction Yes
3D model pTM-score0.39

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (79.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(18.000 % of family members)
Environment Ontology (ENVO) Unclassified
(35.500 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.500 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 49.28%    β-sheet: 0.00%    Coil/Unstructured: 50.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.39
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 200 Family Scaffolds
PF12867DinB_2 33.00
PF07857TMEM144 14.50
PF06800Sugar_transport 13.50
PF13472Lipase_GDSL_2 2.50
PF13620CarboxypepD_reg 2.50
PF13618Gluconate_2-dh3 2.00
PF11528DUF3224 1.50
PF07676PD40 1.00
PF14905OMP_b-brl_3 1.00
PF00355Rieske 1.00
PF04264YceI 1.00
PF13426PAS_9 1.00
PF00775Dioxygenase_C 0.50
PF08281Sigma70_r4_2 0.50
PF13360PQQ_2 0.50
PF09335SNARE_assoc 0.50
PF01408GFO_IDH_MocA 0.50
PF02447GntP_permease 0.50
PF01245Ribosomal_L19 0.50
PF01266DAO 0.50
PF04397LytTR 0.50
PF02882THF_DHG_CYH_C 0.50

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 200 Family Scaffolds
COG4975Glucose uptake protein GlcUCarbohydrate transport and metabolism [G] 13.50
COG2353Polyisoprenoid-binding periplasmic protein YceIGeneral function prediction only [R] 1.00
COG2610H+/gluconate symporter GntT or related permease, GntP/DsdX familyCarbohydrate transport and metabolism [G] 1.00
COG01905,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolaseCoenzyme transport and metabolism [H] 0.50
COG0335Ribosomal protein L19Translation, ribosomal structure and biogenesis [J] 0.50
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 0.50
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 0.50
COG0686Alanine dehydrogenase (includes sporulation protein SpoVN)Amino acid transport and metabolism [E] 0.50
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 0.50
COG3485Protocatechuate 3,4-dioxygenase beta subunitSecondary metabolites biosynthesis, transport and catabolism [Q] 0.50


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms79.00 %
UnclassifiedrootN/A21.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090004|P1_DRAFT_NODE_311315_len_3949_cov_13_065840All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae3999Open in IMG/M
2124908044|A5_c1_ConsensusfromContig46130All Organisms → cellular organisms → Bacteria1353Open in IMG/M
2140918007|ConsensusfromContig56311All Organisms → cellular organisms → Bacteria4949Open in IMG/M
2162886012|MBSR1b_contig_8365174All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium809Open in IMG/M
2170459004|F62QY1Z01C50W3All Organisms → cellular organisms → Bacteria509Open in IMG/M
3300000878|AL9A1W_1014717All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1502Open in IMG/M
3300000880|AL20A1W_1048813All Organisms → cellular organisms → Bacteria1453Open in IMG/M
3300000887|AL16A1W_10005864Not Available534Open in IMG/M
3300000956|JGI10216J12902_101874105All Organisms → cellular organisms → Bacteria3361Open in IMG/M
3300001305|C688J14111_10122567All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus795Open in IMG/M
3300001361|A30PFW6_1115112Not Available532Open in IMG/M
3300001417|JGI20196J14858_1018936Not Available581Open in IMG/M
3300001538|A10PFW1_12292818All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium767Open in IMG/M
3300001565|A35518A_1042693All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1198Open in IMG/M
3300001686|C688J18823_10008475All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6635Open in IMG/M
3300002907|JGI25613J43889_10112178All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium694Open in IMG/M
3300004114|Ga0062593_100484784Not Available1140Open in IMG/M
3300004114|Ga0062593_103094144All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium532Open in IMG/M
3300004156|Ga0062589_100752513All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium874Open in IMG/M
3300005093|Ga0062594_103256687All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium509Open in IMG/M
3300005175|Ga0066673_10170990All Organisms → cellular organisms → Bacteria1223Open in IMG/M
3300005178|Ga0066688_10055666All Organisms → cellular organisms → Bacteria2303Open in IMG/M
3300005181|Ga0066678_10471375All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium835Open in IMG/M
3300005184|Ga0066671_10941696All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium545Open in IMG/M
3300005187|Ga0066675_11093249Not Available596Open in IMG/M
3300005293|Ga0065715_10372002All Organisms → cellular organisms → Bacteria920Open in IMG/M
3300005327|Ga0070658_10013738All Organisms → cellular organisms → Bacteria6498Open in IMG/M
3300005336|Ga0070680_100994793Not Available724Open in IMG/M
3300005337|Ga0070682_100113808Not Available1807Open in IMG/M
3300005337|Ga0070682_100843143All Organisms → cellular organisms → Bacteria748Open in IMG/M
3300005339|Ga0070660_100656784All Organisms → cellular organisms → Bacteria878Open in IMG/M
3300005344|Ga0070661_100083826All Organisms → cellular organisms → Bacteria2355Open in IMG/M
3300005434|Ga0070709_11038537All Organisms → cellular organisms → Bacteria653Open in IMG/M
3300005437|Ga0070710_10417279All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300005440|Ga0070705_101714653All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium531Open in IMG/M
3300005446|Ga0066686_10576441Not Available765Open in IMG/M
3300005451|Ga0066681_10465541All Organisms → cellular organisms → Bacteria777Open in IMG/M
3300005518|Ga0070699_101268551All Organisms → cellular organisms → Bacteria676Open in IMG/M
3300005536|Ga0070697_100511494All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1051Open in IMG/M
3300005536|Ga0070697_100540253All Organisms → cellular organisms → Bacteria1021Open in IMG/M
3300005536|Ga0070697_101717503All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium561Open in IMG/M
3300005544|Ga0070686_100923253All Organisms → cellular organisms → Bacteria711Open in IMG/M
3300005545|Ga0070695_100190184All Organisms → cellular organisms → Bacteria1460Open in IMG/M
3300005546|Ga0070696_101451724All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium586Open in IMG/M
3300005561|Ga0066699_10043651All Organisms → cellular organisms → Bacteria2705Open in IMG/M
3300005566|Ga0066693_10043207All Organisms → cellular organisms → Bacteria1478Open in IMG/M
3300005566|Ga0066693_10226755Not Available735Open in IMG/M
3300005575|Ga0066702_10067160All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1972Open in IMG/M
3300006876|Ga0079217_10167166All Organisms → cellular organisms → Bacteria1086Open in IMG/M
3300006918|Ga0079216_10010799All Organisms → cellular organisms → Bacteria3108Open in IMG/M
3300006954|Ga0079219_12234464All Organisms → cellular organisms → Bacteria527Open in IMG/M
3300007255|Ga0099791_10137544All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1137Open in IMG/M
3300007258|Ga0099793_10127368Not Available1195Open in IMG/M
3300007258|Ga0099793_10256817All Organisms → cellular organisms → Bacteria844Open in IMG/M
3300007265|Ga0099794_10424132Not Available696Open in IMG/M
3300007788|Ga0099795_10067735All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1340Open in IMG/M
3300007788|Ga0099795_10097261All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1150Open in IMG/M
3300007821|Ga0104323_112108All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1237Open in IMG/M
3300007821|Ga0104323_128682All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes2596Open in IMG/M
3300009012|Ga0066710_100180605All Organisms → cellular organisms → Bacteria2981Open in IMG/M
3300009029|Ga0066793_10035387All Organisms → cellular organisms → Bacteria2793Open in IMG/M
3300009029|Ga0066793_10791734All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium538Open in IMG/M
3300009038|Ga0099829_10675508Not Available858Open in IMG/M
3300009093|Ga0105240_10589521Not Available1225Open in IMG/M
3300009137|Ga0066709_100392938All Organisms → cellular organisms → Bacteria1921Open in IMG/M
3300009137|Ga0066709_100716086All Organisms → cellular organisms → Bacteria1441Open in IMG/M
3300009143|Ga0099792_10099204All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300009143|Ga0099792_10116469All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300009609|Ga0105347_1417041All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium579Open in IMG/M
3300009678|Ga0105252_10258552All Organisms → cellular organisms → Bacteria764Open in IMG/M
3300010044|Ga0126310_11018806All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium653Open in IMG/M
3300010329|Ga0134111_10563192All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium507Open in IMG/M
3300010399|Ga0134127_10636233All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1100Open in IMG/M
3300011269|Ga0137392_10693747Not Available843Open in IMG/M
3300011271|Ga0137393_11167269All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium654Open in IMG/M
3300011991|Ga0120153_1006758All Organisms → cellular organisms → Bacteria3432Open in IMG/M
3300011991|Ga0120153_1024358All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1321Open in IMG/M
3300011998|Ga0120114_1058009All Organisms → cellular organisms → Bacteria → Proteobacteria754Open in IMG/M
3300012019|Ga0120139_1009967All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium2193Open in IMG/M
3300012198|Ga0137364_10002131All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae9812Open in IMG/M
3300012200|Ga0137382_11053825All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium582Open in IMG/M
3300012201|Ga0137365_10172737Not Available1620Open in IMG/M
3300012202|Ga0137363_10535316All Organisms → cellular organisms → Bacteria986Open in IMG/M
3300012203|Ga0137399_10055141All Organisms → cellular organisms → Bacteria2908Open in IMG/M
3300012207|Ga0137381_10954207All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium740Open in IMG/M
3300012208|Ga0137376_11016296All Organisms → cellular organisms → Bacteria710Open in IMG/M
3300012210|Ga0137378_11861298All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium504Open in IMG/M
3300012211|Ga0137377_10012369All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis7248Open in IMG/M
3300012211|Ga0137377_11316445All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium653Open in IMG/M
3300012212|Ga0150985_109485942Not Available639Open in IMG/M
3300012356|Ga0137371_10054448All Organisms → cellular organisms → Bacteria3095Open in IMG/M
3300012683|Ga0137398_10127212All Organisms → cellular organisms → Bacteria1634Open in IMG/M
3300012683|Ga0137398_10594783Not Available765Open in IMG/M
3300012917|Ga0137395_10163188All Organisms → cellular organisms → Bacteria1533Open in IMG/M
3300012925|Ga0137419_10046558All Organisms → cellular organisms → Bacteria2773Open in IMG/M
3300012927|Ga0137416_11481648Not Available616Open in IMG/M
3300012958|Ga0164299_11240939Not Available566Open in IMG/M
3300012989|Ga0164305_10502079All Organisms → cellular organisms → Bacteria954Open in IMG/M
3300012989|Ga0164305_11513215All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium596Open in IMG/M
3300012989|Ga0164305_12122769Not Available515Open in IMG/M
3300013104|Ga0157370_11495551All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium607Open in IMG/M
3300013105|Ga0157369_12271107All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium550Open in IMG/M
3300013294|Ga0120150_1032098All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300013307|Ga0157372_10610904All Organisms → cellular organisms → Bacteria1271Open in IMG/M
3300013503|Ga0120127_10000215All Organisms → cellular organisms → Bacteria13504Open in IMG/M
3300013503|Ga0120127_10028183All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1036Open in IMG/M
3300013764|Ga0120111_1002560All Organisms → cellular organisms → Bacteria6946Open in IMG/M
3300014031|Ga0120173_1065167All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium522Open in IMG/M
3300014052|Ga0120109_1072309Not Available787Open in IMG/M
3300014056|Ga0120125_1103921All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium666Open in IMG/M
3300014829|Ga0120104_1030480All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium982Open in IMG/M
3300015162|Ga0167653_1076436Not Available548Open in IMG/M
3300015190|Ga0167651_1009742All Organisms → cellular organisms → Bacteria2170Open in IMG/M
3300015193|Ga0167668_1000126All Organisms → cellular organisms → Bacteria12494Open in IMG/M
3300015195|Ga0167658_1029821All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1446Open in IMG/M
3300015242|Ga0137412_10394849All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1071Open in IMG/M
3300018027|Ga0184605_10143449All Organisms → cellular organisms → Bacteria1072Open in IMG/M
3300018076|Ga0184609_10167898All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1015Open in IMG/M
3300018482|Ga0066669_10019681All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis3736Open in IMG/M
3300019865|Ga0193748_1002198All Organisms → cellular organisms → Bacteria1385Open in IMG/M
3300019868|Ga0193720_1006674All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1587Open in IMG/M
3300019874|Ga0193744_1037446Not Available922Open in IMG/M
3300019877|Ga0193722_1010825All Organisms → cellular organisms → Bacteria2320Open in IMG/M
3300019879|Ga0193723_1042246All Organisms → cellular organisms → Bacteria1352Open in IMG/M
3300019879|Ga0193723_1080370All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae935Open in IMG/M
3300019881|Ga0193707_1028583All Organisms → cellular organisms → Bacteria1826Open in IMG/M
3300019881|Ga0193707_1119175All Organisms → cellular organisms → Bacteria771Open in IMG/M
3300019882|Ga0193713_1054998All Organisms → cellular organisms → Bacteria1141Open in IMG/M
3300019885|Ga0193747_1054476All Organisms → cellular organisms → Bacteria992Open in IMG/M
3300019886|Ga0193727_1000869All Organisms → cellular organisms → Bacteria12279Open in IMG/M
3300019886|Ga0193727_1026979All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1995Open in IMG/M
3300019886|Ga0193727_1180882All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium542Open in IMG/M
3300019887|Ga0193729_1016807All Organisms → cellular organisms → Bacteria3211Open in IMG/M
3300019888|Ga0193751_1014039All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis4124Open in IMG/M
3300019890|Ga0193728_1112754Not Available1242Open in IMG/M
3300020001|Ga0193731_1109857All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300020002|Ga0193730_1085381All Organisms → cellular organisms → Bacteria889Open in IMG/M
3300020012|Ga0193732_1001454All Organisms → cellular organisms → Bacteria4312Open in IMG/M
3300020021|Ga0193726_1002367All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes12874Open in IMG/M
3300020061|Ga0193716_1010469All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae4773Open in IMG/M
3300020202|Ga0196964_10625339All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium531Open in IMG/M
3300021080|Ga0210382_10190160Not Available890Open in IMG/M
3300021363|Ga0193699_10017032All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis2630Open in IMG/M
3300021363|Ga0193699_10030329All Organisms → cellular organisms → Bacteria2022Open in IMG/M
3300021363|Ga0193699_10178344All Organisms → cellular organisms → Bacteria879Open in IMG/M
3300021363|Ga0193699_10322121All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium644Open in IMG/M
3300022756|Ga0222622_10760940All Organisms → cellular organisms → Bacteria706Open in IMG/M
3300024330|Ga0137417_1158557All Organisms → cellular organisms → Bacteria1723Open in IMG/M
3300025324|Ga0209640_10128507All Organisms → cellular organisms → Bacteria2176Open in IMG/M
3300025457|Ga0208850_1000009All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae94761Open in IMG/M
3300025579|Ga0207927_1047731Not Available1119Open in IMG/M
3300025905|Ga0207685_10732455All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium540Open in IMG/M
3300025909|Ga0207705_10115968All Organisms → cellular organisms → Bacteria1983Open in IMG/M
3300025910|Ga0207684_10159641All Organisms → cellular organisms → Bacteria1941Open in IMG/M
3300025912|Ga0207707_10403709All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1173Open in IMG/M
3300025917|Ga0207660_10533307Not Available954Open in IMG/M
3300025921|Ga0207652_10259986All Organisms → cellular organisms → Bacteria1566Open in IMG/M
3300025931|Ga0207644_10503490All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium999Open in IMG/M
3300025949|Ga0207667_10126338All Organisms → cellular organisms → Bacteria2634Open in IMG/M
3300026316|Ga0209155_1140305All Organisms → cellular organisms → Bacteria819Open in IMG/M
3300026320|Ga0209131_1040218All Organisms → cellular organisms → Bacteria2690Open in IMG/M
3300026330|Ga0209473_1133150Not Available1023Open in IMG/M
3300026331|Ga0209267_1134100All Organisms → cellular organisms → Bacteria1034Open in IMG/M
3300026538|Ga0209056_10262542Not Available1219Open in IMG/M
3300026542|Ga0209805_1115509Not Available1272Open in IMG/M
3300026548|Ga0209161_10176427Not Available1211Open in IMG/M
3300027587|Ga0209220_1060374Not Available1009Open in IMG/M
3300027587|Ga0209220_1080062All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium863Open in IMG/M
3300027637|Ga0209818_1296237Not Available500Open in IMG/M
3300027645|Ga0209117_1156958All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium592Open in IMG/M
3300027651|Ga0209217_1079688All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium953Open in IMG/M
3300027674|Ga0209118_1086539Not Available894Open in IMG/M
3300027678|Ga0209011_1083009All Organisms → cellular organisms → Bacteria946Open in IMG/M
3300027681|Ga0208991_1223650All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium540Open in IMG/M
3300027681|Ga0208991_1225379All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium537Open in IMG/M
3300027738|Ga0208989_10146467All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium794Open in IMG/M
3300027903|Ga0209488_10110099All Organisms → cellular organisms → Bacteria2068Open in IMG/M
3300027903|Ga0209488_10745395All Organisms → cellular organisms → Bacteria699Open in IMG/M
3300028047|Ga0209526_10134643All Organisms → cellular organisms → Bacteria1734Open in IMG/M
3300028536|Ga0137415_10084795All Organisms → cellular organisms → Bacteria3025Open in IMG/M
3300028709|Ga0307279_10061128All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium636Open in IMG/M
3300028881|Ga0307277_10107763All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1186Open in IMG/M
3300028881|Ga0307277_10355318Not Available653Open in IMG/M
3300028885|Ga0307304_10551720All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium531Open in IMG/M
3300031740|Ga0307468_102105116All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium543Open in IMG/M
3300031938|Ga0308175_100014976All Organisms → cellular organisms → Bacteria5991Open in IMG/M
3300031938|Ga0308175_100324207All Organisms → cellular organisms → Bacteria1581Open in IMG/M
3300031938|Ga0308175_101157780Not Available859Open in IMG/M
3300031938|Ga0308175_101492361Not Available755Open in IMG/M
3300031938|Ga0308175_102668675Not Available559Open in IMG/M
3300031938|Ga0308175_102907004All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium534Open in IMG/M
3300031939|Ga0308174_10409591Not Available1093Open in IMG/M
3300031939|Ga0308174_10563539All Organisms → cellular organisms → Bacteria939Open in IMG/M
3300032074|Ga0308173_12038527Not Available541Open in IMG/M
3300032180|Ga0307471_101551754Not Available819Open in IMG/M
3300033412|Ga0310810_10007050All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae12769Open in IMG/M
3300034268|Ga0372943_0018682Not Available3675Open in IMG/M
3300034268|Ga0372943_0094762All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium1746Open in IMG/M
3300034384|Ga0372946_0153233All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia → unclassified Afipia → Afipia sp. GAS2311101Open in IMG/M
3300034384|Ga0372946_0271587All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium821Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil18.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil16.00%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost9.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil8.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.50%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil5.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere3.00%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil2.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere2.00%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.50%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.50%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.00%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil1.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.00%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.50%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.50%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.50%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.50%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.50%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.50%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.50%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.50%
SoilEnvironmental → Terrestrial → Soil → Sand → Desert → Soil0.50%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere0.50%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.50%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090004Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P1EnvironmentalOpen in IMG/M
2124908044Soil microbial communities from permafrost in Bonanza Creek, Alaska, sample from Active Layer A5EnvironmentalOpen in IMG/M
2140918007Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Active_allEnvironmentalOpen in IMG/M
2162886012Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
2170459004Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2)EnvironmentalOpen in IMG/M
3300000878Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-5 cm-9A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000880Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-65cm-20A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000887Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001305Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300001361Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-PF)- 6 month illuminaEnvironmentalOpen in IMG/M
3300001417Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 shallow-092012EnvironmentalOpen in IMG/M
3300001538Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A10-PF 4A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300001565Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A35-5cm-18A)- 1 week illumina newEnvironmentalOpen in IMG/M
3300001686Grasslands soil microbial communities from Hopland, California, USAEnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005181Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005187Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124EnvironmentalOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005336Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005446Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135EnvironmentalOpen in IMG/M
3300005451Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130EnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005561Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148EnvironmentalOpen in IMG/M
3300005566Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142EnvironmentalOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300006918Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300007265Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300007821Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 SoapdenovoEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009029Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189EnvironmentalOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009678Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT100EnvironmentalOpen in IMG/M
3300010044Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300011271Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaGEnvironmentalOpen in IMG/M
3300011991Permafrost microbial communities from Nunavut, Canada - A34_65cm_12MEnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012019Permafrost microbial communities from Nunavut, Canada - A7_5cm_12MEnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012925Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013294Permafrost microbial communities from Nunavut, Canada - A3_65cm_0MEnvironmentalOpen in IMG/M
3300013307Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaGHost-AssociatedOpen in IMG/M
3300013503Permafrost microbial communities from Nunavut, Canada - A23_5cm_12MEnvironmentalOpen in IMG/M
3300013764Permafrost microbial communities from Nunavut, Canada - A28_35cm_6MEnvironmentalOpen in IMG/M
3300014031Permafrost microbial communities from Nunavut, Canada - A35_80cm_0.25MEnvironmentalOpen in IMG/M
3300014052Permafrost microbial communities from Nunavut, Canada - A23_35cm_12MEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014829Permafrost microbial communities from Nunavut, Canada - A10_35cm_6MEnvironmentalOpen in IMG/M
3300015162Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4c, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015190Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-4a, rock/ice/stream interface)EnvironmentalOpen in IMG/M
3300015193Arctic soil microbial communities from a glacier forefield, Rabots glacier, Tarfala, Sweden (Sample Rb6, proglacial stream)EnvironmentalOpen in IMG/M
3300015195Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6c, vegetation/snow interface)EnvironmentalOpen in IMG/M
3300015242Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019865Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1EnvironmentalOpen in IMG/M
3300019868Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s1EnvironmentalOpen in IMG/M
3300019874Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a1EnvironmentalOpen in IMG/M
3300019877Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m1EnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019881Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2EnvironmentalOpen in IMG/M
3300019882Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2EnvironmentalOpen in IMG/M
3300019885Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019887Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2EnvironmentalOpen in IMG/M
3300019888Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2EnvironmentalOpen in IMG/M
3300019890Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1EnvironmentalOpen in IMG/M
3300020001Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020012Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s1EnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300020061Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c1EnvironmentalOpen in IMG/M
3300020202Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10EnvironmentalOpen in IMG/M
3300021080Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redoEnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300024330Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025579Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026320Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026330Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 (SPAdes)EnvironmentalOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300026542Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes)EnvironmentalOpen in IMG/M
3300026548Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes)EnvironmentalOpen in IMG/M
3300027587Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027637Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027651Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027674Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027681Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027738Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300028536Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300028709Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_118EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300028885Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032074Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300034268Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2EnvironmentalOpen in IMG/M
3300034384Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_KNG_2.2EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P1_DRAFT_010123902088090004SoilMSDNRREQQSSSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
A5_c1_000663802124908044SoilMSDNRREQRSGSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS
A_all_C_008356702140918007SoilMTDDRREQHSRSWLGLVLSDVQFWVPVAVLIGGLLVLRWIS
MBSR1b_0557.000068802162886012Miscanthus RhizosphereMTDNRRGEPSGSWLGLVLRDVQFWVPVAVLLAGLLVLRWISS
E4B_000351402170459004Grass SoilMTDNRRGQTSGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS
AL9A1W_101471733300000878PermafrostMSDDRREQNSGNWLDLVLRDVQFWVPVAVLAGGLLVLRWIS*
AL20A1W_104881323300000880PermafrostMSDNRREQRSGSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS*
AL16A1W_1000586423300000887PermafrostMSDNRREQYSDSWLGLVLRDVQFWVPVAVLLGGLLVLRWIS*
JGI10216J12902_10187410553300000956SoilMSEDRREQETSNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
C688J14111_1012256723300001305SoilMADDVEDKSGGWVGLVLRDAQFWVPVVVLVAGLLVLRWIS*
A30PFW6_111511213300001361PermafrostEQYSDSWLGLVLRDVQFWVPVAVLLGGLLVLRWIS*
JGI20196J14858_101893623300001417Arctic Peat SoilDNRREQQSSSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS*
A10PFW1_1229281813300001538PermafrostMSDNRREQHSGTWLGLVLRDVQFWVPVAVLLGGLLVLRWIS*
A35518A_104269323300001565PermafrostMTDNRRGQTSSSWLGLVLRDIQFWVPVAVLVGGLLVLRWISS*
C688J18823_1000847553300001686SoilMSEDVEQKSGNWLGLVLRDAQFWVPVIVLAAGLLVLRWIS*
JGI25613J43889_1011217823300002907Grasslands SoilMSNNRREQHSGNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0062593_10048478423300004114SoilMTTDSREQRRPHWWSLVLKDVQFWVPVAVLCAGLLVLGWIQ*
Ga0062593_10309414423300004114SoilMSDNQREQPSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0062589_10075251323300004156SoilMSNDRREQHSGNWLGLVLRDVQFWVPVAVLIGGLLVLRWIS*
Ga0062594_10325668713300005093SoilMTDNRRGEPSGSWLGLVLRDVQFWVPVAVLLAGLLVLRWISS*
Ga0066673_1017099023300005175SoilMADNRRELQPHAWLGLVLRDVHFWVPVAVLVGGLLVLRWIS*
Ga0066688_1005566643300005178SoilMSDDRRERHSGSWAGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0066678_1047137513300005181SoilVNDRHQEQHTRGLLGLVLRDATFWIPVVVLIGGLLVLRWIR*
Ga0066671_1094169623300005184SoilMIDDRDRKSSNWLSLVLRDVQFWVPVAVLAAGLLVLRWIS*
Ga0066675_1109324923300005187SoilHAAERPMAEDSKQSSRSWLNLVLRDVQFWVPVAVLVAGLIVLRWIS*
Ga0065715_1037200223300005293Miscanthus RhizosphereMTDDRGQRDGGWVSLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0070658_1001373873300005327Corn RhizosphereMENVRREPASPGWISLVLRDVQFWVPVIVLAAGLLVLRWIS*
Ga0070680_10099479323300005336Corn RhizosphereMSEDSAHNSRSWLGLVLRDAQFWVPVAVLIAGLLVLRWIS*
Ga0070682_10011380823300005337Corn RhizosphereCQERGMTDNRRGEPSGSWLGLVLRDVQFWVPVAVLLAGLLVLRWISS*
Ga0070682_10084314323300005337Corn RhizosphereMTEDSEQNSRSWLSLALRDVQFWVPVAVLVAGLLVLRWIS*
Ga0070660_10065678423300005339Corn RhizosphereVSTMPDGRRGWLALVIRDVQFWVPVIVLAAGLLVLRWIS*
Ga0070661_10008382623300005344Corn RhizosphereMPDDRSEQPGSWINLVLQDLQFWVPVAVLVVGLIVLRWIS*
Ga0070709_1103853723300005434Corn, Switchgrass And Miscanthus RhizosphereMADDREQTSGWLSLVLRDVQFWVPVAVLAAGLIILRWIS*
Ga0070710_1041727923300005437Corn, Switchgrass And Miscanthus RhizosphereMSEDSAHNSRSWLGLVLRDVQFWVPVAVLIAGLLVLRWIS*
Ga0070705_10171465313300005440Corn, Switchgrass And Miscanthus RhizosphereMSDNHREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0066686_1057644123300005446SoilMSDYRRERHSGSWAGLVLSDVQFWVPVAVLVAGLLVLRSIS*
Ga0066681_1046554123300005451SoilMSDDREHHTDSWLSLVLRDAQFWVPVAVLVAGLLVLRWIS*
Ga0070699_10126855123300005518Corn, Switchgrass And Miscanthus RhizosphereMPDDRDPQSGSWVSLVLHDVQFWVPVAVLVAGLLILRWIS*
Ga0070697_10051149413300005536Corn, Switchgrass And Miscanthus RhizosphereMPDDRDPQSGSWVSLVLRDVQFWVPVAVLVAGLLILRWIS*
Ga0070697_10054025323300005536Corn, Switchgrass And Miscanthus RhizosphereMTDDREQSSRSWLSLVVRDVQFWVPVAVLIAGLLILRWIS*
Ga0070697_10171750323300005536Corn, Switchgrass And Miscanthus RhizosphereMSDNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0070686_10092325323300005544Switchgrass RhizosphereMRDVREQNTGSWLGLVLRDAQFWVPVGVLVAGLLVLRWIS*
Ga0070695_10019018423300005545Corn, Switchgrass And Miscanthus RhizosphereMADDREHASGWLSLVLRDVQFWVPVAVLVAGLIILRWIS*
Ga0070696_10145172423300005546Corn, Switchgrass And Miscanthus RhizosphereMTEDSEQNSRSWLSLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0066699_1004365143300005561SoilMADDRKQVSASWLSLVLRDVQFWVPVAVLVAGLLILRWIS*
Ga0066693_1004320733300005566SoilMAEDSKQSSRSWLNLVLRDVQFWVPVAVLVAGLIVLRWIS*
Ga0066693_1022675513300005566SoilPKSSNWLGLVLRDVQFWVPVAVLAAGLLVLRWIS*
Ga0066702_1006716023300005575SoilMTDQREPDSRSWLSLVLSDVQFWVPVLVLVAGLLVLRWIS*
Ga0079217_1016716623300006876Agricultural SoilMPDARREQRSWLSVILTDIHFWVPVAVLAGGLLVLRWIS*
Ga0079216_1001079913300006918Agricultural SoilCPSTDYSRTSAMPDARREQRSWLSVILTDIHFWVPVAVLAGGLLVLRWIS*
Ga0079219_1223446423300006954Agricultural SoilVTEMPDGRRGWLALVIRDVQFWVPVIVLVAGLLVLRWIA*
Ga0099791_1013754423300007255Vadose Zone SoilMSINRREQHSGNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0099793_1012736823300007258Vadose Zone SoilMSDDRREQQSGSWLGLVLSDVQFWVPVAVLAGGLLVLRWIS*
Ga0099793_1025681723300007258Vadose Zone SoilMSNNRREQHSGNWLGLVLRDVQVWVPVAVLVAGLLVLRWIS*
Ga0099794_1042413213300007265Vadose Zone SoilMSDDRREQQSGSWLGLVLRDVQFWVPVAVLVGGLLVLRWIS*
Ga0099795_1006773523300007788Vadose Zone SoilMTDNRRGQTLGSWLGLVLRDVQFWVPVAVLVAGLLVLRWISS*
Ga0099795_1009726133300007788Vadose Zone SoilMADNRRGQTLGSWLGLVLRDVQFWVSVAVLVGGLLVLRWISS*
Ga0104323_11210823300007821SoilMSDNRREQQSSSWLGLVLRDLQFWVPVAVLAAGLLVLRWIS*
Ga0104323_12868223300007821SoilMSDDREQHSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS*
Ga0066710_10018060553300009012Grasslands SoilMSDDRRDRHSASWASLVLRDAQFWVPVGVLVAGLLVLRWIS
Ga0066793_1003538733300009029Prmafrost SoilMSDNRREQQSSSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS*
Ga0066793_1079173423300009029Prmafrost SoilMNDHRPEQRSRHWLSLVLHDVQFWVPVAVLCGGLLVLAWIR*
Ga0099829_1067550823300009038Vadose Zone SoilMSDNRREQDSGSWLVLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0105240_1058952123300009093Corn RhizosphereEPSGSWLGLVLRDVQFWVPVAVLLAGLLVLRWISS*
Ga0066709_10039293813300009137Grasslands SoilRREQQSGSWLGLVLHDVQFWVPVAVLVAGLLVLRWIS*
Ga0066709_10071608623300009137Grasslands SoilMSDYRRERHSGSWAGLVLSDVQFWVPVAVLVAGLLVLRWIS*
Ga0099792_1009920423300009143Vadose Zone SoilMTDNRRGQTLGSWLGLVLRDVQFWVPVTVLVGGLLVLRWISS*
Ga0099792_1011646923300009143Vadose Zone SoilMADNRRGQTSGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS*
Ga0105347_141704113300009609SoilMSDDEQRDHWMYLVLRDVQFWVPVVVLIGGLLVLRWIG*
Ga0105252_1025855223300009678SoilMTNGSKPPHWLAQVVRDVQFWIPVVVLIAGLLVLRWIA*
Ga0126310_1101880623300010044Serpentine SoilMSDDDRAKQSGSWATLVLTDVHFWVPIAVLIAGLVVLRWVS*
Ga0134111_1056319213300010329Grasslands SoilMSEDRREQQSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0134127_1063623323300010399Terrestrial SoilMTDDRGQRDDGWVSLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0137392_1069374723300011269Vadose Zone SoilMSDNRREHDSGSWLVLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0137393_1116726923300011271Vadose Zone SoilMNDDWPQHRGRSWLSLVLRDVQFWVPVAVLCGGLLVLGWIS*
Ga0120153_100675833300011991PermafrostMSDNRREHSGTWLGLVLRDVQFWVPVAVLLGGLLVLRWIS*
Ga0120153_102435813300011991PermafrostMSDNRREQRSGSWLGLVLRDVQFWVPVAVLAAGLLVL
Ga0120114_105800923300011998PermafrostMSDDREQHSDSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS*
Ga0120139_100996723300012019PermafrostMSDNRREQQGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0137364_1000213163300012198Vadose Zone SoilMADNRREQQPHAWLGLVLRDVHFWVPVAVLLGGLLVLRWIS*
Ga0137382_1105382523300012200Vadose Zone SoilMTDNRRGQTSGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS*
Ga0137365_1017273713300012201Vadose Zone SoilMSDDRRDRHHGSWASLVLRDMQFWVPVAVLVAGLLVLRWIS*
Ga0137363_1053531623300012202Vadose Zone SoilMRINRREQHSGNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0137399_1005514143300012203Vadose Zone SoilMSNNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0137381_1095420713300012207Vadose Zone SoilMPDDREQASASKLSLVVRDVQFWVPVAVLVAGLLILRWIS
Ga0137376_1101629613300012208Vadose Zone SoilMSDNRREQQSGSWLGLVLRDVQFWVPVGVLVAGLLVLRWIS*
Ga0137378_1186129823300012210Vadose Zone SoilMPDDREQASASKLSLVVRDVQFWVPVAVLIVGLLVLRWIS*
Ga0137377_1001236943300012211Vadose Zone SoilMSDDRREQDSGSWLGLVMRDVQFWVPVAVLIGGLLVLRWIS*
Ga0137377_1131644523300012211Vadose Zone SoilLRADRQEKPMTDDRGQHTGGWVGLVLRDVQFWVPVAVLIVGLLVLRWIS*
Ga0150985_10948594223300012212Avena Fatua RhizosphereNAMSDDVEQNSGSWWRLVLRDAQFWVPVVVLVAGLLVLRWIS*
Ga0137371_1005444823300012356Vadose Zone SoilMSEDRHEQQSGGWLGLVIRDVQFWVPVAVLVAGLLVLRWIS*
Ga0137398_1012721233300012683Vadose Zone SoilMSDNHHVQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0137398_1059478313300012683Vadose Zone SoilPMTDNRRGPTLGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS*
Ga0137395_1016318843300012917Vadose Zone SoilMSDNHREQHSGSWLGLVLRDVQFWVPVAVLVAGLIVLRWIS*
Ga0137419_1004655823300012925Vadose Zone SoilMSDDRRDPQTGSRLGLVLRDVHFWVPVAVLVGGLLVLRWIS*
Ga0137416_1148164813300012927Vadose Zone SoilREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS*
Ga0164299_1124093923300012958SoilMDDVRRERASPGWISLVLRDVQFWVPVVVLAAGLLVLRWIS*
Ga0164305_1050207923300012989SoilLRADHAEERTLTDNRSERPRGWPSLVLRDPQFWVPVVVLVAGLLVLRWIS*
Ga0164305_1151321523300012989SoilMRDVRDQKTGSWLGLVLRDAQFWVPVGVLIAGLLVLRWIS*
Ga0164305_1212276913300012989SoilMDDVRRERGSPGWISLVLRDVQFWVPIIVLAAGLLVLRWIS*
Ga0157370_1149555123300013104Corn RhizosphereMTDNRRGEPSGSWLGLVLRDVQFWVPLAVLLAGLLVLRWISS*
Ga0157369_1227110713300013105Corn RhizosphereMPMPDARRGWLSLVIRDVQFWVPVIVLAAGLVVLRWIS*
Ga0120150_103209823300013294PermafrostMSDNHREQYSDSWLGLVLRDVQFWVPVAVLLGGLLVLRWIS*
Ga0157372_1061090423300013307Corn RhizosphereMPDGRRGWLALVIRDVQFWVPVIVLAAGLLVLRWIS*
Ga0120127_10000215133300013503PermafrostMSDDREQQSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS*
Ga0120127_1002818333300013503PermafrostMTDNRRGQTSGSWLGLVLRDIQFWVPVAVLVGGLLVLRWISS*
Ga0120111_100256083300013764PermafrostMSDNRHKQHSGSRLGLVLRDVQFWVPVAVLLGGLLVLRWIS*
Ga0120173_106516723300014031PermafrostMSDNRHKQHSGSWLGLVLRDVQFWVPVAVLLGGLLVLRWIS*
Ga0120109_107230913300014052PermafrostMGDDREAHSGGWLGLVLRDVQFWVPVAVLAAGLLVLRWIS*
Ga0120125_110392123300014056PermafrostMTDNRRGQTSGSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS*
Ga0120104_103048033300014829PermafrostMSDDREQHSGSWLGLVLRDVQFWVPVAVLAGGLLV
Ga0167653_107643623300015162Glacier Forefield SoilMSDDREQHSGWLGLVLRDVQFWVPVAVLGGGLIVLRWIS*
Ga0167651_100974213300015190Glacier Forefield SoilSMSDDREQHSGWLGLVLRDVQFWVPVAVLGVGLLVLRWIS*
Ga0167668_100012673300015193Glacier Forefield SoilMGDDRREQHSGSWLGLVVRDVQFWVPVAVLAGGLLVLRWIS*
Ga0167658_102982123300015195Glacier Forefield SoilMSDDREQHSGSWLGLVLLDVQFWVPVAVLAGGLLVLRWIS*
Ga0137412_1039484913300015242Vadose Zone SoilMTDNRRGQTLGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS*
Ga0184605_1014344923300018027Groundwater SedimentMNDSREQSSPGWLSLVLHDVQFWVPLAVLLGGLLVLRWIS
Ga0184609_1016789823300018076Groundwater SedimentMRQSRGWLGLVMRDVQFWVPVAVLIGGLLVLQWIR
Ga0066669_1001968153300018482Grasslands SoilMAEDSKQSSRSWLNLVLRDVQFWVPVAVLVAGLIVLRWIS
Ga0193748_100219823300019865SoilMSDDREQQSGNWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0193720_100667423300019868SoilMSDDREQQSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0193744_103744613300019874SoilMTDNRRGQTSGSWLGLVLRDVQFWVPIAVLAGGLLVLRWISS
Ga0193722_101082523300019877SoilMADNRRGQTSGSWLGLVLRDVQFWVPIAVLVGGLLVLRWISS
Ga0193723_104224623300019879SoilMSDDQLNDNRRERPSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0193723_108037023300019879SoilMRQSRNWLKLILRDAQFWVPVAVLAGGLLVLQWMH
Ga0193707_102858323300019881SoilMTDNRRGQTSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWISS
Ga0193707_111917523300019881SoilMSDNQREERSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0193713_105499823300019882SoilMTDNRRGQASGSWLGLVLRDVQFWVPVAVLAGGLVVLRWISS
Ga0193747_105447623300019885SoilMSEDRREQHSGGWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0193727_100086973300019886SoilMSDNQREKRSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0193727_102697923300019886SoilMTDNRRGQTSGSWLSLVLRDVQFWVPVAVLAGGLLVLRWISS
Ga0193727_118088223300019886SoilMSDDQLSDNRRERPSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0193729_101680753300019887SoilMSNNRREQRSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0193751_101403973300019888SoilMSDDRREHNSGNWLGLVLRDAQFWVPVAVLAGGLLVLRWIS
Ga0193728_111275413300019890SoilTNNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0193731_110985723300020001SoilMSDHQLSDNRREQPSGGWRRDVQCWVPVAVLVAGLLVLRWIS
Ga0193730_108538123300020002SoilMSDHQLSDNRREQPSGGWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0193732_100145443300020012SoilMADNRRGQTSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWISS
Ga0193726_1002367103300020021SoilMSDNQREQPSGNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0193716_101046953300020061SoilMSKDHREQHSGSWLGLVLRDVQFWVPVAVLIAGLLVLRWIS
Ga0196964_1062533923300020202SoilMPPSPNEQHGRSWVGLVVRDAQFWVPVAVLIGGLLVLNWIQ
Ga0210382_1019016013300021080Groundwater SedimentEQSSPGWLSLVLHDVQFWVPLAVLLGGLLVLRWIS
Ga0193699_1001703213300021363SoilMTDNRRGQTSGSWLGLVLRDVQFWVPVAVLMGGLLVLRWIS
Ga0193699_1003032923300021363SoilMSDNLREHKSGSWLGLVLRDVQFWVPVAVLIGGLLVLRWIS
Ga0193699_1017834423300021363SoilMSDDRREQNSGSRLGLVMRDVQFWVPVAVLIGGLLVLRWIS
Ga0193699_1032212123300021363SoilMSDDREQHSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0222622_1076094023300022756Groundwater SedimentMGDNQRERPTGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0137417_115855723300024330Vadose Zone SoilMSNNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0209640_1012850733300025324SoilMNDDRREQHSRNWLGIVLQDVHFWVPVVVLVGGLLVLQWIR
Ga0208850_1000009133300025457Arctic Peat SoilMSDNRREQQSSSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS
Ga0207927_104773113300025579Arctic Peat SoilNRREQQSSSWLGLVLRDVQFWVPVAVLAAGLLVLRWIS
Ga0207685_1073245523300025905Corn, Switchgrass And Miscanthus RhizosphereMSEDSAHNSRSWLGLVLRDAQFWVPVAVLIAGLLVLRWIS
Ga0207705_1011596823300025909Corn RhizosphereMPMPDARRGWLSLVIRDVQFWVPVIVLAAGLVVLRWIS
Ga0207684_1015964123300025910Corn, Switchgrass And Miscanthus RhizosphereMSDNHREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0207707_1040370923300025912Corn RhizosphereMTEDSEQNSRSWLSLALRDVQFWVPVAVLVAGLLVLRWIS
Ga0207660_1053330723300025917Corn RhizosphereDSAHNSRSWLGLVLRDAQFWVPVAVLIAGLLVLRWIS
Ga0207652_1025998623300025921Corn RhizosphereMPDDRSEQPGSWINLVLRDLQFWVPVAVLVVGLIVLRWIS
Ga0207644_1050349033300025931Switchgrass RhizosphereMRDVREQNTGSWLGLVLRDAQFWVPVGVLVAGLLVLRWIS
Ga0207667_1012633823300025949Corn RhizosphereMTDNRRGEPSGSWLGLVLRDVQFWVPLAVLLAGLLVLRWISS
Ga0209155_114030523300026316SoilMIDDRDRKSSNWLSLVLRDVQFWVPVAVLAAGLLVLRWIS
Ga0209131_104021833300026320Grasslands SoilMSNNRREQHSGNWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0209473_113315023300026330SoilMIDDRDPKSSNWLGLVLRDVQFWVPVAVLAAGLLVLRWIS
Ga0209267_113410023300026331SoilMTDDREQSSRSWLSLVVRDVQFWVPVAVLIAGLLILRWIS
Ga0209056_1026254223300026538SoilMSDYRRERHSGSWAGLVLSDVQFWVPVAVLVAGLLVLRWIS
Ga0209805_111550913300026542SoilMADDRKQVSASWLSLVLRDVQFWVPVAVLVAGLLILRWIS
Ga0209161_1017642723300026548SoilSDDRRDRHSASWASLVLRDAQFWVPVGVLVAGLLVLRWIS
Ga0209220_106037413300027587Forest SoilEQYSGNWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0209220_108006223300027587Forest SoilMSDDREQQTGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0209818_129623723300027637Agricultural SoilMPDARREQRSWLSVILTDIHFWVPVAVLVGGLLVLR
Ga0209117_115695813300027645Forest SoilMSDDREKDSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0209217_107968823300027651Forest SoilMSDDREQHSGSWLGLVLRDVQFWVPVAVLAGGLLVL
Ga0209118_108653923300027674Forest SoilMSDDRREQYSGNWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0209011_108300923300027678Forest SoilMSDDRREQHSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0208991_122365023300027681Forest SoilMSDDREQQSGGWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0208991_122537923300027681Forest SoilMSDNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0208989_1014646723300027738Forest SoilMSDDRREQQPGSWLGLVLRDVQFWVPVAVLAGGLLVLRWIS
Ga0209488_1011009923300027903Vadose Zone SoilMTDNRRGHTLGSWLGLVLRDVQFWVPVAVLVGGLLVLRWISS
Ga0209488_1074539523300027903Vadose Zone SoilVSDDRRDQHTGSRLGLVLRDVHFWVPIAVLIGGLLVLRWIS
Ga0209526_1013464323300028047Forest SoilMNDNRREQHSGSWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0137415_1008479523300028536Vadose Zone SoilMSDDRREQQSGSWLGLVLSDVQFWVPVAVLAGGLLVLRWIS
Ga0307279_1006112813300028709SoilMSDDREQQSGNWLGLVLRDVQFWVPVAVLAGGLLVLRW
Ga0307277_1010776333300028881SoilMSDDRRDQHTDSRLGLVLRDVHFWVPVAVLVAGLLVLRWIS
Ga0307277_1035531813300028881SoilTMSDDRRDQHTDSRLGLVLRDVHFWVPVAVLVAGLLVLRWIS
Ga0307304_1055172023300028885SoilHQLSDNRREQPSGGWLGLVLRDVQFWVPVAVLVAGLLVLRWIS
Ga0307468_10210511623300031740Hardwood Forest SoilMTDDRGQRDSGWVSLILRDAQFWVPVAVLVAGLLVLRWIS
Ga0308175_10001497643300031938SoilMDVRRDSASPSWISLVLRDVQFWVPVVVLAAGLLVLRWIS
Ga0308175_10032420723300031938SoilMDDNRRGHTSPAWFSLVLRDVQFWVPVIVLAAGLLVLRWIA
Ga0308175_10115778013300031938SoilVTAVPNVDRWLTLVLRDVQFWVPVIVLAAGLLVLHWIS
Ga0308175_10149236113300031938SoilMSADSHEQRRPHWWSLVLRDVQFWVPVAVLCGGLLVLGWIQ
Ga0308175_10266867523300031938SoilMTDARRDAGSPGWIALVLRDVQFWVPVVVLTAGLLVLRWIS
Ga0308175_10290700413300031938SoilMTTDSREQRRPHWWSLVLKDVQFWVPVAVLCAGLLVLGWIQ
Ga0308174_1040959113300031939SoilEAGSPGWIALVLRDVQFWVPVVVLTAGLLVLRWIS
Ga0308174_1056353923300031939SoilMPDGRRGWLALVIRDVQFWVPVIVLVAGLLVLRWIS
Ga0308173_1203852723300032074SoilMDDNRRGHISPAWFSLVLRDVQFWVPVIVLAAGLLV
Ga0307471_10155175413300032180Hardwood Forest SoilMSDNRREQHSGSWLGLVLRDVQFWVPLAVLVAGLLVLRWIS
Ga0310810_10007050103300033412SoilMTDNRSGQTSGSWLGLVLRDVQFWVPVAVLAGGLLVLRWISS
Ga0372943_0018682_2223_23423300034268SoilMGDDDRKRVSWLPVLLRDVQFWVPVAVLIGGLLVLRWIS
Ga0372943_0094762_782_9343300034268SoilLPADRDEEQTLTDNRSERPKSWPGLVLRDPQFWVPVAVLAAGLIVLRWIS
Ga0372946_0153233_89_2113300034384SoilMDDSRSEPKSSWVALVVRDVQFWVPVVVLAAGLVVLRWIA
Ga0372946_0271587_199_3243300034384SoilMDDSRRDSRSRSWLALVLSDIQFWVPVIVLVAGLLVLRWIA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.