| Basic Information | |
|---|---|
| Family ID | F025834 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 42 residues |
| Representative Sequence | PLALGGLWLGFFAFNLKQCPLLPLGDPKLAEAIEHHEH |
| Number of Associated Samples | 168 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.00 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 152 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.45 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (18.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.88% β-sheet: 0.00% Coil/Unstructured: 62.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.45 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF02630 | SCO1-SenC | 13.00 |
| PF00116 | COX2 | 7.00 |
| PF02790 | COX2_TM | 5.00 |
| PF00115 | COX1 | 1.00 |
| PF01960 | ArgJ | 0.50 |
| PF13442 | Cytochrome_CBB3 | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG1225 | Peroxiredoxin | Posttranslational modification, protein turnover, chaperones [O] | 13.00 |
| COG1999 | Cytochrome oxidase Cu insertion factor, SCO1/SenC/PrrC family | Posttranslational modification, protein turnover, chaperones [O] | 13.00 |
| COG1622 | Heme/copper-type cytochrome/quinol oxidase, subunit 2 | Energy production and conversion [C] | 12.00 |
| COG4263 | Nitrous oxide reductase | Inorganic ion transport and metabolism [P] | 7.00 |
| COG1364 | Glutamate N-acetyltransferase (ornithine transacetylase) | Amino acid transport and metabolism [E] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.00 % |
| Unclassified | root | N/A | 4.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100820531 | All Organisms → cellular organisms → Bacteria | 811 | Open in IMG/M |
| 3300003219|JGI26341J46601_10100446 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300003370|JGI26337J50220_1026677 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300004091|Ga0062387_100211360 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300004092|Ga0062389_103371719 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300004152|Ga0062386_101631483 | All Organisms → cellular organisms → Bacteria | 538 | Open in IMG/M |
| 3300005180|Ga0066685_10167009 | All Organisms → cellular organisms → Bacteria | 1502 | Open in IMG/M |
| 3300005290|Ga0065712_10669339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300005356|Ga0070674_100705572 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300005406|Ga0070703_10465784 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005552|Ga0066701_10929927 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 515 | Open in IMG/M |
| 3300005554|Ga0066661_10899008 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300005557|Ga0066704_10273030 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300005586|Ga0066691_10885530 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 525 | Open in IMG/M |
| 3300005718|Ga0068866_11379610 | All Organisms → cellular organisms → Bacteria | 514 | Open in IMG/M |
| 3300005764|Ga0066903_101684175 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1207 | Open in IMG/M |
| 3300006028|Ga0070717_10722459 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300006031|Ga0066651_10815342 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006057|Ga0075026_101071627 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300006086|Ga0075019_10375948 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300006172|Ga0075018_10450392 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068 | 663 | Open in IMG/M |
| 3300006175|Ga0070712_100511430 | All Organisms → cellular organisms → Bacteria | 1008 | Open in IMG/M |
| 3300006176|Ga0070765_100126408 | All Organisms → cellular organisms → Bacteria | 2250 | Open in IMG/M |
| 3300006176|Ga0070765_100855659 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300006755|Ga0079222_10256903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1104 | Open in IMG/M |
| 3300006755|Ga0079222_11306135 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300006796|Ga0066665_10218490 | All Organisms → cellular organisms → Bacteria | 1490 | Open in IMG/M |
| 3300006804|Ga0079221_11784697 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006871|Ga0075434_102049241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300006904|Ga0075424_101485599 | All Organisms → cellular organisms → Bacteria | 719 | Open in IMG/M |
| 3300007255|Ga0099791_10173615 | Not Available | 1012 | Open in IMG/M |
| 3300007255|Ga0099791_10289782 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300007265|Ga0099794_10182422 | All Organisms → cellular organisms → Bacteria | 1072 | Open in IMG/M |
| 3300007265|Ga0099794_10544154 | Not Available | 613 | Open in IMG/M |
| 3300009038|Ga0099829_10002699 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 10268 | Open in IMG/M |
| 3300009038|Ga0099829_10705037 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300009088|Ga0099830_11705036 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009089|Ga0099828_11410301 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300009137|Ga0066709_103121347 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300009143|Ga0099792_10562715 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300009524|Ga0116225_1162085 | All Organisms → cellular organisms → Bacteria | 1018 | Open in IMG/M |
| 3300009615|Ga0116103_1140475 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300009621|Ga0116116_1020107 | All Organisms → cellular organisms → Bacteria | 2439 | Open in IMG/M |
| 3300009636|Ga0116112_1010299 | All Organisms → cellular organisms → Bacteria | 3746 | Open in IMG/M |
| 3300010048|Ga0126373_12500804 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010322|Ga0134084_10085269 | All Organisms → cellular organisms → Bacteria | 987 | Open in IMG/M |
| 3300010339|Ga0074046_10814374 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300010341|Ga0074045_10221819 | All Organisms → cellular organisms → Bacteria | 1259 | Open in IMG/M |
| 3300010376|Ga0126381_100214039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2585 | Open in IMG/M |
| 3300010379|Ga0136449_103270193 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300011120|Ga0150983_13820623 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300011269|Ga0137392_10941512 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300012096|Ga0137389_10128295 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
| 3300012189|Ga0137388_10501662 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300012189|Ga0137388_10742584 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300012189|Ga0137388_11711369 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300012207|Ga0137381_10252834 | All Organisms → cellular organisms → Bacteria | 1532 | Open in IMG/M |
| 3300012207|Ga0137381_11519967 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012349|Ga0137387_10929547 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300012359|Ga0137385_10101578 | All Organisms → cellular organisms → Bacteria | 2549 | Open in IMG/M |
| 3300012359|Ga0137385_10317049 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300012685|Ga0137397_10378239 | All Organisms → cellular organisms → Bacteria | 1055 | Open in IMG/M |
| 3300012685|Ga0137397_10859517 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300012917|Ga0137395_10110647 | All Organisms → cellular organisms → Bacteria | 1837 | Open in IMG/M |
| 3300012923|Ga0137359_10168829 | All Organisms → cellular organisms → Bacteria | 1953 | Open in IMG/M |
| 3300012923|Ga0137359_10768113 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012923|Ga0137359_11729445 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300012924|Ga0137413_10847917 | All Organisms → cellular organisms → Bacteria | 705 | Open in IMG/M |
| 3300012925|Ga0137419_11370837 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300012927|Ga0137416_10478806 | All Organisms → cellular organisms → Bacteria | 1069 | Open in IMG/M |
| 3300012957|Ga0164303_11394136 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300012961|Ga0164302_10124874 | All Organisms → cellular organisms → Bacteria | 1471 | Open in IMG/M |
| 3300012972|Ga0134077_10358093 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300012977|Ga0134087_10038321 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300013308|Ga0157375_10677208 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
| 3300015051|Ga0137414_1130572 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300015054|Ga0137420_1038644 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3052 | Open in IMG/M |
| 3300015089|Ga0167643_1039765 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300015203|Ga0167650_1078299 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300015242|Ga0137412_10817703 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300015264|Ga0137403_11135177 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300015371|Ga0132258_11777551 | All Organisms → cellular organisms → Bacteria | 1554 | Open in IMG/M |
| 3300015374|Ga0132255_103426361 | All Organisms → cellular organisms → Bacteria | 675 | Open in IMG/M |
| 3300016319|Ga0182033_10680411 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300016387|Ga0182040_11336919 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300016422|Ga0182039_10283170 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 1366 | Open in IMG/M |
| 3300017823|Ga0187818_10504448 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300017934|Ga0187803_10061531 | All Organisms → cellular organisms → Bacteria | 1477 | Open in IMG/M |
| 3300017934|Ga0187803_10438570 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300017936|Ga0187821_10292849 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300017961|Ga0187778_10411145 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → Pyrinomonas → Pyrinomonas methylaliphatogenes | 889 | Open in IMG/M |
| 3300017974|Ga0187777_11136925 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300017975|Ga0187782_11432690 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300017999|Ga0187767_10069499 | All Organisms → cellular organisms → Bacteria | 917 | Open in IMG/M |
| 3300018024|Ga0187881_10082557 | All Organisms → cellular organisms → Bacteria | 1482 | Open in IMG/M |
| 3300018431|Ga0066655_10074375 | All Organisms → cellular organisms → Bacteria | 1831 | Open in IMG/M |
| 3300018433|Ga0066667_10356932 | All Organisms → cellular organisms → Bacteria | 1165 | Open in IMG/M |
| 3300018468|Ga0066662_10107685 | All Organisms → cellular organisms → Bacteria | 1995 | Open in IMG/M |
| 3300019788|Ga0182028_1097421 | All Organisms → cellular organisms → Bacteria | 990 | Open in IMG/M |
| 3300019882|Ga0193713_1129384 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
| 3300020579|Ga0210407_10267888 | All Organisms → cellular organisms → Bacteria | 1332 | Open in IMG/M |
| 3300020581|Ga0210399_10094225 | All Organisms → cellular organisms → Bacteria | 2443 | Open in IMG/M |
| 3300020581|Ga0210399_10543472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 964 | Open in IMG/M |
| 3300021181|Ga0210388_10516482 | All Organisms → cellular organisms → Bacteria | 1048 | Open in IMG/M |
| 3300021403|Ga0210397_11271642 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300021405|Ga0210387_10210802 | All Organisms → cellular organisms → Bacteria | 1689 | Open in IMG/M |
| 3300021405|Ga0210387_10962316 | Not Available | 749 | Open in IMG/M |
| 3300021406|Ga0210386_10346299 | All Organisms → cellular organisms → Bacteria | 1278 | Open in IMG/M |
| 3300021432|Ga0210384_10947490 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300021477|Ga0210398_11383930 | Not Available | 550 | Open in IMG/M |
| 3300021478|Ga0210402_10808645 | All Organisms → cellular organisms → Bacteria | 863 | Open in IMG/M |
| 3300021478|Ga0210402_11858087 | Not Available | 528 | Open in IMG/M |
| 3300022204|Ga0224496_10056088 | All Organisms → cellular organisms → Bacteria | 1782 | Open in IMG/M |
| 3300022529|Ga0242668_1120350 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300022557|Ga0212123_10084600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2660 | Open in IMG/M |
| 3300022721|Ga0242666_1047236 | All Organisms → cellular organisms → Bacteria | 899 | Open in IMG/M |
| 3300024178|Ga0247694_1034778 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300024330|Ga0137417_1049346 | All Organisms → cellular organisms → Bacteria | 1775 | Open in IMG/M |
| 3300025544|Ga0208078_1032276 | All Organisms → cellular organisms → Bacteria | 1150 | Open in IMG/M |
| 3300025906|Ga0207699_10049207 | All Organisms → cellular organisms → Bacteria | 2480 | Open in IMG/M |
| 3300025906|Ga0207699_10320489 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300025910|Ga0207684_10407146 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300025934|Ga0207686_10826231 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300025939|Ga0207665_10454333 | All Organisms → cellular organisms → Bacteria | 984 | Open in IMG/M |
| 3300026088|Ga0207641_10008320 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8573 | Open in IMG/M |
| 3300026304|Ga0209240_1083946 | All Organisms → cellular organisms → Bacteria | 1169 | Open in IMG/M |
| 3300026328|Ga0209802_1326166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300026333|Ga0209158_1047532 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300026514|Ga0257168_1092712 | Not Available | 671 | Open in IMG/M |
| 3300026524|Ga0209690_1272012 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300026530|Ga0209807_1010213 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4627 | Open in IMG/M |
| 3300026538|Ga0209056_10131046 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300026547|Ga0209156_10106346 | All Organisms → cellular organisms → Bacteria | 1390 | Open in IMG/M |
| 3300026557|Ga0179587_10725055 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300027049|Ga0207806_1031883 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300027616|Ga0209106_1031418 | All Organisms → cellular organisms → Bacteria | 1172 | Open in IMG/M |
| 3300027616|Ga0209106_1060046 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 851 | Open in IMG/M |
| 3300027625|Ga0208044_1161660 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
| 3300027643|Ga0209076_1096732 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300027678|Ga0209011_1169872 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300027725|Ga0209178_1162604 | All Organisms → cellular organisms → Bacteria | 776 | Open in IMG/M |
| 3300027729|Ga0209248_10016516 | All Organisms → cellular organisms → Bacteria | 2313 | Open in IMG/M |
| 3300027729|Ga0209248_10235605 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300027829|Ga0209773_10164660 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300027854|Ga0209517_10376776 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300027862|Ga0209701_10700566 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300027867|Ga0209167_10750965 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300027884|Ga0209275_10857628 | Not Available | 523 | Open in IMG/M |
| 3300027894|Ga0209068_10348448 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300027910|Ga0209583_10669608 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300028047|Ga0209526_10858388 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
| 3300028145|Ga0247663_1046855 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300028536|Ga0137415_10461503 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300028808|Ga0302228_10065633 | All Organisms → cellular organisms → Bacteria | 1730 | Open in IMG/M |
| 3300028906|Ga0308309_10681308 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300030991|Ga0073994_12287347 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300031057|Ga0170834_107988652 | All Organisms → cellular organisms → Bacteria | 591 | Open in IMG/M |
| 3300031057|Ga0170834_112495528 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300031446|Ga0170820_14062284 | All Organisms → cellular organisms → Bacteria | 865 | Open in IMG/M |
| 3300031474|Ga0170818_110154687 | All Organisms → cellular organisms → Bacteria | 1052 | Open in IMG/M |
| 3300031546|Ga0318538_10775372 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300031680|Ga0318574_10747651 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031708|Ga0310686_107469615 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300031708|Ga0310686_109863858 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300031708|Ga0310686_109867911 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
| 3300031718|Ga0307474_10223178 | All Organisms → cellular organisms → Bacteria | 1438 | Open in IMG/M |
| 3300031718|Ga0307474_11066910 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300031718|Ga0307474_11542128 | Not Available | 522 | Open in IMG/M |
| 3300031718|Ga0307474_11547365 | All Organisms → cellular organisms → Bacteria | 521 | Open in IMG/M |
| 3300031720|Ga0307469_10365849 | All Organisms → cellular organisms → Bacteria | 1217 | Open in IMG/M |
| 3300031720|Ga0307469_11092026 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
| 3300031744|Ga0306918_10039667 | All Organisms → cellular organisms → Bacteria | 3053 | Open in IMG/M |
| 3300031744|Ga0306918_11241884 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300031753|Ga0307477_10431665 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300031753|Ga0307477_10480794 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300031754|Ga0307475_10077049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2562 | Open in IMG/M |
| 3300031777|Ga0318543_10452803 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031820|Ga0307473_11070875 | All Organisms → cellular organisms → Bacteria | 593 | Open in IMG/M |
| 3300031879|Ga0306919_11105918 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300031942|Ga0310916_11586449 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300031945|Ga0310913_11042938 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300031946|Ga0310910_11210910 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031954|Ga0306926_10075406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4092 | Open in IMG/M |
| 3300031962|Ga0307479_10016866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6870 | Open in IMG/M |
| 3300031962|Ga0307479_10176609 | All Organisms → cellular organisms → Bacteria | 2099 | Open in IMG/M |
| 3300032001|Ga0306922_10314590 | All Organisms → cellular organisms → Bacteria | 1681 | Open in IMG/M |
| 3300032035|Ga0310911_10065273 | All Organisms → cellular organisms → Bacteria | 1932 | Open in IMG/M |
| 3300032055|Ga0318575_10548073 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300032059|Ga0318533_10536684 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300032059|Ga0318533_10642309 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300032205|Ga0307472_100323911 | All Organisms → cellular organisms → Bacteria | 1251 | Open in IMG/M |
| 3300032205|Ga0307472_101568564 | All Organisms → cellular organisms → Bacteria | 646 | Open in IMG/M |
| 3300032261|Ga0306920_101739578 | All Organisms → cellular organisms → Bacteria | 882 | Open in IMG/M |
| 3300032805|Ga0335078_10430836 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
| 3300032828|Ga0335080_10461757 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
| 3300032893|Ga0335069_10725163 | All Organisms → cellular organisms → Bacteria | 1127 | Open in IMG/M |
| 3300033547|Ga0316212_1000865 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3938 | Open in IMG/M |
| 3300033755|Ga0371489_0092538 | All Organisms → cellular organisms → Bacteria | 1795 | Open in IMG/M |
| 3300033755|Ga0371489_0121666 | All Organisms → cellular organisms → Bacteria | 1476 | Open in IMG/M |
| 3300033983|Ga0371488_0113851 | All Organisms → cellular organisms → Bacteria | 1475 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 18.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 14.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 4.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 1.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.50% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.50% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.50% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300003219 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 | Environmental | Open in IMG/M |
| 3300003370 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006031 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Angelo_100 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006086 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009615 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100 | Environmental | Open in IMG/M |
| 3300009621 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150 | Environmental | Open in IMG/M |
| 3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015203 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3c, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
| 3300017936 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_1 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019882 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300022204 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_8_1 | Environmental | Open in IMG/M |
| 3300022529 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022721 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024178 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK35 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025544 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026514 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-13-B | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026547 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_124 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027049 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 72 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027625 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028145 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK04 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031474 | Fir Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032055 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f23 | Environmental | Open in IMG/M |
| 3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1008205311 | 3300002245 | Forest Soil | PSWIDFVVPIALIGLWLAFFAFNLQKLPLLPLGDPHLAEAIAPHEH* |
| JGI26341J46601_101004463 | 3300003219 | Bog Forest Soil | SAGPNPLDFVLPIALFGLWLGYFAWNLKREPLLPLGDPKLAEAIAAHEH* |
| JGI26337J50220_10266771 | 3300003370 | Bog Forest Soil | PEFYRSAAPHALDFVLPIALLGLWLAYFAWNLKREPLLPLGDPKLAGAIANEH* |
| Ga0062387_1002113601 | 3300004091 | Bog Forest Soil | PEFTARALPTWRDIVVPVALVGLWVGFFAKNLKRLPLLPLGDPKLAEAIAHDEH* |
| Ga0062389_1033717191 | 3300004092 | Bog Forest Soil | YWLTQPEFYRSAAPHALDFVLPIALLGLWLAYFAWNLKREPLLPLGDPKLAGAIANEH* |
| Ga0062386_1016314831 | 3300004152 | Bog Forest Soil | RPTWLDIVVPIALIGLWVGFFAYNLKQQPLLPLGDPKLAEAIAHHEH* |
| Ga0066685_101670091 | 3300005180 | Soil | IVLPLALGGLWLGLFAFNLRQYPLLPIGDPNLEETLEHHEH* |
| Ga0065712_106693391 | 3300005290 | Miscanthus Rhizosphere | AVLALGGIWLWFFAKQLKQQPLLPLGEPKLAEAIATHEH* |
| Ga0070674_1007055721 | 3300005356 | Miscanthus Rhizosphere | FVTILGLGGIWLWFFARQLKQQPLLPLGEPKLAEAIADHEH* |
| Ga0070703_104657842 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | WDLAAVLALGGIWLWFFAKQLKQQPLLPLGEPKLAEAIATHEH* |
| Ga0066701_109299272 | 3300005552 | Soil | LGGLWLGFFAFNLKQCPLLPLGDPDLAEAIERHEH* |
| Ga0066661_108990082 | 3300005554 | Soil | PLALGGLWLGFFAFNLKQCPLLPLGDPKLAEAIEHHEH* |
| Ga0066704_102730303 | 3300005557 | Soil | ALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIANHEH* |
| Ga0066691_108855302 | 3300005586 | Soil | ALGGLWLGFFAFNLKQCPLLPLGDPKLEEAIEQHHE* |
| Ga0068866_113796102 | 3300005718 | Miscanthus Rhizosphere | LALGGLWFGVFAWQLQQRPLLPLGDPKLEEAIERHEY* |
| Ga0066903_1016841753 | 3300005764 | Tropical Forest Soil | GGIWLWFFARQLKQQPLLPLGEPKLAEAIANHEH* |
| Ga0070717_107224593 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | ALPTLWDVATILALGGIWLWFFAVQLQQQPLLPLGEPKLAEAIANHEH* |
| Ga0066651_108153421 | 3300006031 | Soil | LALGGIWLWFVAVQLKQQPLLPLGEPKLAEAIANHEH* |
| Ga0075026_1010716271 | 3300006057 | Watersheds | LGGIWLGFFAFNLKQCPILPLGDPKLAEAIEHHEH* |
| Ga0075019_103759481 | 3300006086 | Watersheds | VPIALVGLWLGLFATNLKQRPLLPLGDPNLSEALAQHEH* |
| Ga0075018_104503921 | 3300006172 | Watersheds | LVVPIALMGLWLGFFAWNLKREPLFPLGDPKLAEVIGHNDH* |
| Ga0070712_1005114301 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | FTSRALPTLWDIAAILALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIGNHEH* |
| Ga0070765_1001264084 | 3300006176 | Soil | LIGIWLGYFAWNLKREPLLPLGDPKLAEAIAHHEH* |
| Ga0070765_1008556591 | 3300006176 | Soil | WRDFVTPVALIGIWVGFFALNLKQRPILPLGDPKLAEVLAAHHEH* |
| Ga0079222_102569031 | 3300006755 | Agricultural Soil | LGGLWVWFFARQLKQMPLLPLGDPKLAEAIAHNEH* |
| Ga0079222_113061353 | 3300006755 | Agricultural Soil | AAPLALIGLWIFVFAGQLKRMPLLPLGDPKLEEAIEQHEY* |
| Ga0066665_102184903 | 3300006796 | Soil | PIALGGLWLGYFAFNLKQLPLLPLGDPKLAEAIEHHEH* |
| Ga0079221_117846972 | 3300006804 | Agricultural Soil | LGGLWLGFFAFNLRQCPLLPLGDPDLAEAIKNHEH* |
| Ga0075434_1020492412 | 3300006871 | Populus Rhizosphere | ALGGLWLGFFAFNLRQCPLLPLGDPDLAEAIKNREH* |
| Ga0075424_1014855991 | 3300006904 | Populus Rhizosphere | GGLWFGVFAWQLQQRPLLPLGDPKLEEAIEHHEY* |
| Ga0099791_101736153 | 3300007255 | Vadose Zone Soil | ALPTLWDIAAILALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIANHEH* |
| Ga0099791_102897823 | 3300007255 | Vadose Zone Soil | ALGGLWLGVFAFNLKQMPLLPLGDPKLAEAIEHHEH* |
| Ga0099794_101824223 | 3300007265 | Vadose Zone Soil | LGGLWFFFFTGQLKQLPVLPVGDPKLAEAIEIHEH* |
| Ga0099794_105441542 | 3300007265 | Vadose Zone Soil | PTLWDIAAILALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIANHEH* |
| Ga0099829_1000269910 | 3300009038 | Vadose Zone Soil | VLPLALGGLWLGLFAFNLRQYPLLPIGDPNLEETLEHHEH* |
| Ga0099829_107050373 | 3300009038 | Vadose Zone Soil | MAAGGLWLFFFAGQLKQLPLLPLGDPKLAEAIAHHEH* |
| Ga0099830_117050361 | 3300009088 | Vadose Zone Soil | VALIGLWLGFFAMNLKQRPLLPVGDPNLSEALAQNEH* |
| Ga0099828_114103012 | 3300009089 | Vadose Zone Soil | IGGLWLFFFARQLKELPLLPLNDPKLAEAIETHEH* |
| Ga0066709_1031213472 | 3300009137 | Grasslands Soil | LDLLLPIALGSLWLGFFAFNLKQCPLLPLGDPELAEAIEHHEH* |
| Ga0099792_105627151 | 3300009143 | Vadose Zone Soil | LGGLWLGFFAFNLKQCPLLPLGDPDLAEAIEHHEH* |
| Ga0116225_11620853 | 3300009524 | Peatlands Soil | SSSALPTWLDIVVPIALIGLWVGFFAFNLKQQPLLPLGDPKLAEAIAHHEH* |
| Ga0116103_11404751 | 3300009615 | Peatland | SSALPTWLDIVVPIALIGLWVGFFAFNLQQQPLLPLGDPKLAEAIAHHEH* |
| Ga0116116_10201071 | 3300009621 | Peatland | LPTWLDIVVPIALIGLWVGFFAFNLQQQPLLQLGVPKLAEAIAHHEH* |
| Ga0116112_10102991 | 3300009636 | Peatland | PEFSSSALPTWLDIVVPIALIGLWIGFFALNLKQQPLLPLGDPKLAEAIAHHER* |
| Ga0126373_125008042 | 3300010048 | Tropical Forest Soil | ALGGLWLGFFAFNLKQCPLLPLGDPKLEEAIEHHEH* |
| Ga0134084_100852693 | 3300010322 | Grasslands Soil | LGGLWLGFFAFNLKHCPLLPLGDPVLAEAIGHLEH* |
| Ga0074046_108143741 | 3300010339 | Bog Forest Soil | VGLWLGFFAMNLKQRPLLPLGDPKLAEAIAHHEH* |
| Ga0074045_102218193 | 3300010341 | Bog Forest Soil | WMTRPEFSSSALPTWLDIVVPIALIGLWVGFFAFHLKQQPLLPLGDPKLAEAIAHHEH* |
| Ga0126381_1002140395 | 3300010376 | Tropical Forest Soil | PVALVGLWVGSFAMNLKQRPLLPLGDPKLAEAMAQNEH* |
| Ga0136449_1032701932 | 3300010379 | Peatlands Soil | PEFSSSALPTWLDIVVPIALIGLWVGFFAFNLKQQPLLPLGDPKLAEAIAHHEH* |
| Ga0150983_138206232 | 3300011120 | Forest Soil | IGLWLGFFAWNLKREPLFPLGDPKLAEVIAPNEH* |
| Ga0137392_109415121 | 3300011269 | Vadose Zone Soil | DFATILGLGGIWLWFFAVQLKQRPLLPLGEPKLAEAIANDEH* |
| Ga0137389_101282954 | 3300012096 | Vadose Zone Soil | PIALGGLWLGFFAFNLKQCPLLPLGDPDLAEAIEHHEH* |
| Ga0137388_105016623 | 3300012189 | Vadose Zone Soil | GGLWLFVFAGQLKQLPLLPLGDPKLAEAIEHHEH* |
| Ga0137388_107425843 | 3300012189 | Vadose Zone Soil | LAAPLALGGLWLFVFAGQLKQLPLLPLGDPKLAEAIQHHEH* |
| Ga0137388_117113692 | 3300012189 | Vadose Zone Soil | LALGGLWLGFFAFNLKQCPLLPLGDPDLPEAIKHHEH* |
| Ga0137381_102528343 | 3300012207 | Vadose Zone Soil | IVLPLALGGLWLGFFAFNLKQCPLLPLGDPDLPEAIKHHEH* |
| Ga0137381_115199671 | 3300012207 | Vadose Zone Soil | LGGLWLGYFAFNLKQLPLLPLGDPKLAEAIEHHEH* |
| Ga0137387_109295471 | 3300012349 | Vadose Zone Soil | LGGLWLGFFAFNLKQCPLLPLGDPELAEAIERHEH* |
| Ga0137385_101015785 | 3300012359 | Vadose Zone Soil | FGGLWLGLFAFNLRQLPLLPLGDPELAEAIEHHEH* |
| Ga0137385_103170493 | 3300012359 | Vadose Zone Soil | LPIALGGLWLGFFAFNLRQCPLLPLGDLHLAEAIKNREH* |
| Ga0137397_103782391 | 3300012685 | Vadose Zone Soil | IVLPLALGGLWLGLFAFNLRQYPLLPIGDPSLLETLEHHEH* |
| Ga0137397_108595171 | 3300012685 | Vadose Zone Soil | LALGGLWFFFFTGQLKQLPVLPVGDPKLAEAIEVHEH* |
| Ga0137395_101106474 | 3300012917 | Vadose Zone Soil | GGLWFFFFTGQLKQLPVLPVGDPKLAEAIEIHEH* |
| Ga0137359_101688291 | 3300012923 | Vadose Zone Soil | VPVALIGLWLGFFAMNLKQRPLLPVGDPNLSEVLAPNEQ* |
| Ga0137359_107681133 | 3300012923 | Vadose Zone Soil | PLALGGLWLGLFAFNLRQYPLLPIGDPNLEETLEHHEH* |
| Ga0137359_117294451 | 3300012923 | Vadose Zone Soil | LALGGIWLWFFAVQVKEQPLLPLGEPKLAEAIANHEH* |
| Ga0137413_108479171 | 3300012924 | Vadose Zone Soil | VVVPVALIGLWLGFFAMNLKQRPMLPVGDPNLSEVLAPNEH* |
| Ga0137419_113708372 | 3300012925 | Vadose Zone Soil | IVLPLALGGLWLGLFAFNLRRYPLLPIGDPHLEETLEHHEH* |
| Ga0137416_104788061 | 3300012927 | Vadose Zone Soil | PLALGGLWLGFFAFNLKQCPLLPLGDPDLPEAMEHHEH* |
| Ga0164303_113941361 | 3300012957 | Soil | ALPSWLDVVVPVTLGGLWFGVFAKNLKSEPLLPLGDPKLQEAIEVHEY* |
| Ga0164302_101248743 | 3300012961 | Soil | CLDLYWLTRPEFTLQALPTLLDLAALAGLGGMWLWFFAFQLKQRPLLPLGVPELAEAIANHEH* |
| Ga0134077_103580932 | 3300012972 | Grasslands Soil | GAVLALGGIWLWFFAVQLKQRPLLPLGEPKLAEAIANHEH* |
| Ga0134087_100383211 | 3300012977 | Grasslands Soil | FTSRAVPTWLDLLLPIALGSLWLGFFAFNLKQCPLLPLGDPELAEAIEHHEH* |
| Ga0157375_106772081 | 3300013308 | Miscanthus Rhizosphere | LGGIWLWFFAKQLKQQPLLPLGEPKLAEAIANHEH* |
| Ga0137414_11305724 | 3300015051 | Vadose Zone Soil | DLAAALALGGLWFFFFTGQLKQLPVLPVGDPKLAEAIEVHEH* |
| Ga0137420_10386445 | 3300015054 | Vadose Zone Soil | GGLWFFVFAGQLKQLPLLPLGDPKLAEAIEHHEH* |
| Ga0167643_10397652 | 3300015089 | Glacier Forefield Soil | DIILPIALPIALLGIWLGFFAWNLKREPLLPLGDPHLAEAIASHEH* |
| Ga0167650_10782991 | 3300015203 | Glacier Forefield Soil | PMPTWLDLVVPVALFGLWLGFFIYNLKQAPLLPLGDSKLEEAISHHEH* |
| Ga0137412_108177033 | 3300015242 | Vadose Zone Soil | IGLWLGFFAMNLKQRPMLPVGDPNLSEVLAPNEH* |
| Ga0137403_111351771 | 3300015264 | Vadose Zone Soil | ALAVGGLWFFFFAGQLKQLPVLPVGDPKLAEAIANEH* |
| Ga0132258_117775514 | 3300015371 | Arabidopsis Rhizosphere | VLALGGIWLWFFAKQLKQQPLLPLGEPKLAEAIANHEH* |
| Ga0132255_1034263613 | 3300015374 | Arabidopsis Rhizosphere | PLALGGLWFGVFAWQLKQMPLLPLGDPKLEEAIASDEQ* |
| Ga0182033_106804113 | 3300016319 | Soil | PEFTSNALPSLWDVATLLALGGIWLWFFALQLKQLPLLPLGEPKLAEAIANNEH |
| Ga0182040_113369192 | 3300016387 | Soil | VDLYWMTRPEFTRSAVPGWIDIVAPIALTGLWVGFFAMNLKQRPVLPLGDPKLGEVLLAQHEH |
| Ga0182039_102831703 | 3300016422 | Soil | ADLATILGLGGIWLWFFARQLKQQPLLPLGEPKLAEAIADHEH |
| Ga0187818_105044481 | 3300017823 | Freshwater Sediment | VALTGLWTGFFAFNLKQRPILPLGDPKLAEVLAHHEH |
| Ga0187803_100615311 | 3300017934 | Freshwater Sediment | RMIVFRLVDLYWMKRAEFTVKALPNWLDIVVPVALVGLWVGFFAMNLKQRPLRPLGDPKLAEAVAQDEH |
| Ga0187803_104385702 | 3300017934 | Freshwater Sediment | PVPNWRDFIVPIALVGLWVGFFALNLKQQPLLPLGDPKLAEAIAHHEH |
| Ga0187821_102928491 | 3300017936 | Freshwater Sediment | VPSWFDIVVPVTLIGLWLGFFARNLKSQPLLPLGDPKLDEAIEVHEY |
| Ga0187778_104111451 | 3300017961 | Tropical Peatland | ALVGLWLGFFAKNLKQRPLLPLGDPKLAEAMAQHEH |
| Ga0187777_111369252 | 3300017974 | Tropical Peatland | VPIALGGLWAGFFAFNLKQLPLLPLGEPKLAEAIEHHEH |
| Ga0187782_114326901 | 3300017975 | Tropical Peatland | FTSRAWPTWLDIVVPIALIGLWVGFFAYNLKQQPLLPLGDPKLAEAIAHHEH |
| Ga0187767_100694991 | 3300017999 | Tropical Peatland | EFTARALPTWLDIVVPVALIGLWVGFFAMNLKQWPLLPLGDPKLAEAVAHHEH |
| Ga0187881_100825571 | 3300018024 | Peatland | MTRPEFSSSALPTWLDIVVPIALIGLWVGFFAFNLKQQPLLPLGDPKLAEAIAHHEH |
| Ga0066655_100743751 | 3300018431 | Grasslands Soil | ALGGLWLGFFAFNLRRCPLLPLGDPDLAEAIKNHEH |
| Ga0066667_103569323 | 3300018433 | Grasslands Soil | GLGGLWFWFFAMQLKQRPLLPLGDPKLQEAIANNDH |
| Ga0066662_101076854 | 3300018468 | Grasslands Soil | IVLPLALGGLWLGFFAFNLKQCPLLPLGDPDLAGAIEHHEH |
| Ga0182028_10974211 | 3300019788 | Fen | SLFLVVPIALIGLWVGFFALNLKQPPLLPLGDPKLAEAIAHHEH |
| Ga0193713_11293841 | 3300019882 | Soil | DVAAILALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIANHEH |
| Ga0210407_102678881 | 3300020579 | Soil | DIVVPIALIGLWLGSFARNLKQRPLLPLGDPNLSEALAQHEH |
| Ga0210399_100942254 | 3300020581 | Soil | VLALAGIWFAVFARNLKSQPLLPLGDPKLEEAIEVHEY |
| Ga0210399_105434723 | 3300020581 | Soil | EHGVRFTWLDLVVPTALIGLWLGFFAWNLKREPLFPLGDPKLPEVIEQHEH |
| Ga0210388_105164821 | 3300021181 | Soil | VALIGLWIGFFARNLKQRPLLPLGDPKLEEAIAHHEH |
| Ga0210397_112716421 | 3300021403 | Soil | LDFVLPIALVGLWLGFFAWNLKREPLLPLGDPHLAEAIASHEH |
| Ga0210387_102108024 | 3300021405 | Soil | MDVAAILALAGIWFAVFARNLKTQPLLPLGDPKLEEAIEVHEY |
| Ga0210387_109623163 | 3300021405 | Soil | GVILALAGIWFAVFARNLKSQPLLPLGDPKLEEAIEVHEY |
| Ga0210386_103462991 | 3300021406 | Soil | ALAGIWFAVFARNLKAQPLLPLGDPKLEEAIEVHEY |
| Ga0210384_109474903 | 3300021432 | Soil | ALISLWVGFFAMNLKQQPLLPLGDPKLAEAIGSHEH |
| Ga0210398_113839302 | 3300021477 | Soil | AILALAGIWFAVFARNLKTQPLLPLGDPQLEEAIEVHEH |
| Ga0210402_108086451 | 3300021478 | Soil | AALLALGGLWFFVFAGQLKQLPLLPLGDPKLAEAIEHHEH |
| Ga0210402_118580871 | 3300021478 | Soil | GLILALAGIWFAVFARNLKSQPLLPLGDPKLEEAIEVHEY |
| Ga0224496_100560881 | 3300022204 | Sediment | LAAVGGLWFGVFAAQLRKRTLLPVGEPHLEEALEA |
| Ga0242668_11203501 | 3300022529 | Soil | VPVALIGLWMGFFAMNLKQRPLLPVGDPNLSEVLAQNEH |
| Ga0212123_100846001 | 3300022557 | Iron-Sulfur Acid Spring | IALIGLWLAFFAFNLQKLPLLPLGDPKLAEAIAHHEHP |
| Ga0242666_10472363 | 3300022721 | Soil | AILVLAGIWFAVFARNLKTQPLLPLGDPKLEEAIEVHEY |
| Ga0247694_10347782 | 3300024178 | Soil | PLALGGLWLGFFARNLKSQPLLPLGDPKLEEAIEIHEF |
| Ga0137417_10493464 | 3300024330 | Vadose Zone Soil | LALGGLWFFFFAGQLKQLPVLPVGDPKLAEAIANEH |
| Ga0208078_10322763 | 3300025544 | Arctic Peat Soil | VVPIALIGLWVGYFAFNLQQLPLLPLGDPKLAEAIAHHEH |
| Ga0207699_100492074 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | ALPTLWDIGAVLALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIGNHEH |
| Ga0207699_103204893 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | AAVLAAAGLWFFFFAGNLKQLPVLPVGDPNLAEAIAHEH |
| Ga0207684_104071461 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VLALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIANHEH |
| Ga0207686_108262313 | 3300025934 | Miscanthus Rhizosphere | TILGLGGIWLWFFARQLKQQPLLPLGEPKLAEAIANHEH |
| Ga0207665_104543333 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | LGGLWFWFFAAQLKRRPLLPLGDPKLEEAIASNDH |
| Ga0207641_100083208 | 3300026088 | Switchgrass Rhizosphere | PTLWDLAAVLALGGIWLWFFAKQLKQQPLLPLGEPKLAEAIANHEH |
| Ga0209240_10839463 | 3300026304 | Grasslands Soil | TYHALPTLWDIAAILALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIANHEH |
| Ga0209802_13261662 | 3300026328 | Soil | PLGIGGIWLFWFAKQLKDRPLLPLGDPGLEEAIERHEH |
| Ga0209158_10475324 | 3300026333 | Soil | DIVLPLALGGLWLGLFAFNLRQYPLLPIGDPNLEETLEHHEH |
| Ga0257168_10927121 | 3300026514 | Soil | ILALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIANHEH |
| Ga0209690_12720122 | 3300026524 | Soil | GLGGLWLWFFAMQLKQRPLLPLGDPKLEEAIASDEH |
| Ga0209807_10102131 | 3300026530 | Soil | LGGLWLGFFAFNLKQCPLLPLGDPDLAEAIEHHEH |
| Ga0209056_101310464 | 3300026538 | Soil | LGGLWLGYFAFNLKQLPLLPLGDPKLAEAIEHHEH |
| Ga0209156_101063461 | 3300026547 | Soil | VALGGLWLGFFAFNLKQSPLFPVGDPKLGEAIEQHHEH |
| Ga0179587_107250551 | 3300026557 | Vadose Zone Soil | LGGLWLAFFAFNLKQCPLLPLGDPKLAEAIEHHEH |
| Ga0207806_10318832 | 3300027049 | Tropical Forest Soil | WLDIVVPVALIGLWAGFFANNLKRMPLLPLGDPKLGEAIAHHEH |
| Ga0209106_10314181 | 3300027616 | Forest Soil | IALIGLWLAFFAFNLQKLPLLPLGDPHLAEAIAPHEH |
| Ga0209106_10600461 | 3300027616 | Forest Soil | LGGLWLGLFAFNLRQYPLLPIGDPNLEETLEHHEH |
| Ga0208044_11616602 | 3300027625 | Peatlands Soil | PTWLDIVVPIALIGLWVGFFAFNLKQQPLLPLGDPKLAEAIAHHEH |
| Ga0209076_10967323 | 3300027643 | Vadose Zone Soil | VLPLGLGGLWLGFFAFNLKQCPLLPLGDPDLAEAIEHHEH |
| Ga0209011_11698722 | 3300027678 | Forest Soil | PIALGGLWLGLFAFNLKQYPLLPIGDPDLAETLEHHEH |
| Ga0209178_11626043 | 3300027725 | Agricultural Soil | ALGGLWLSLFARNLKSQPLLPLGDPKLEEAIEVHEY |
| Ga0209248_100165164 | 3300027729 | Bog Forest Soil | APLALGGLWLFFFSWQLQKMPLLPLGDPKLAEAIANHEH |
| Ga0209248_102356051 | 3300027729 | Bog Forest Soil | LTQPEFYRSAAPHALDFVLPIALLGLWLAYFAWNLKREPLLPLGDPKLAGAIANEH |
| Ga0209773_101646603 | 3300027829 | Bog Forest Soil | FVPTAFPKPLNFLLPIALLGLWLGYFAWNLKRDPLLPLGDPKLAEAIASHEH |
| Ga0209517_103767763 | 3300027854 | Peatlands Soil | WLDIVVPIALIGLWVGFFAYNLKQQPLLPLGDPKLAEAIAHHEH |
| Ga0209701_107005662 | 3300027862 | Vadose Zone Soil | LGLVGLWLWYFAGQLKQQPLLPLGEPKLAEAIGQNEH |
| Ga0209167_107509652 | 3300027867 | Surface Soil | APAYPTWVDIAVPLALIGLWLAVFAWNLKAMPLLPLGDPKLAEAIEVHEF |
| Ga0209275_108576282 | 3300027884 | Soil | LAGIWFAVFARNLKTQPLLPLGDPKLEEAIEVHEY |
| Ga0209068_103484481 | 3300027894 | Watersheds | VLPLGLGGLWLGFFAFNLKQCPILPLGDPKLAEAIEHHEH |
| Ga0209583_106696081 | 3300027910 | Watersheds | ALIGLWVGFFAMNLQQRPLLPLGDPNLAEALAHDEH |
| Ga0209526_108583882 | 3300028047 | Forest Soil | MDLAAILALAGIWFAVFARNLKTQPLLPLGDPKLEEAIEVHEY |
| Ga0247663_10468553 | 3300028145 | Soil | LAGLGGMWLWFFAFQLKQRPLLPLGEPKLAEAIANHEH |
| Ga0137415_104615033 | 3300028536 | Vadose Zone Soil | IVLPIGLGGIWLGFFAFNLKQCPILPLGDPKLAEAIEHHEH |
| Ga0302228_100656331 | 3300028808 | Palsa | DIYWLTQPEFNLTAWPKPLNLVTPIAVLGIWLGYFAWNLKREPLLPLGDPKLAGAIANHE |
| Ga0308309_106813083 | 3300028906 | Soil | FTSSALPDWRDFVTPVALIGIWVGFFALNLKQRPILPLGDPKLAEVLAAHHEH |
| Ga0073994_122873471 | 3300030991 | Soil | LGGLWLGFFAFNLKQCPLLPVGDPKLAEAIEHHEH |
| Ga0170834_1079886521 | 3300031057 | Forest Soil | LGGIWLWFFALQLKQRPLLPLGEPKLAEAIANHEH |
| Ga0170834_1124955281 | 3300031057 | Forest Soil | LAGIWFAFFAWNLKSQPLLPLGDPKLEEAIEVHEY |
| Ga0170820_140622843 | 3300031446 | Forest Soil | IALIGLWLAFFAFNLQKLPLLPLGDPKLAEAIAHHEHH |
| Ga0170818_1101546871 | 3300031474 | Forest Soil | IALIGLWLAFFAFNLQKLPLLPLGDPKLAEAIAHHEH |
| Ga0318538_107753721 | 3300031546 | Soil | VPIALFGLWLGFFAMNLKQRPLLPLGDPKLAEAIAHHEH |
| Ga0318574_107476511 | 3300031680 | Soil | VVPVALIGLWVGFFAMNLKQQPLLPLGDPKLAEAIAHHEY |
| Ga0310686_1074696153 | 3300031708 | Soil | ALSGIWFAVFARNLKTQPLLPLGDPKLEEAIEVHEF |
| Ga0310686_1098638583 | 3300031708 | Soil | FPGALNILLPIALLGIWLGYFAWNLKREPLLPLGDPKLAEAIASHEH |
| Ga0310686_1098679113 | 3300031708 | Soil | FPGALNILLPIALLGIWLGYFAWNLKREPLLPLGDPKLAEAILSHEH |
| Ga0307474_102231781 | 3300031718 | Hardwood Forest Soil | RDAMPNSLDFVLPIALVGLWLGFFAWNLKREPLLPLGDPHLAEAIASHEH |
| Ga0307474_110669102 | 3300031718 | Hardwood Forest Soil | YRNALPNALDFVLPIALIGIWLGYFAWNLKREPLLPLGDPKLAEAIAQHEH |
| Ga0307474_115421281 | 3300031718 | Hardwood Forest Soil | WDIAAILALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIANHEH |
| Ga0307474_115473651 | 3300031718 | Hardwood Forest Soil | LPIALVGLWLGFFAWNLKREPLLPLGDPHLAEAIASHEH |
| Ga0307469_103658493 | 3300031720 | Hardwood Forest Soil | PIALGGLWLGLFAFNLKQYPLLPIGDPNLEEVLEHHEH |
| Ga0307469_110920263 | 3300031720 | Hardwood Forest Soil | ALGGLWFFVFAGQLKQLPLLPLGDPKLAEAIEHHEH |
| Ga0306918_100396675 | 3300031744 | Soil | LPIALGGLWLGFFAFNLKQCPLLPLGDPELAEAIEHHEH |
| Ga0306918_112418841 | 3300031744 | Soil | VALLGLWVGFFARNLKQRPLLPLGDPNLAEAVAQHEH |
| Ga0307477_104316653 | 3300031753 | Hardwood Forest Soil | WDISTILALGGIWLWFFAVQLKQQPLLPLGEPKLAEAIANHEH |
| Ga0307477_104807943 | 3300031753 | Hardwood Forest Soil | DFVVPIALIGLWLAFFAFNLQKLPLLPLGDPHLAEAIAPHEH |
| Ga0307475_100770491 | 3300031754 | Hardwood Forest Soil | LDLAAPLAVVGLWLFFFAFNLKQMPLLPLGDPKLEEAIAHDEH |
| Ga0318543_104528032 | 3300031777 | Soil | VALVGLWVGSFAMNLKQRPLLPLGDPKLAEAIAHEH |
| Ga0307473_110708752 | 3300031820 | Hardwood Forest Soil | LWDFAAIFALGGIWLWFFAVQLKQMPLLPLGEPKLAEAIANHEH |
| Ga0306919_111059181 | 3300031879 | Soil | VPVALVGLWLAGFALNLKQRPLLPLGDPNLSEALAQHEH |
| Ga0310916_115864492 | 3300031942 | Soil | VAFGGLWLGFFAFNLKQCPLLPLGDPDLAEAIKNHEH |
| Ga0310913_110429381 | 3300031945 | Soil | EFTSNALPSLWDVATLLALGGIWLWFFALQLKQLPLLPLGEPKLAEAIANNEH |
| Ga0310910_112109101 | 3300031946 | Soil | IALGGLWLGFFAFNLKQYPLLPLGDPKLAEAIEHHEH |
| Ga0306926_100754061 | 3300031954 | Soil | FWMTRPEFTARALPTWLDLVVPVALIGLWVGFFAMNLKQQPLLPLGDPKLAEAIAHHEY |
| Ga0307479_100168669 | 3300031962 | Hardwood Forest Soil | LTRPEFTYHALPTLWDVATILALGGIWLWFFAVQLQQQPLLPLGEPKLAEAIANHEH |
| Ga0307479_101766091 | 3300031962 | Hardwood Forest Soil | WDLAAVLALGGLWFFVFAGQLKQLPLLPLGDPKLAEAIEHHEH |
| Ga0306922_103145904 | 3300032001 | Soil | WTRPEFTSNALPSLWDVATLLALGGIWLWFFALQLKQLPLLPLGEPKLAEAIANNEH |
| Ga0310911_100652731 | 3300032035 | Soil | VALIGLWVGFFAMNLKQQPLLPLGDPKLAEAIAHHEY |
| Ga0318575_105480731 | 3300032055 | Soil | VPIALVGLWLGFFAMNLKQRPLLPLGDPNLAEAIAHHEH |
| Ga0318533_105366841 | 3300032059 | Soil | LGGLWLWFFAMQLKQLPLFPLGEPKLAEAIAHHEH |
| Ga0318533_106423091 | 3300032059 | Soil | VRFTWMDLVVPVALIGLWIGVFAWQLQREPVLPLGDPKLAEVIAPHEH |
| Ga0307472_1003239111 | 3300032205 | Hardwood Forest Soil | ALIGLWIGFFARNLKQRPLLPLGDPKLEEAIAHHEH |
| Ga0307472_1015685642 | 3300032205 | Hardwood Forest Soil | LGGIWLWFFAVQLKRQPLLPLGEPKLAEAIEHHEH |
| Ga0306920_1017395783 | 3300032261 | Soil | NALPSLWDFAALLALGGLWLWFFAKQLKQLPLFPLGEPKLAEAIAHHEH |
| Ga0335078_104308364 | 3300032805 | Soil | FPNAPAYPSWVDIAVPLALIGLWLAVFAWNLKAMPLLPLGDPKLTEAIEVHEY |
| Ga0335080_104617571 | 3300032828 | Soil | VPVALTCLWLGFFAMNLKQRPVLPLGDPKLEEVLAHHEQ |
| Ga0335069_107251631 | 3300032893 | Soil | VPVGLVGVWVGFFAMNLKQRPLLPLGDPKLAEAIGNEH |
| Ga0316212_10008651 | 3300033547 | Roots | LALAGIWFAVFARNLKTQPLLPLGDPHLEEAIEVHEH |
| Ga0371489_0092538_1679_1795 | 3300033755 | Peat Soil | PIALIGLWVGFFAFNLKQQPLLPLGDPKLAEAIAHHEH |
| Ga0371489_0121666_21_194 | 3300033755 | Peat Soil | MTRPEFSSSALPTGLDIIVPIALIGLWVGFFAYNLKQQPLLPLGDPKLAEAIAHHEH |
| Ga0371488_0113851_1332_1475 | 3300033983 | Peat Soil | LPTGLDIIVPIALIGLWVGFFALNLKQQPLLPLGDPKLAEAIAHHEH |
| ⦗Top⦘ |