| Basic Information | |
|---|---|
| Family ID | F025815 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 42 residues |
| Representative Sequence | MNEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRSGRE |
| Number of Associated Samples | 167 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 85.43 % |
| % of genes near scaffold ends (potentially truncated) | 98.50 % |
| % of genes from short scaffolds (< 2000 bps) | 91.50 % |
| Associated GOLD sequencing projects | 159 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.35 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (28.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.27% β-sheet: 0.00% Coil/Unstructured: 88.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.35 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF00072 | Response_reg | 91.00 |
| PF00512 | HisKA | 7.00 |
| PF03060 | NMO | 0.50 |
| PF03544 | TonB_C | 0.50 |
| PF01584 | CheW | 0.50 |
| PF02895 | H-kinase_dim | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0643 | Chemotaxis protein histidine kinase CheA | Signal transduction mechanisms [T] | 1.00 |
| COG0516 | IMP dehydrogenase/GMP reductase | Nucleotide transport and metabolism [F] | 0.50 |
| COG0810 | Periplasmic protein TonB, links inner and outer membranes | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG2070 | NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase family | General function prediction only [R] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.50 % |
| Unclassified | root | N/A | 0.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2199352024|deeps__Contig_68389 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 653 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101927368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_105629425 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2067 | Open in IMG/M |
| 3300001593|JGI12635J15846_10272246 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1074 | Open in IMG/M |
| 3300001686|C688J18823_10365910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 937 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100251080 | All Organisms → cellular organisms → Bacteria | 1656 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101500892 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300002558|JGI25385J37094_10159833 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300002561|JGI25384J37096_10093015 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300004082|Ga0062384_100744160 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300004091|Ga0062387_101202401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300004091|Ga0062387_101531106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300004092|Ga0062389_101818057 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300004092|Ga0062389_102161456 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 731 | Open in IMG/M |
| 3300004152|Ga0062386_101774116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300005175|Ga0066673_10738746 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 565 | Open in IMG/M |
| 3300005332|Ga0066388_104412685 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300005332|Ga0066388_107958206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300005518|Ga0070699_101545920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 608 | Open in IMG/M |
| 3300005536|Ga0070697_100539671 | All Organisms → cellular organisms → Bacteria | 1022 | Open in IMG/M |
| 3300005542|Ga0070732_10376983 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300005542|Ga0070732_10924838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 533 | Open in IMG/M |
| 3300005555|Ga0066692_10219544 | All Organisms → cellular organisms → Bacteria | 1195 | Open in IMG/M |
| 3300005559|Ga0066700_10448699 | All Organisms → cellular organisms → Bacteria | 905 | Open in IMG/M |
| 3300005586|Ga0066691_10400482 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300005607|Ga0070740_10273842 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 683 | Open in IMG/M |
| 3300005610|Ga0070763_10915141 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300005952|Ga0080026_10163114 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 649 | Open in IMG/M |
| 3300006052|Ga0075029_101225514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300006173|Ga0070716_100449467 | All Organisms → cellular organisms → Bacteria | 939 | Open in IMG/M |
| 3300006794|Ga0066658_10531299 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300006797|Ga0066659_11391810 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300006806|Ga0079220_10807013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300006903|Ga0075426_11226982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 569 | Open in IMG/M |
| 3300009137|Ga0066709_100900043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1289 | Open in IMG/M |
| 3300009143|Ga0099792_10532642 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300009177|Ga0105248_11342868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 809 | Open in IMG/M |
| 3300009545|Ga0105237_10649783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1061 | Open in IMG/M |
| 3300009698|Ga0116216_10344023 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 907 | Open in IMG/M |
| 3300010043|Ga0126380_10222608 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1283 | Open in IMG/M |
| 3300010159|Ga0099796_10582509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300010304|Ga0134088_10029700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2460 | Open in IMG/M |
| 3300010321|Ga0134067_10007951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2932 | Open in IMG/M |
| 3300010336|Ga0134071_10367998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 729 | Open in IMG/M |
| 3300010343|Ga0074044_10443043 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 850 | Open in IMG/M |
| 3300010343|Ga0074044_11011634 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 545 | Open in IMG/M |
| 3300010358|Ga0126370_11062286 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 744 | Open in IMG/M |
| 3300010358|Ga0126370_11517933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300010359|Ga0126376_10870242 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 888 | Open in IMG/M |
| 3300010359|Ga0126376_12207778 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 595 | Open in IMG/M |
| 3300010359|Ga0126376_12525013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
| 3300010360|Ga0126372_12208473 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300010361|Ga0126378_13069601 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300010366|Ga0126379_10244146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1763 | Open in IMG/M |
| 3300010376|Ga0126381_101895883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 860 | Open in IMG/M |
| 3300010376|Ga0126381_102336297 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 768 | Open in IMG/M |
| 3300011120|Ga0150983_12210159 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300011120|Ga0150983_13469951 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 516 | Open in IMG/M |
| 3300011270|Ga0137391_10712002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300012096|Ga0137389_10109481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2208 | Open in IMG/M |
| 3300012189|Ga0137388_11027893 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 760 | Open in IMG/M |
| 3300012199|Ga0137383_10952945 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300012202|Ga0137363_10311824 | All Organisms → cellular organisms → Bacteria | 1294 | Open in IMG/M |
| 3300012202|Ga0137363_10824779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 787 | Open in IMG/M |
| 3300012206|Ga0137380_10778205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300012357|Ga0137384_11240791 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 591 | Open in IMG/M |
| 3300012359|Ga0137385_11032874 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300012363|Ga0137390_10011861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 7771 | Open in IMG/M |
| 3300012582|Ga0137358_10703374 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 676 | Open in IMG/M |
| 3300012685|Ga0137397_10175952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1589 | Open in IMG/M |
| 3300012917|Ga0137395_10628063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 777 | Open in IMG/M |
| 3300012918|Ga0137396_10649999 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300012922|Ga0137394_11560421 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300012927|Ga0137416_12059013 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300012929|Ga0137404_10822616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300012929|Ga0137404_12229694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300012930|Ga0137407_10944570 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 816 | Open in IMG/M |
| 3300012960|Ga0164301_10522728 | All Organisms → cellular organisms → Bacteria | 861 | Open in IMG/M |
| 3300014166|Ga0134079_10063776 | All Organisms → cellular organisms → Bacteria | 1328 | Open in IMG/M |
| 3300015051|Ga0137414_1052083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 522 | Open in IMG/M |
| 3300015053|Ga0137405_1118446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 630 | Open in IMG/M |
| 3300016294|Ga0182041_10702543 | All Organisms → cellular organisms → Bacteria | 897 | Open in IMG/M |
| 3300017823|Ga0187818_10162609 | All Organisms → cellular organisms → Bacteria | 972 | Open in IMG/M |
| 3300017930|Ga0187825_10030924 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1804 | Open in IMG/M |
| 3300017930|Ga0187825_10122831 | All Organisms → cellular organisms → Bacteria | 907 | Open in IMG/M |
| 3300017932|Ga0187814_10353364 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300017933|Ga0187801_10228378 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 743 | Open in IMG/M |
| 3300017942|Ga0187808_10515276 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300017947|Ga0187785_10332828 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 709 | Open in IMG/M |
| 3300017993|Ga0187823_10124086 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300018026|Ga0187857_10325106 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
| 3300018047|Ga0187859_10387912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300018060|Ga0187765_10985004 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 577 | Open in IMG/M |
| 3300018085|Ga0187772_11411693 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300018088|Ga0187771_10924446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| 3300018433|Ga0066667_12188232 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300019268|Ga0181514_1310840 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300019880|Ga0193712_1041022 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
| 3300019890|Ga0193728_1346289 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300020062|Ga0193724_1056384 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 828 | Open in IMG/M |
| 3300020140|Ga0179590_1050831 | All Organisms → cellular organisms → Bacteria | 1068 | Open in IMG/M |
| 3300020170|Ga0179594_10070036 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300020579|Ga0210407_11096994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300020580|Ga0210403_10038879 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3804 | Open in IMG/M |
| 3300020580|Ga0210403_10665671 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 836 | Open in IMG/M |
| 3300020581|Ga0210399_11310699 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300020582|Ga0210395_10001391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 18756 | Open in IMG/M |
| 3300020583|Ga0210401_10697350 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300021086|Ga0179596_10582878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300021088|Ga0210404_10881381 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 512 | Open in IMG/M |
| 3300021170|Ga0210400_10488041 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
| 3300021170|Ga0210400_10827127 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300021178|Ga0210408_10044914 | All Organisms → cellular organisms → Bacteria | 3461 | Open in IMG/M |
| 3300021180|Ga0210396_11342548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 593 | Open in IMG/M |
| 3300021180|Ga0210396_11640499 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300021401|Ga0210393_10318119 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300021401|Ga0210393_10491936 | All Organisms → cellular organisms → Bacteria | 1002 | Open in IMG/M |
| 3300021404|Ga0210389_10380872 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
| 3300021404|Ga0210389_11008802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300021405|Ga0210387_11622712 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300021406|Ga0210386_11253563 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300021407|Ga0210383_10634688 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300021407|Ga0210383_10717169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 859 | Open in IMG/M |
| 3300021420|Ga0210394_10263907 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1508 | Open in IMG/M |
| 3300021479|Ga0210410_10003888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 13204 | Open in IMG/M |
| 3300021479|Ga0210410_10053039 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3536 | Open in IMG/M |
| 3300022532|Ga0242655_10298295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300024284|Ga0247671_1093674 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300024286|Ga0247687_1000894 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3562 | Open in IMG/M |
| 3300024330|Ga0137417_1084884 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 864 | Open in IMG/M |
| 3300025915|Ga0207693_10289084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1284 | Open in IMG/M |
| 3300025927|Ga0207687_10350719 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300025929|Ga0207664_11518512 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300025939|Ga0207665_10482677 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300026035|Ga0207703_11965800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300026281|Ga0209863_10038277 | All Organisms → cellular organisms → Bacteria | 1437 | Open in IMG/M |
| 3300026298|Ga0209236_1034260 | All Organisms → cellular organisms → Bacteria | 2680 | Open in IMG/M |
| 3300026301|Ga0209238_1059459 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
| 3300026304|Ga0209240_1291830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300026329|Ga0209375_1003516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10897 | Open in IMG/M |
| 3300026331|Ga0209267_1120101 | All Organisms → cellular organisms → Bacteria | 1107 | Open in IMG/M |
| 3300026331|Ga0209267_1337096 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300026524|Ga0209690_1179616 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 703 | Open in IMG/M |
| 3300026552|Ga0209577_10338789 | All Organisms → cellular organisms → Bacteria | 1111 | Open in IMG/M |
| 3300026557|Ga0179587_10524846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300026823|Ga0207759_109641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
| 3300027504|Ga0209114_1034902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 857 | Open in IMG/M |
| 3300027562|Ga0209735_1007820 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2019 | Open in IMG/M |
| 3300027565|Ga0209219_1063044 | All Organisms → cellular organisms → Bacteria | 923 | Open in IMG/M |
| 3300027604|Ga0208324_1098413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 819 | Open in IMG/M |
| 3300027610|Ga0209528_1107181 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300027645|Ga0209117_1158268 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 589 | Open in IMG/M |
| 3300027654|Ga0209799_1037635 | All Organisms → cellular organisms → Bacteria | 1077 | Open in IMG/M |
| 3300027671|Ga0209588_1016350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2289 | Open in IMG/M |
| 3300027671|Ga0209588_1274135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300027738|Ga0208989_10101667 | All Organisms → cellular organisms → Bacteria | 978 | Open in IMG/M |
| 3300027768|Ga0209772_10101002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 887 | Open in IMG/M |
| 3300027826|Ga0209060_10537566 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300027862|Ga0209701_10344479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 845 | Open in IMG/M |
| 3300027862|Ga0209701_10502408 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300027879|Ga0209169_10069014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1827 | Open in IMG/M |
| 3300027889|Ga0209380_10481673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 724 | Open in IMG/M |
| 3300027894|Ga0209068_10651393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
| 3300028047|Ga0209526_10354380 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300028047|Ga0209526_10937980 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300028146|Ga0247682_1042387 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 817 | Open in IMG/M |
| 3300028536|Ga0137415_10049763 | All Organisms → cellular organisms → Bacteria | 4068 | Open in IMG/M |
| 3300029636|Ga0222749_10302577 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 827 | Open in IMG/M |
| 3300031057|Ga0170834_103873436 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 529 | Open in IMG/M |
| 3300031122|Ga0170822_14575537 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300031240|Ga0265320_10108234 | All Organisms → cellular organisms → Bacteria | 1275 | Open in IMG/M |
| 3300031469|Ga0170819_16863589 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300031564|Ga0318573_10509041 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300031718|Ga0307474_10915460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 694 | Open in IMG/M |
| 3300031720|Ga0307469_11129982 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300031720|Ga0307469_11373504 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 673 | Open in IMG/M |
| 3300031720|Ga0307469_12278172 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300031754|Ga0307475_10134965 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1951 | Open in IMG/M |
| 3300031754|Ga0307475_11496701 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300031754|Ga0307475_11513575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300031768|Ga0318509_10411880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300031792|Ga0318529_10314029 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 730 | Open in IMG/M |
| 3300031823|Ga0307478_11322472 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 599 | Open in IMG/M |
| 3300031910|Ga0306923_10533283 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300031941|Ga0310912_10615735 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300031959|Ga0318530_10434880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
| 3300031962|Ga0307479_11754211 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300031962|Ga0307479_12177976 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300032044|Ga0318558_10530390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 588 | Open in IMG/M |
| 3300032051|Ga0318532_10039555 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1597 | Open in IMG/M |
| 3300032063|Ga0318504_10608162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 525 | Open in IMG/M |
| 3300032174|Ga0307470_11166915 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
| 3300032180|Ga0307471_102383883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300032205|Ga0307472_100821744 | All Organisms → cellular organisms → Bacteria | 851 | Open in IMG/M |
| 3300032205|Ga0307472_101518560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300032261|Ga0306920_104233006 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300032782|Ga0335082_10705157 | All Organisms → cellular organisms → Bacteria | 871 | Open in IMG/M |
| 3300033289|Ga0310914_10493422 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300033405|Ga0326727_10425223 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 17.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.00% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.50% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.50% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2199352024 | Bare-fallow DEEP SOIL | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005607 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005952 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-045 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010321 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09212015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300014166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09182015 | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017930 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_5 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017933 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_1 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
| 3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300019268 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019880 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3a1 | Environmental | Open in IMG/M |
| 3300019890 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c1 | Environmental | Open in IMG/M |
| 3300020062 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a1 | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024284 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK12 | Environmental | Open in IMG/M |
| 3300024286 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK28 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300026823 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 19 (SPAdes) | Environmental | Open in IMG/M |
| 3300027504 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027604 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027610 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027768 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Host-Associated | Open in IMG/M |
| 3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031792 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032051 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f26 | Environmental | Open in IMG/M |
| 3300032063 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f17 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| deeps_01075540 | 2199352024 | Soil | MTMNPFLHLEPLAADESTGSLLEALGPMEERHPESQYCVFRSGRERLCLPVL |
| INPhiseqgaiiFebDRAFT_1019273681 | 3300000364 | Soil | MTEDFQLAPLPPDADTAEMLEAIGPLEERPAESQYCV |
| INPhiseqgaiiFebDRAFT_1056294254 | 3300000364 | Soil | MSEDFHLVPLPTDADSGDLLEALGPIEERVPESQY |
| JGI12635J15846_102722463 | 3300001593 | Forest Soil | MNPFLHLEPLSADESTGSLLEALGPMEERRPQSQYCVFRSGRERLCLPV |
| C688J18823_103659103 | 3300001686 | Soil | MFDDFHLTPLSANADSAELLEALGPLEEPSAESQFCVFRSGRERFCLP |
| JGIcombinedJ26739_1002510804 | 3300002245 | Forest Soil | MSEDFHLAPLPADADDLLEALGPMEERLPESQYCVFRSGRERFCLPV |
| JGIcombinedJ26739_1015008922 | 3300002245 | Forest Soil | MNPFLHLEPLAADESTGSLLEALGPMEERRPQSQYCVFRS |
| JGI25385J37094_101598331 | 3300002558 | Grasslands Soil | MNEDFHLVPLPAEADTDLLEALGPTEERPPESQYCVFRSGRERFCL |
| JGI25384J37096_100930153 | 3300002561 | Grasslands Soil | MSEDFHLEPLPADAATGELLEALGPIEERAPESQYCVFRSGRER |
| Ga0062384_1007441601 | 3300004082 | Bog Forest Soil | MNDDFQLTPLPADADVVEMLEALGPMVERAPESQHCVFRSGRERFS |
| Ga0062387_1012024012 | 3300004091 | Bog Forest Soil | MFEDFHLTPLAANADADDLLEALGPLDDSPAESQFCVFRSGRERFC |
| Ga0062387_1015311061 | 3300004091 | Bog Forest Soil | MSDEFQLTPLPADAEVVEMLEALGPMVERAPESQYCVFRSGRERFSLPV |
| Ga0062389_1018180572 | 3300004092 | Bog Forest Soil | MNEEFHLTPLSPEADALEMLEALGPLAEPRPESQFCVFRSGRERFC |
| Ga0062389_1021614562 | 3300004092 | Bog Forest Soil | MSEDFHLAPLPADAEDLLEALGPTMEERLPESQYCVFRSGRERF |
| Ga0062386_1017741162 | 3300004152 | Bog Forest Soil | MNEDFHLVPMPADAEMVDLLEALGPIAERPPESQYCVFRSGRERFCLPV |
| Ga0066673_107387462 | 3300005175 | Soil | MMNDEFQLAPLPPDADTAEMLEAIGPLEERPAESQYCVFRSG |
| Ga0066388_1044126852 | 3300005332 | Tropical Forest Soil | VSESTNNEEFQLAPISPDADTAELLEALGPLDDRTPESQYCVF |
| Ga0066388_1079582061 | 3300005332 | Tropical Forest Soil | MSEDFHLEPLPADAESDQLLEALGGLEERSPESQYCVFRSGRERFCLPVLD |
| Ga0070699_1015459201 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MNDEFQLAPLPPDADTAEMLEAIGPLEEPPAESQYCVFRSG |
| Ga0070697_1005396713 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDDFHLTPLSANADSADLLEALGPLEEPSAESQYCVFRSGRERFC |
| Ga0070732_103769833 | 3300005542 | Surface Soil | MNEDFHLTPLAADIDAADLLEALGPMEERPPESQYCVFRSGRERF |
| Ga0070732_109248381 | 3300005542 | Surface Soil | MNEDFHLTPLAADADSADLLEALGPMEVRPPESQYCVFRSGRERFCF |
| Ga0066692_102195441 | 3300005555 | Soil | MSEDFHLEPLPAEADTGDLLEALGPVEERPPESQYCVFRSGR |
| Ga0066700_104486993 | 3300005559 | Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRSGRERFCL |
| Ga0066691_104004823 | 3300005586 | Soil | MTEDFYLTPLAADTDSADLLEALGPLEDRPPESQYCVFR |
| Ga0070740_102738421 | 3300005607 | Surface Soil | MPMNEDFHLAPVPADADSGDLLEALGAMEERPPESQYCVFRSG |
| Ga0070763_109151412 | 3300005610 | Soil | MNEDFHLAPLPADAEMGDLLESLGPLGERAPESQYCVFRSGRERFCF |
| Ga0080026_101631142 | 3300005952 | Permafrost Soil | MNEDFHLTPLSANADAMDLLEALGPLDDSPAESQFCVFRSGR |
| Ga0075029_1012255142 | 3300006052 | Watersheds | MNEDFHLAPLPADAEIGDLLESLGSLGERPPESQYCVFRSGRERF |
| Ga0070716_1004494671 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEDFHLAPLPADAEMGDLLESLGPLGERPPESQYCVFR |
| Ga0066658_105312992 | 3300006794 | Soil | MNEDFHLIPMAADADTADLLEALGPLEERPPESQYCVFRSGRERFC |
| Ga0066659_113918102 | 3300006797 | Soil | LETEQTVSDDFHLEPLPADADTGELLEARGPIEDRAP |
| Ga0079220_108070131 | 3300006806 | Agricultural Soil | MSEDFHLEPLPADADTGDLLEALGPVEERPPESQYCVFRSGRERFC |
| Ga0075426_112269821 | 3300006903 | Populus Rhizosphere | MNDEFQLTPLSPDADTAELLEALGPLDERAPESQYCVFRSGRE |
| Ga0066709_1009000433 | 3300009137 | Grasslands Soil | MMNDEFQLAPLPPDADTAEMLNAIGPLEERPAESQYCLFRSRRARLCL |
| Ga0099792_105326421 | 3300009143 | Vadose Zone Soil | MNEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRS |
| Ga0105248_113428681 | 3300009177 | Switchgrass Rhizosphere | MTEDFQLAPLPPDADTAEMLEAIGPLEERPAESQYCVFRSGRERF |
| Ga0105237_106497831 | 3300009545 | Corn Rhizosphere | MFDDFHLTPLSANADSADLLEALGPLEEPSAESQYCVFRSGRERFCL |
| Ga0116216_103440231 | 3300009698 | Peatlands Soil | MSEDFHLVPLPADADTTDLLEALGPIEERPPESQYCVFRSGRERFC |
| Ga0126380_102226083 | 3300010043 | Tropical Forest Soil | MNEDFHLTPLPADAETGDLLEALGPLEERAPESQYCVFR |
| Ga0099796_105825092 | 3300010159 | Vadose Zone Soil | MNEDFHLEPLPADADTGDLLEALGPVEERAPESQYCVFRS |
| Ga0134088_100297004 | 3300010304 | Grasslands Soil | MSEDFHLEPLPADADTGDLLEALGPIEERSPESQYCVF |
| Ga0134067_100079511 | 3300010321 | Grasslands Soil | MNDDFHLEPLPADADTGELLEALGPIKDRPPESQFCVFRSGRERFC |
| Ga0134071_103679981 | 3300010336 | Grasslands Soil | MSDDFHLEPLPADADTGELLEALGPIEDRSPESQF |
| Ga0074044_104430431 | 3300010343 | Bog Forest Soil | MNEDFHLEPISGEADGLDLLEAMEATEERTPESQFCVFRS |
| Ga0074044_110116341 | 3300010343 | Bog Forest Soil | MSEDFHLVPLPADADDLLEALGPMEERLPESQYCVFRSGR |
| Ga0126370_110622862 | 3300010358 | Tropical Forest Soil | MNEDFHLTPMAADADTADLLEALGPLEERPPESQYCVFRSG |
| Ga0126370_115179331 | 3300010358 | Tropical Forest Soil | MNEDFHLTPLPADAETGDLLEALGPLEERSPESQYCV |
| Ga0126376_108702421 | 3300010359 | Tropical Forest Soil | MNDDFQLTPLAADAELGELLEALEASAAERAPESQYCVFRSGRERF |
| Ga0126376_122077781 | 3300010359 | Tropical Forest Soil | MNEDFHLTPLPADAGTGDLLEALGPLEERPPESQYC |
| Ga0126376_125250131 | 3300010359 | Tropical Forest Soil | MNEDFQLAPLSPDADTAELLEALGPLEERAPESQYCVFRSGRERFCLP |
| Ga0126372_122084732 | 3300010360 | Tropical Forest Soil | MTDDFQLTPLPPDADTAEMLEAIGPLEERPAESQYCVFRSGRERFCLPV |
| Ga0126378_130696011 | 3300010361 | Tropical Forest Soil | MAMSDDFHLEPLPGDADTDELLEALGPIEDRAPESQFCVFRSGRERFCLPV |
| Ga0126379_102441461 | 3300010366 | Tropical Forest Soil | MIEDFHRAALPPDADTAEMLEAIGRLEERPAESQYCVFRSGRERF |
| Ga0126381_1018958833 | 3300010376 | Tropical Forest Soil | MTDEFQLAPLPPDADTAEMLEAIGPLEERPAESQYCVFRSG |
| Ga0126381_1023362973 | 3300010376 | Tropical Forest Soil | MNNEEFQLAPLSPDADTAELLEALGPLEERTPESQYCVFR |
| Ga0150983_122101591 | 3300011120 | Forest Soil | MNEDFHLSPLAADADSADLLEALGPLEDRPPESQCAGLHEK* |
| Ga0150983_134699512 | 3300011120 | Forest Soil | MNEEFHLTPLPTDADTGELLEALGPIEERLPESQYCVFRSGRE |
| Ga0137391_107120023 | 3300011270 | Vadose Zone Soil | MNEDFHLVPLPAETDTGDLLEALGPIEERPPELQYCVFRSGRERFC |
| Ga0137389_101094811 | 3300012096 | Vadose Zone Soil | MSEKTEAMSEEFHLTPLSADADTGELLEALGPTEERPPESQYCVFRSGR |
| Ga0137388_110278931 | 3300012189 | Vadose Zone Soil | MNEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRSGRE |
| Ga0137383_109529451 | 3300012199 | Vadose Zone Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRS |
| Ga0137363_103118241 | 3300012202 | Vadose Zone Soil | MMNDEFQLAPLPPDADTAEMLQAIGPLEERPAESQYCVFRSG |
| Ga0137363_108247793 | 3300012202 | Vadose Zone Soil | MNDEFQLTPLSPDADTAELLEALGPLEERAPESQYCVFRS |
| Ga0137380_107782051 | 3300012206 | Vadose Zone Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRSGRERFC |
| Ga0137384_112407911 | 3300012357 | Vadose Zone Soil | MNDEFQLAPLPPDADTAEMLEAIGPLEERPAESQYCVFRSGR |
| Ga0137385_110328742 | 3300012359 | Vadose Zone Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRS* |
| Ga0137390_100118618 | 3300012363 | Vadose Zone Soil | MSEDFHLTPLAADADAADLLEALGPMEDRPPESQYCVFRSGRERF |
| Ga0137358_107033742 | 3300012582 | Vadose Zone Soil | MNDEFQLAPLPPDADTAEMLEAIGPLEERPAESQYCVFR |
| Ga0137397_101759524 | 3300012685 | Vadose Zone Soil | MNDEFQLAPLPPDADTAEMLQAIGPLEERPAESQYCVF |
| Ga0137395_106280633 | 3300012917 | Vadose Zone Soil | MSEDFHLEPLPAEADTGDLLEALGPVEERPPESQYCVFR |
| Ga0137396_106499991 | 3300012918 | Vadose Zone Soil | MSEDFHLTPLAADADAADLLEALGPMEDRPPESQYCVF |
| Ga0137394_115604212 | 3300012922 | Vadose Zone Soil | MSEDFHLVPLPADADSGDLLEALGPIEERPPESQY |
| Ga0137416_120590132 | 3300012927 | Vadose Zone Soil | MNEDFHLTPLAADADSADLLEALGPMEDRPPESQY |
| Ga0137404_108226161 | 3300012929 | Vadose Zone Soil | MNEDFHLTPLAADADAADLLEALGPLEDRPPESQYCVFRSGRE |
| Ga0137404_122296941 | 3300012929 | Vadose Zone Soil | MMNDEFQLAPLPPDADTAEMLEAIGPLEERPAESQYCVFRS |
| Ga0137407_109445701 | 3300012930 | Vadose Zone Soil | MNEDFQLAALPPDADTAEMLEAIGPLEERPAESQYCVFR |
| Ga0164301_105227281 | 3300012960 | Soil | MINDEFQLAPLPPDADTAEMLEAIGPLEERPAESQYC |
| Ga0134079_100637763 | 3300014166 | Grasslands Soil | MSDDFHLEPLPADADTGELLEALGPIEDRSPESQFCVFRSGRER |
| Ga0137414_10520831 | 3300015051 | Vadose Zone Soil | MNEDFHLTPLAADADAADLLEALGPLEDRPPESQYCVFRSGRERFWLLFS |
| Ga0137405_11184461 | 3300015053 | Vadose Zone Soil | MNEDFHLMPLPADAETGDLLEALGPIDIRPPESQYCVFRSGRAGANAFACR |
| Ga0182041_107025433 | 3300016294 | Soil | MNEDFHLAPLPADAEMGDLLESLGPLGERPPESQYCVFRSGR |
| Ga0187818_101626093 | 3300017823 | Freshwater Sediment | MNEEFHLTPLPADADTGELLEALGPIEERPPESQYCVFRS |
| Ga0187825_100309244 | 3300017930 | Freshwater Sediment | MSEDFHLTPLSADVESTDLLEALGPVEERAPESQYCVFRSG |
| Ga0187825_101228311 | 3300017930 | Freshwater Sediment | MNDDFHLVPLPADADDLLEALGPIEERAPESQYCVFRSGRER |
| Ga0187814_103533641 | 3300017932 | Freshwater Sediment | MSDDFQLTPLPADAEVGEKLEALGNVTERPPESQYCV |
| Ga0187801_102283781 | 3300017933 | Freshwater Sediment | MNDDFQLTPLPADAEVGEMLEALGNLTERPPESQYCVFRS |
| Ga0187808_105152761 | 3300017942 | Freshwater Sediment | MNEDFQLTPIPADAEMGELLEALGPVGDRPPESQYCV |
| Ga0187785_103328281 | 3300017947 | Tropical Peatland | MSDDFQLKPIPANAEIGELLEALGPVTERPPESQYCVFRSGRER |
| Ga0187823_101240861 | 3300017993 | Freshwater Sediment | MSEDFHLAPLPADADDLLEALGPMEERLPESQYCVFRSGR |
| Ga0187857_103251061 | 3300018026 | Peatland | MIEDFHLTPLSANADAADLLEALGPLEDSPAESQYCVFRSGRERF |
| Ga0187859_103879122 | 3300018047 | Peatland | MIEDFHLTPLSANADAADLLEALGPLEDSPAESQYC |
| Ga0187765_109850042 | 3300018060 | Tropical Peatland | MNQDFHLTPLPADAETADLLEALGPLEERPPESQYCVFRS |
| Ga0187772_114116932 | 3300018085 | Tropical Peatland | MNEDFHLAPLPPAEADELLEALGPSEERSPESQYCVFRSGR |
| Ga0187771_109244461 | 3300018088 | Tropical Peatland | MNDDFQLTPVPADAELGEMLEALAPVGERAPESQFVVFRSGRERFCFPVLD |
| Ga0066667_121882321 | 3300018433 | Grasslands Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRSGRE |
| Ga0181514_13108401 | 3300019268 | Peatland | MSEDFHLVPLPADADDLLEALGLMEERPPESQYVVFRSGRERF |
| Ga0193712_10410221 | 3300019880 | Soil | MMNEDFHLEPLPADADAGDLLEALGPEEDEAPETQ |
| Ga0193728_13462891 | 3300019890 | Soil | MNPFLHLEPLSADESTGSLLEALGPMEERQPQSQY |
| Ga0193724_10563843 | 3300020062 | Soil | MNPFLHLEPLAADESTGSLLEALGPMEERRPQSQY |
| Ga0179590_10508311 | 3300020140 | Vadose Zone Soil | MSDDFHLLPIAADADATEMLEALGTLEQSTPESQFCVFRSGRERFCLPV |
| Ga0179590_11516251 | 3300020140 | Vadose Zone Soil | MSEEFQLTPIPADAELGELLEAMDPGVERTPESQYCVFRSGRERFC |
| Ga0179594_100700361 | 3300020170 | Vadose Zone Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVF |
| Ga0210407_110969942 | 3300020579 | Soil | MSEDFHLAPLPADADLLEALGPMEERLPESQYCVFRS |
| Ga0210403_100388796 | 3300020580 | Soil | MNEDFHLVPLPAEADTGDLLEALGPIEERAPESQYC |
| Ga0210403_106656713 | 3300020580 | Soil | MNEDFHLTPLAADTDAADLLEALGPLEERPPESQYCVFRSG |
| Ga0210399_113106991 | 3300020581 | Soil | MNEDFHLTPLAADADAADLLEALGPLEERPPESQYCVFRS |
| Ga0210395_1000139119 | 3300020582 | Soil | MSEDFHLAPLPADADDLLEALGPMEERLPESQYCVFRSGRERYCSP |
| Ga0210401_106973501 | 3300020583 | Soil | MSEDFHLVPLPADADTADLLEALGPMEERPPESQYCVF |
| Ga0179596_105828781 | 3300021086 | Vadose Zone Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRSG |
| Ga0210404_108813812 | 3300021088 | Soil | MNEEFHLTPLPADADTGELLEALGPTEERPPESQYCVFR |
| Ga0210400_104880411 | 3300021170 | Soil | MNEDFHLTPLPADAETGDLLEALGPLEERPPESQYC |
| Ga0210400_108271271 | 3300021170 | Soil | MIEDFHLTPLAADADASDLLEALGPLEERPPESQFCVF |
| Ga0210408_100449141 | 3300021178 | Soil | MNEDFHLVPLPAEADTGDLLEALGPIEERAPESQYCVFRSGRERFC |
| Ga0210396_113425481 | 3300021180 | Soil | MNEDFHLSPLAADADSADLLEALGPLEDRPPESQYCVFRSGRERF |
| Ga0210396_116404991 | 3300021180 | Soil | MIEDFHLTPLSANADAADLLEALGPLEDSPAESQYCVFRSGRERFCLP |
| Ga0210393_103181191 | 3300021401 | Soil | MSEDFHLAPLPADADDLLEALGPMEERLPESQYCVFRSGRERYCFP |
| Ga0210393_104919363 | 3300021401 | Soil | MTEDFQLVPLPPDADTAEMLEAIGPLEERQAESQYCVF |
| Ga0210389_103808721 | 3300021404 | Soil | MFEDFHLTPLAANADADDLLEALGPLDDGPAESQFC |
| Ga0210389_110088021 | 3300021404 | Soil | MNEDFHLAPLPADAEMGDLLESLGPLGERPPESQYCVFRSG |
| Ga0210387_116227122 | 3300021405 | Soil | MTEDFQLVPLPPDADTAEMLEAIGPLEERPAESQYCVFRSGRERFC |
| Ga0210386_112535631 | 3300021406 | Soil | MFEDFHLTPLAANADADDLLEALGPLDDSPAESQFCVFRSGRERFCLP |
| Ga0210383_106346883 | 3300021407 | Soil | MTEDFQLVPLPPDADTAEMLEAIGPLEERQAESQYCVFRSGRERFCLP |
| Ga0210383_107171693 | 3300021407 | Soil | MMDEFHLTPLAANADSADLLEALGPLEESPAESQFCVFRSGRERFCLPV |
| Ga0210394_102639071 | 3300021420 | Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRSGR |
| Ga0210410_1000388813 | 3300021479 | Soil | MSEDFHLVPLPADADTADLLEALGPMEERPPESQYCVFRS |
| Ga0210410_100530395 | 3300021479 | Soil | MSEDFHLAPLPADADDLLEALGPMEERLPESQYCVFRSGRER |
| Ga0242655_102982952 | 3300022532 | Soil | MNEDFHLMPLPADAETGDLLEALGPIDVRPPESQYCVFRSGRE |
| Ga0247671_10936742 | 3300024284 | Soil | MNDEFQLTPLSPDADTAELLEALGPLEERAPESQYCVF |
| Ga0247687_10008941 | 3300024286 | Soil | MNEDFHLVPLPADADDLLEALGPMEERLPESQYCVFRSGRERFCLP |
| Ga0137417_10848841 | 3300024330 | Vadose Zone Soil | MNEDFHLTPLAADADAADLLEALGPLEERPPESQYCVFRSGRERFGRERFCFPVL |
| Ga0207693_102890844 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MFDDFHLTPLSANADSADLLEALGPLEEPSAESQYCVFRSGRE |
| Ga0207687_103507193 | 3300025927 | Miscanthus Rhizosphere | MFDDFHLTPLSANADSADLLEALGPLEEPSAESQYCVFRSGRERFCLPVL |
| Ga0207664_115185122 | 3300025929 | Agricultural Soil | MNEDFHLTPLAADADAADLLEALGPLEERPPESQYCV |
| Ga0207665_104826773 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEDFHLAPLPADAEMGDLLESLGPLGERPPESQYCVFRSGRERF |
| Ga0207703_119658002 | 3300026035 | Switchgrass Rhizosphere | VPFAVLLRTNEPMTEDFQLAPLPPDADTAEMLEAIGPLEERPAESQYCVFRSGRERFCLP |
| Ga0209863_100382773 | 3300026281 | Prmafrost Soil | MNPFLHLEPLSADESTGSLLEALGPMEERHPESQYCVFRSGRERLCLPVLQ |
| Ga0209236_10342601 | 3300026298 | Grasslands Soil | MSEDFHLVPLPADADSGDLLEALGPIEERPPESQYCVFRSG |
| Ga0209238_10594591 | 3300026301 | Grasslands Soil | MNDEFQLTPLSPDADTAELLEALGPLEERAPESQYCVFRSG |
| Ga0209240_12918301 | 3300026304 | Grasslands Soil | MNEDFQLIALPPDADTAEMLEAIGPLEERPAESQYCVFRS |
| Ga0209375_10035164 | 3300026329 | Soil | MSDDFHLEPLPADADTGELLEALGPIEDRSPESQFCVFRSGRERFCWEFSICAG |
| Ga0209267_11201011 | 3300026331 | Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFR |
| Ga0209267_13370962 | 3300026331 | Soil | MMNDEFQLAPLPPDADTAEMLEAIGPLEERPAESQYCVFR |
| Ga0209690_11796162 | 3300026524 | Soil | MSEDFHLEPLPADADTGDLLEALGPIEERSPESQYCVFR |
| Ga0209577_103387893 | 3300026552 | Soil | MSDDFHLEPLPADAETGDLLEALGPIDDRPPESQYCVFRSGRERF |
| Ga0179587_105248461 | 3300026557 | Vadose Zone Soil | MSEDFHLVPLPADADSGDLLEALGPIEERPPESQYCV |
| Ga0207759_1096411 | 3300026823 | Tropical Forest Soil | MSEDFQLTPLPADAEIGEILEAMGPAMDRSPESQYCVFRS |
| Ga0209114_10349021 | 3300027504 | Forest Soil | MMDEFHLTPLSANADSADLLEALGPLEESPAESQFCVFRSGRERFWKR |
| Ga0209735_10078201 | 3300027562 | Forest Soil | MSEDFHLAPLPADADDLLEALGPMEERLPESQYCVFRSGRE |
| Ga0209219_10630441 | 3300027565 | Forest Soil | MNPFLHLEPLAADESTGSLLEALGPMEERRPQSQYCVFRSGR |
| Ga0208324_10984131 | 3300027604 | Peatlands Soil | MSDDFQLAPLPADAEVGEMLEALGNVAERPPESQYCVFRSGRERFC |
| Ga0209528_11071812 | 3300027610 | Forest Soil | MNEDFHLTPLAADTDAADLLEALGPMEERPPESQYCV |
| Ga0209117_11582681 | 3300027645 | Forest Soil | MNDEFQLAPLPPDADTAEMLEAIGPLEERPAESQYCV |
| Ga0209799_10376353 | 3300027654 | Tropical Forest Soil | LKDAMNNEEFQLAPLSPDADTAALLEALGPLEDRAPESQYCVFRSGRERFCLPVLD |
| Ga0209588_10163504 | 3300027671 | Vadose Zone Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCV |
| Ga0209588_12741351 | 3300027671 | Vadose Zone Soil | MSEDFHLTPLAADADAADLLEALGPMEDRPPESQYCVFRSGRE |
| Ga0208989_101016673 | 3300027738 | Forest Soil | MNEDFYLTPLAADADAADLLEALGPLEERPPESQYCVF |
| Ga0209772_101010022 | 3300027768 | Bog Forest Soil | MSEDFHLVPLPADADDLLEALGPMEERLPESQYCVFRSGRERFCLP |
| Ga0209060_105375661 | 3300027826 | Surface Soil | MPMNEDFHLAPVPADADTGDLLEALGAMEERPPESQYC |
| Ga0209701_103444792 | 3300027862 | Vadose Zone Soil | MSEDFHLEPLPADAATGELLEALGPIEERAPESQYCVFRS |
| Ga0209701_105024083 | 3300027862 | Vadose Zone Soil | MSAADHGAMNDDFQLSPIPADADSGDLLEALGPIEDRPPESQFCVFRS |
| Ga0209169_100690144 | 3300027879 | Soil | MSEDFHLVPLPADADDLLEALGPMEERLPESQYCVFRSGRERFC |
| Ga0209380_104816732 | 3300027889 | Soil | MSEDFHLVPLPADADDLLEALGPMEERLPESQYCVFRS |
| Ga0209068_106513931 | 3300027894 | Watersheds | MSEDFHLEPLPADADTGDLLEALGPTEERPPESQYC |
| Ga0209526_103543801 | 3300028047 | Forest Soil | MSEDFHLEPLPAEAEFGDLLEAIGPISERPPESQYCVFR |
| Ga0209526_109379801 | 3300028047 | Forest Soil | MNEDFHLTPLAADADAADLLEALGPMEERPPESQYCVF |
| Ga0247682_10423871 | 3300028146 | Soil | MSEEFQLTPIPADAELGELLEAMDPGVERTPESQYCVFRSGRERFCLP |
| Ga0137415_100497636 | 3300028536 | Vadose Zone Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYC |
| Ga0222749_103025773 | 3300029636 | Soil | MNEDFHLVPLPADADDLLEALGPMEERLPESQYCVFRSGRE |
| Ga0170834_1038734362 | 3300031057 | Forest Soil | MTEDFQLVPLPPDADTAEMLEAISPLEERPAESQYCVFRSGRERFC |
| Ga0170822_145755371 | 3300031122 | Forest Soil | MNDEFQLAPLPPDADTAEMLEAIGPLEERPAESQYCVF |
| Ga0265320_101082343 | 3300031240 | Rhizosphere | MNEDFHLEPLPADAEDLLEALGPMEERLPESQYCVFRSGRERFCLPV |
| Ga0170819_168635892 | 3300031469 | Forest Soil | MEDFHLTPLSANTDSADLLEALGPMEESPAESQFCVFRSGRERFCLP |
| Ga0318573_105090411 | 3300031564 | Soil | MSDDFHLEPLPADADTGELLEALGPIEDRAPESQFCVFRS |
| Ga0307474_109154603 | 3300031718 | Hardwood Forest Soil | MMNDEFQLAPLPPDADTAEMLEAIGPLEERPAESQY |
| Ga0307469_111299821 | 3300031720 | Hardwood Forest Soil | MSDDFHLEPLPADADTGELLEALGPIEDRSPESQFCVFRSGRERF |
| Ga0307469_113735042 | 3300031720 | Hardwood Forest Soil | MNEDFHLVPLPAEADTGDLLEALGPIEERAPESQYCVFRSGRE |
| Ga0307469_122781722 | 3300031720 | Hardwood Forest Soil | MSEDFHLEPLPADADTGDLLEALGPIEERPPESQYCVFRSGRER |
| Ga0307475_101349651 | 3300031754 | Hardwood Forest Soil | MFEDFHLTPLAANADADDLLEALGPLDDSPADSQFC |
| Ga0307475_114967012 | 3300031754 | Hardwood Forest Soil | MNEDFHLTPLPADAETGDLLEALGPIDVRPPESQYCVFRSGRERF |
| Ga0307475_115135751 | 3300031754 | Hardwood Forest Soil | MNEDFHLTPLAADADSADLLEALGPLEERPPESQY |
| Ga0318509_104118803 | 3300031768 | Soil | MSEDFQLTPLPPDAEAGEILEAIGPAMDRSPESQYCVFR |
| Ga0318529_103140292 | 3300031792 | Soil | MSEEFQLTPLPPDAEMGEMLEALGPVVERPAESQYCVFRS |
| Ga0307478_113224722 | 3300031823 | Hardwood Forest Soil | MNEDFHLTPLAADADSADLLEALGPLEDRPPESQYCVFRSGRE |
| Ga0306923_105332833 | 3300031910 | Soil | MNEDFQLTPLPPDAEIGEMLEAIGPAMDRSPELQYCVFRSGRE |
| Ga0310912_106157351 | 3300031941 | Soil | MSEDFQLTPLPADAEVGEILEAIGPAMDRSPESQYCVFRSGRERFC |
| Ga0318530_104348801 | 3300031959 | Soil | MSDDFHLEPLPADADTGELLEALGPIEDRAPESQFCVFRSGRERFC |
| Ga0307479_117542111 | 3300031962 | Hardwood Forest Soil | MNEDFHLTPLAADADAADLLEALGPLEERPPESQYCVFRSGRE |
| Ga0307479_121779762 | 3300031962 | Hardwood Forest Soil | MFDDFHLTPLSANADGADLLEALGPLEEPSAESQYCVFRSGRERFCLPV |
| Ga0318558_105303901 | 3300032044 | Soil | MSEDFQLTPLPADAEVGEILEAIGPAMDRSPESQYC |
| Ga0318532_100395551 | 3300032051 | Soil | MSDDFHLEPLPADADTGELLEALGPIEDRAPESQFC |
| Ga0318504_106081622 | 3300032063 | Soil | MNDEFQLAPLPPDADTAEMLDAIGPLEERPAESQYC |
| Ga0307470_111669152 | 3300032174 | Hardwood Forest Soil | MSNSMNNEEFQLAPLSPDADTAELLEALGPLDDRTP |
| Ga0307471_1023838831 | 3300032180 | Hardwood Forest Soil | MNEDFHLAPLPADAEMGDLLESLGPLGERPPESQYCVFRS |
| Ga0307472_1008217441 | 3300032205 | Hardwood Forest Soil | MIMMNDEFQLAPLPPDADTAEMLEAIGPLEERPAESQF |
| Ga0307472_1015185602 | 3300032205 | Hardwood Forest Soil | MNEDFHLVPLPADADDLLEALGPTEERLPESQYCVFR |
| Ga0306920_1042330061 | 3300032261 | Soil | LRDAMSEEFQLPPLAPDADTAELLEALGPLDDRAPESQYCVFRS |
| Ga0335082_107051571 | 3300032782 | Soil | MNEDFQLAPMPPDADTAEMLEAIGPLDDRPVESQFCVFR |
| Ga0310914_104934221 | 3300033289 | Soil | MTDDFQLAPLPPDADTAEMLEAIGPLEERPAESQYCVFRSGRERFC |
| Ga0326727_104252233 | 3300033405 | Peat Soil | MNEEFHLAAMPSDAEMGDLLEALGPIAERPPESQYCV |
| ⦗Top⦘ |