Basic Information | |
---|---|
Family ID | F025795 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 200 |
Average Sequence Length | 41 residues |
Representative Sequence | EEGGLGIAIIRALTDEVEIGEREGGGSRLRFVKLLND |
Number of Associated Samples | 179 |
Number of Associated Scaffolds | 200 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 95.00 % |
% of genes from short scaffolds (< 2000 bps) | 90.00 % |
Associated GOLD sequencing projects | 174 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.54 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (87.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (23.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 13.85% β-sheet: 18.46% Coil/Unstructured: 67.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.54 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 200 Family Scaffolds |
---|---|---|
PF00982 | Glyco_transf_20 | 14.50 |
PF00534 | Glycos_transf_1 | 12.50 |
PF13581 | HATPase_c_2 | 4.50 |
PF00171 | Aldedh | 1.00 |
PF13551 | HTH_29 | 0.50 |
PF01040 | UbiA | 0.50 |
PF00994 | MoCF_biosynth | 0.50 |
PF01578 | Cytochrom_C_asm | 0.50 |
COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
---|---|---|---|
COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 14.50 |
COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 1.00 |
COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 1.00 |
COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 87.00 % |
Unclassified | root | N/A | 13.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2124908045|KansclcFeb2_ConsensusfromContig571259 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 570 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig815907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 645 | Open in IMG/M |
2124908045|KansclcFeb2_ConsensusfromContig975125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 543 | Open in IMG/M |
2140918008|ConsensusfromContig66922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 654 | Open in IMG/M |
2170459004|F62QY1Z01ENN0W | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300001537|A2065W1_10279811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 524 | Open in IMG/M |
3300002568|C688J35102_120441244 | All Organisms → cellular organisms → Bacteria | 1071 | Open in IMG/M |
3300004081|Ga0063454_101275568 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
3300004643|Ga0062591_102067425 | All Organisms → cellular organisms → Bacteria | 589 | Open in IMG/M |
3300005166|Ga0066674_10373178 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
3300005364|Ga0070673_100341498 | All Organisms → cellular organisms → Bacteria | 1327 | Open in IMG/M |
3300005435|Ga0070714_102119124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 548 | Open in IMG/M |
3300005439|Ga0070711_100094669 | All Organisms → cellular organisms → Bacteria | 2160 | Open in IMG/M |
3300005439|Ga0070711_101991637 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
3300005467|Ga0070706_101505639 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
3300005526|Ga0073909_10281631 | All Organisms → cellular organisms → Bacteria | 749 | Open in IMG/M |
3300005535|Ga0070684_100822695 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
3300005560|Ga0066670_10122419 | Not Available | 1488 | Open in IMG/M |
3300005561|Ga0066699_10919315 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
3300005575|Ga0066702_10934626 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
3300005587|Ga0066654_10396826 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
3300005598|Ga0066706_11370083 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 534 | Open in IMG/M |
3300005614|Ga0068856_100696703 | All Organisms → cellular organisms → Bacteria | 1036 | Open in IMG/M |
3300005719|Ga0068861_101728425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 619 | Open in IMG/M |
3300005764|Ga0066903_101413812 | All Organisms → cellular organisms → Bacteria | 1308 | Open in IMG/M |
3300005764|Ga0066903_106891605 | Not Available | 590 | Open in IMG/M |
3300005897|Ga0075281_1090832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
3300005981|Ga0081538_10365026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
3300005985|Ga0081539_10021830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4260 | Open in IMG/M |
3300006034|Ga0066656_10163811 | All Organisms → cellular organisms → Bacteria | 1398 | Open in IMG/M |
3300006046|Ga0066652_100269487 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1499 | Open in IMG/M |
3300006175|Ga0070712_101841110 | All Organisms → cellular organisms → Bacteria | 530 | Open in IMG/M |
3300006237|Ga0097621_101072967 | All Organisms → cellular organisms → Bacteria | 755 | Open in IMG/M |
3300006358|Ga0068871_100775354 | All Organisms → cellular organisms → Bacteria | 883 | Open in IMG/M |
3300006755|Ga0079222_11107642 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
3300006755|Ga0079222_12671653 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
3300006806|Ga0079220_10079161 | All Organisms → cellular organisms → Bacteria | 1644 | Open in IMG/M |
3300006864|Ga0066797_1102009 | All Organisms → cellular organisms → Bacteria | 1005 | Open in IMG/M |
3300006881|Ga0068865_100689568 | Not Available | 872 | Open in IMG/M |
3300006894|Ga0079215_10176869 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1053 | Open in IMG/M |
3300006904|Ga0075424_100245221 | All Organisms → cellular organisms → Bacteria | 1905 | Open in IMG/M |
3300006904|Ga0075424_102596511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 530 | Open in IMG/M |
3300009081|Ga0105098_10335636 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 735 | Open in IMG/M |
3300009093|Ga0105240_11767313 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
3300009094|Ga0111539_13019560 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 544 | Open in IMG/M |
3300009098|Ga0105245_10032064 | All Organisms → cellular organisms → Bacteria | 4652 | Open in IMG/M |
3300009098|Ga0105245_12357996 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
3300009098|Ga0105245_12462652 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 574 | Open in IMG/M |
3300009137|Ga0066709_102594895 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 679 | Open in IMG/M |
3300009137|Ga0066709_102662691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 668 | Open in IMG/M |
3300009553|Ga0105249_11367647 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 780 | Open in IMG/M |
3300009820|Ga0105085_1035916 | Not Available | 881 | Open in IMG/M |
3300009840|Ga0126313_10422172 | Not Available | 1060 | Open in IMG/M |
3300009840|Ga0126313_10797506 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 768 | Open in IMG/M |
3300010036|Ga0126305_10929191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 595 | Open in IMG/M |
3300010039|Ga0126309_10229268 | Not Available | 1042 | Open in IMG/M |
3300010045|Ga0126311_11746286 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 526 | Open in IMG/M |
3300010145|Ga0126321_1421443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 545 | Open in IMG/M |
3300010145|Ga0126321_1449416 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 665 | Open in IMG/M |
3300010301|Ga0134070_10049015 | Not Available | 1423 | Open in IMG/M |
3300010303|Ga0134082_10252425 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 731 | Open in IMG/M |
3300010333|Ga0134080_10560657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 551 | Open in IMG/M |
3300010337|Ga0134062_10720918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 526 | Open in IMG/M |
3300010360|Ga0126372_13286186 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 503 | Open in IMG/M |
3300010371|Ga0134125_10710131 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
3300010373|Ga0134128_12777204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 540 | Open in IMG/M |
3300010375|Ga0105239_11654053 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
3300010397|Ga0134124_11498301 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 703 | Open in IMG/M |
3300011412|Ga0137424_1010058 | Not Available | 1246 | Open in IMG/M |
3300011997|Ga0120162_1068432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 801 | Open in IMG/M |
3300012004|Ga0120134_1033861 | Not Available | 851 | Open in IMG/M |
3300012208|Ga0137376_10736093 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium HR12 | 850 | Open in IMG/M |
3300012285|Ga0137370_10297674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 963 | Open in IMG/M |
3300012349|Ga0137387_10740503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 711 | Open in IMG/M |
3300012356|Ga0137371_10892726 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 676 | Open in IMG/M |
3300012358|Ga0137368_10909876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
3300012361|Ga0137360_10545627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 990 | Open in IMG/M |
3300012391|Ga0134035_1113602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
3300012469|Ga0150984_110833480 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1024 | Open in IMG/M |
3300012505|Ga0157339_1030824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 626 | Open in IMG/M |
3300012901|Ga0157288_10065582 | Not Available | 893 | Open in IMG/M |
3300012929|Ga0137404_10744039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 889 | Open in IMG/M |
3300012951|Ga0164300_10338001 | Not Available | 803 | Open in IMG/M |
3300012957|Ga0164303_10218514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1069 | Open in IMG/M |
3300012960|Ga0164301_10438472 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
3300012985|Ga0164308_11580978 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
3300012986|Ga0164304_10276721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1138 | Open in IMG/M |
3300012986|Ga0164304_11155397 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 623 | Open in IMG/M |
3300012987|Ga0164307_11568518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
3300012989|Ga0164305_10980937 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 716 | Open in IMG/M |
3300013102|Ga0157371_11231488 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 577 | Open in IMG/M |
3300013105|Ga0157369_10696824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1046 | Open in IMG/M |
3300013105|Ga0157369_10983695 | All Organisms → cellular organisms → Bacteria | 864 | Open in IMG/M |
3300014487|Ga0182000_10425054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
3300014965|Ga0120193_10025550 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 707 | Open in IMG/M |
3300014969|Ga0157376_12883360 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
3300015077|Ga0173483_10542484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 628 | Open in IMG/M |
3300015200|Ga0173480_10122824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1292 | Open in IMG/M |
3300015357|Ga0134072_10145444 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 775 | Open in IMG/M |
3300015358|Ga0134089_10559370 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 507 | Open in IMG/M |
3300015373|Ga0132257_100046645 | All Organisms → cellular organisms → Bacteria | 4810 | Open in IMG/M |
3300015373|Ga0132257_100504342 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1485 | Open in IMG/M |
3300015374|Ga0132255_100948724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1288 | Open in IMG/M |
3300016404|Ga0182037_10919363 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 759 | Open in IMG/M |
3300017966|Ga0187776_10433142 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 886 | Open in IMG/M |
3300017974|Ga0187777_10729603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 704 | Open in IMG/M |
3300017993|Ga0187823_10118930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 808 | Open in IMG/M |
3300018000|Ga0184604_10182434 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 710 | Open in IMG/M |
3300018028|Ga0184608_10089899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1270 | Open in IMG/M |
3300018051|Ga0184620_10303530 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
3300018061|Ga0184619_10078860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1460 | Open in IMG/M |
3300018076|Ga0184609_10237412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 852 | Open in IMG/M |
3300018082|Ga0184639_10579329 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
3300019356|Ga0173481_10361602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 697 | Open in IMG/M |
3300019884|Ga0193741_1014408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2044 | Open in IMG/M |
3300020005|Ga0193697_1054573 | Not Available | 991 | Open in IMG/M |
3300020082|Ga0206353_11272742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 557 | Open in IMG/M |
3300021073|Ga0210378_10306791 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 596 | Open in IMG/M |
3300021344|Ga0193719_10392104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
3300021362|Ga0213882_10501197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
3300021415|Ga0193694_1029860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 764 | Open in IMG/M |
3300021445|Ga0182009_10331347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 773 | Open in IMG/M |
3300021510|Ga0222621_1133531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
3300022467|Ga0224712_10190582 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
3300022694|Ga0222623_10146500 | Not Available | 919 | Open in IMG/M |
3300022886|Ga0247746_1203512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 520 | Open in IMG/M |
3300022899|Ga0247795_1011192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1432 | Open in IMG/M |
3300023263|Ga0247800_1019000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1107 | Open in IMG/M |
3300024254|Ga0247661_1014053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1363 | Open in IMG/M |
3300024283|Ga0247670_1003172 | All Organisms → cellular organisms → Bacteria | 3249 | Open in IMG/M |
3300024323|Ga0247666_1008475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 2282 | Open in IMG/M |
3300025552|Ga0210142_1112058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
3300025692|Ga0209744_1007362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4245 | Open in IMG/M |
3300025865|Ga0209226_10076051 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1533 | Open in IMG/M |
3300025888|Ga0209540_10367456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 796 | Open in IMG/M |
3300025888|Ga0209540_10425700 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 717 | Open in IMG/M |
3300025911|Ga0207654_10349775 | All Organisms → cellular organisms → Bacteria | 1017 | Open in IMG/M |
3300025918|Ga0207662_10123039 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1628 | Open in IMG/M |
3300025927|Ga0207687_10261811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1379 | Open in IMG/M |
3300025928|Ga0207700_11117324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 704 | Open in IMG/M |
3300025928|Ga0207700_11820620 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 535 | Open in IMG/M |
3300025931|Ga0207644_11679439 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 532 | Open in IMG/M |
3300025934|Ga0207686_10484157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 957 | Open in IMG/M |
3300025944|Ga0207661_10184417 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Conexibacteraceae → Conexibacter → Conexibacter woesei | 1825 | Open in IMG/M |
3300025949|Ga0207667_10431508 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1340 | Open in IMG/M |
3300025960|Ga0207651_11885315 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 538 | Open in IMG/M |
3300026029|Ga0208002_1024331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 589 | Open in IMG/M |
3300026305|Ga0209688_1065256 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 658 | Open in IMG/M |
3300026305|Ga0209688_1085635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 573 | Open in IMG/M |
3300026548|Ga0209161_10377655 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 626 | Open in IMG/M |
3300027667|Ga0209009_1079273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 830 | Open in IMG/M |
3300027949|Ga0209860_1017442 | Not Available | 960 | Open in IMG/M |
3300028146|Ga0247682_1084227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 586 | Open in IMG/M |
3300028705|Ga0307276_10127012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 635 | Open in IMG/M |
3300028707|Ga0307291_1008027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2271 | Open in IMG/M |
3300028711|Ga0307293_10023842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1820 | Open in IMG/M |
3300028719|Ga0307301_10262790 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 564 | Open in IMG/M |
3300028720|Ga0307317_10014379 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2382 | Open in IMG/M |
3300028720|Ga0307317_10212559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 653 | Open in IMG/M |
3300028744|Ga0307318_10165173 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 761 | Open in IMG/M |
3300028744|Ga0307318_10326352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
3300028754|Ga0307297_10038589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1436 | Open in IMG/M |
3300028771|Ga0307320_10269094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 674 | Open in IMG/M |
3300028824|Ga0307310_10503961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 610 | Open in IMG/M |
3300028828|Ga0307312_10972129 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 562 | Open in IMG/M |
3300028828|Ga0307312_11148048 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 514 | Open in IMG/M |
3300028876|Ga0307286_10088699 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1078 | Open in IMG/M |
3300028884|Ga0307308_10327006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 734 | Open in IMG/M |
3300029984|Ga0311332_11543031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 539 | Open in IMG/M |
3300030294|Ga0311349_11138092 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 729 | Open in IMG/M |
3300030336|Ga0247826_11427528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 560 | Open in IMG/M |
3300030516|Ga0268255_10156288 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 667 | Open in IMG/M |
3300030620|Ga0302046_11145747 | Not Available | 613 | Open in IMG/M |
3300030838|Ga0311335_10245261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1206 | Open in IMG/M |
3300031184|Ga0307499_10221318 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 592 | Open in IMG/M |
3300031226|Ga0307497_10453312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 624 | Open in IMG/M |
3300031723|Ga0318493_10331365 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 825 | Open in IMG/M |
3300031747|Ga0318502_10785789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 577 | Open in IMG/M |
3300031764|Ga0318535_10331458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 680 | Open in IMG/M |
3300031858|Ga0310892_10320320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 985 | Open in IMG/M |
3300031918|Ga0311367_11103623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 791 | Open in IMG/M |
3300031938|Ga0308175_101758518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 694 | Open in IMG/M |
3300031940|Ga0310901_10279568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 694 | Open in IMG/M |
3300032065|Ga0318513_10466696 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 617 | Open in IMG/M |
3300032074|Ga0308173_11726237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 590 | Open in IMG/M |
3300032782|Ga0335082_10592569 | All Organisms → cellular organisms → Bacteria | 970 | Open in IMG/M |
3300032898|Ga0335072_11397642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 605 | Open in IMG/M |
3300033004|Ga0335084_11615763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 639 | Open in IMG/M |
3300033475|Ga0310811_11497059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 502 | Open in IMG/M |
3300033814|Ga0364930_0332108 | Not Available | 510 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 7.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.50% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.50% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.50% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.50% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.50% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.00% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.00% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.50% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.50% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.50% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.50% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.50% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.50% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.50% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 1.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.50% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.50% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.50% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.50% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.50% |
Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.50% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Soil | 0.50% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.50% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.50% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.50% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.50% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.50% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.50% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.50% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.50% |
Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.50% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.50% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.50% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.50% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.50% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.50% |
Agave | Host-Associated → Plants → Phylloplane → Unclassified → Unclassified → Agave | 0.50% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2124908045 | Soil microbial communities from Great Prairies - Kansas assembly 1 01_01_2011 | Environmental | Open in IMG/M |
2140918008 | Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_all | Environmental | Open in IMG/M |
2170459004 | Grass soil microbial communities from Rothamsted Park, UK - March 2009 indirect MP BIO 1O1 lysis 0-21cm (2) | Environmental | Open in IMG/M |
3300001537 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A20-65 cm-11A)- 1 week illumina | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
3300005587 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103 | Environmental | Open in IMG/M |
3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005897 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_10C_80N_103 | Environmental | Open in IMG/M |
3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Host-Associated | Open in IMG/M |
3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
3300006894 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Control | Environmental | Open in IMG/M |
3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
3300009081 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm May2015 | Environmental | Open in IMG/M |
3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
3300009821 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 | Environmental | Open in IMG/M |
3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
3300010036 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot26 | Environmental | Open in IMG/M |
3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
3300010145 | Soil microbial communities from Hawaii, USA to study soil gas exchange rates - KP-HI-INT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010301 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09082015 | Environmental | Open in IMG/M |
3300010303 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09182015 | Environmental | Open in IMG/M |
3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
3300011997 | Permafrost microbial communities from Nunavut, Canada - A15_80cm_18M | Environmental | Open in IMG/M |
3300012004 | Permafrost microbial communities from Nunavut, Canada - A30_5cm_6M | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
3300012391 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_20cm_5_16_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Host-Associated | Open in IMG/M |
3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
3300014487 | Bulk soil microbial communities from Mexico - Magueyal (Ma) metaG | Environmental | Open in IMG/M |
3300014965 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - T2 | Environmental | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015077 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S178-409R-2 (version 2) | Environmental | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
3300017993 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_3 | Environmental | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300020005 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m2 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021362 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R09 | Environmental | Open in IMG/M |
3300021415 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s1 | Environmental | Open in IMG/M |
3300021445 | Bulk soil microbial communities from the field in Mead, Nebraska, USA - 072115-187_1 MetaG | Environmental | Open in IMG/M |
3300021510 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_coex | Environmental | Open in IMG/M |
3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022886 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S079-202R-5 | Environmental | Open in IMG/M |
3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
3300023263 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S092-311B-6 | Environmental | Open in IMG/M |
3300024254 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK02 | Environmental | Open in IMG/M |
3300024283 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK11 | Environmental | Open in IMG/M |
3300024323 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK07 | Environmental | Open in IMG/M |
3300025552 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Goodyear_PhragC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025692 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-311 (SPAdes) | Environmental | Open in IMG/M |
3300025865 | Arctic peat soil from Barrow, Alaska, USA - Barrow Graham LP Ref core NGADG0011-212 (SPAdes) | Environmental | Open in IMG/M |
3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026029 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
3300027667 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027949 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300028146 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK23 | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
3300028720 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_357 | Environmental | Open in IMG/M |
3300028744 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_367 | Environmental | Open in IMG/M |
3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
3300028771 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
3300029984 | I_Fen_E1 coassembly | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030516 | Agave microbial communities from Guanajuato, Mexico - Or.Ma.rz (v2) | Host-Associated | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300030838 | I_Fen_N1 coassembly | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
3300031918 | III_Fen_N3 coassembly | Environmental | Open in IMG/M |
3300031938 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1 | Environmental | Open in IMG/M |
3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
3300032074 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R1 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
KansclcFeb2_02781110 | 2124908045 | Soil | GGLGIAIIQAVSDEFEAGKQAGGGSRLRFVKFLEQ |
KansclcFeb2_14890400 | 2124908045 | Soil | EGGLGIAIIKAVSDEFEAGKRANGHGSRLRFVKFLES |
KansclcFeb2_00149290 | 2124908045 | Soil | NGDLSEGGLGIEIIRAVADEVEIGEREAGGSRLRFVKFLDA |
Bog_all_C_06367850 | 2140918008 | Soil | SGLEELGDPGEGGLGLAIIRELVDDLEITEKAGGGSRLRFVKKLRD |
E4B_01556470 | 2170459004 | Grass Soil | ETDELTEGGLGIAIIEALSDELEITQRDEGGSRLRFVKKLPA |
A2065W1_102798112 | 3300001537 | Permafrost | SGDPFAADELSEGGLGIAIIEALADEFQISERAEGGSHLRFVKRF* |
C688J35102_1204412442 | 3300002568 | Soil | STKLDDDELSEGGLGIAIIEALADEFQITERAAGGSSLRFVKRLA* |
Ga0063454_1012755681 | 3300004081 | Soil | EPPAEPRLALEDDELTEGGLGIAIIRALADEFEIRERAQGGSSLRFVKHLS* |
Ga0062591_1020674251 | 3300004643 | Soil | ELEEGGLGIEIIRALTDEVEIGGREGGGSRLRFVKLLHD* |
Ga0066674_103731782 | 3300005166 | Soil | RDLEEGGLGIAIIRALADEVEIGPRETGGSKLRFVKFLTS* |
Ga0070673_1003414981 | 3300005364 | Switchgrass Rhizosphere | DGEETSELSEGGLGLAIIRSLSDEFELGSRNGGGSRLRFVKKLP* |
Ga0070714_1021191242 | 3300005435 | Agricultural Soil | DDELVEGGLGIAIIRALADELEISGREQGGSRLRFVKRLPAPIL* |
Ga0070711_1000946691 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | APLEEEELAEGGLGIAIIKALSDEFEIREGDRGGSRLRFVKRLS* |
Ga0070711_1019916372 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | LSGEGNGDLNEGGLGIAIIQAVTDEVEIGERESGGSRLRFVKFLGT* |
Ga0070706_1015056391 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | SALVDEELSEGGLGIAIIEALADEFEIRERAQGGSFLRFVKHLS* |
Ga0073909_102816312 | 3300005526 | Surface Soil | EGGLGIAIIKALSDEFEIREGDRGGSRLRFVKRLS* |
Ga0070684_1008226952 | 3300005535 | Corn Rhizosphere | LSESGLGIAIIRSLADELEIEPGEGRGSRLRFVKHLGAAA* |
Ga0066670_101224192 | 3300005560 | Soil | AIIRAIADEFELGPRNGGRGSRLRFVKLLPETAR* |
Ga0066699_109193152 | 3300005561 | Soil | DLSEGGLGIAIIRSIADELEIGPRAGGGSRLRFVKNLSDGPVTLSR* |
Ga0066702_109346262 | 3300005575 | Soil | SEGGLGIAIIRALSDELEIAERQGGGSTLRFVKHLSR* |
Ga0066654_103968262 | 3300005587 | Soil | LDDSNGHEGELEEGGLGIEIIRALADEVEIGPREEGGSRLRFVKLLPD* |
Ga0066706_113700832 | 3300005598 | Soil | GESGLGLAIIKAVSDDVEIGDRRGGGASLRFVKHLR* |
Ga0068856_1006967032 | 3300005614 | Corn Rhizosphere | NGELTEGGLGLAIIRSLTDEFELGSRNGGGSRLRFVKKLS* |
Ga0068861_1017284252 | 3300005719 | Switchgrass Rhizosphere | DPDDLSEGGLGIAIIQALADELQIGPREGGGSRLRFVKRLDTLEPA* |
Ga0066903_1014138122 | 3300005764 | Tropical Forest Soil | SEGGLGIAIIRAVSDEVEIGGRDGGGVRLRFVKLLAP* |
Ga0066903_1068916051 | 3300005764 | Tropical Forest Soil | GIAIIRALADELEIEQGDERGSRLRFVKHLGAAA* |
Ga0075281_10908322 | 3300005897 | Rice Paddy Soil | AEGGLGIAIIRALSDEFSLADGEGGGSRLRFVKRLPG* |
Ga0081538_103650261 | 3300005981 | Tabebuia Heterophylla Rhizosphere | GGLGIAIIRAVTDELSIGPRSGGHGSCLRFTKSLAS* |
Ga0081539_100218306 | 3300005985 | Tabebuia Heterophylla Rhizosphere | GGLGIAIIRAIADKVEIGRKPDGKGSRLRFEKVLGSA* |
Ga0066656_101638111 | 3300006034 | Soil | GNGDLSEGGLGIAIIQAVSDEVEIGGRESGGSRLRFVKFLGE* |
Ga0066652_1002694872 | 3300006046 | Soil | EGGLGIAIIQAVSDEFEAGKQADGGGSRLRFVKFLEQ* |
Ga0075417_101313432 | 3300006049 | Populus Rhizosphere | PEILEIQPGELDEGGLGIAIIRALTDDLSIGPRSGGTGSCLRFTKTLG* |
Ga0070712_1018411102 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | TEGGLGIAIIRSIADELDIERRETGGSRLRFVKLLEN* |
Ga0097621_1010729671 | 3300006237 | Miscanthus Rhizosphere | EGGLGIAIIQALSDEFEIREGDRGGSRLRFVKRLS* |
Ga0068871_1007753542 | 3300006358 | Miscanthus Rhizosphere | AGTGNGDLSEGGLGIAIIRAVSDEVEIDERESGGSRLRFVKFLGE* |
Ga0079222_111076422 | 3300006755 | Agricultural Soil | GDLSEGGLGIAIIRAVSDEVEIDERESGGSRLRFVKFLGE* |
Ga0079222_126716531 | 3300006755 | Agricultural Soil | PEELSEGGLGIAIIQSLPDELQIDAREGGGSRLRFVKVLEN* |
Ga0079220_100791613 | 3300006806 | Agricultural Soil | GDLSEGGLGIAIIRAVSDDVEIDERKSGGSRLRFVKFLAE* |
Ga0066797_11020092 | 3300006864 | Soil | EGGLGIAIIRAIVDDLEISEKMGGGSRLRFVKRLDS* |
Ga0068865_1006895682 | 3300006881 | Miscanthus Rhizosphere | GGLGIAIIKAVSDEFEAGEREDGQGSRLRFVKLLDS* |
Ga0079215_101768691 | 3300006894 | Agricultural Soil | GAPELDEGGLGIAIIRAVTDELQIGPRAAGPGSCLRFIKYLAQ* |
Ga0075424_1002452211 | 3300006904 | Populus Rhizosphere | EGGLGIEIIRAVTDEVEIAEREGGGSRLRFVKFLAD* |
Ga0075424_1025965112 | 3300006904 | Populus Rhizosphere | GDRPLNEGLAEGGLGIAIIQAVSDEFEAGKQPDGTGSRLRFVKFLEQ* |
Ga0105098_103356362 | 3300009081 | Freshwater Sediment | GGLGIAIIRAVADDVSIGPRPGGTGYSVRFTKRLT* |
Ga0105240_117673131 | 3300009093 | Corn Rhizosphere | NAVGDGELTEGGLGIAIIDALADELEIAPRDHGGASLRFVKKLDA* |
Ga0111539_130195602 | 3300009094 | Populus Rhizosphere | EGGLGIAIIRALTDEVEIAEREGGGSRLRFVKLLSD* |
Ga0105245_100320647 | 3300009098 | Miscanthus Rhizosphere | EGGLGIEIIRALTDEVEIAEREGGGSRLRFVKLLHD* |
Ga0105245_123579961 | 3300009098 | Miscanthus Rhizosphere | EGGLGIAIIEALADEGEITERAAGGSSLRFVKRLA* |
Ga0105245_124626521 | 3300009098 | Miscanthus Rhizosphere | GGLGIAIIRAVSDEFEAGKHADGSGSRLRFVKFLQE* |
Ga0066709_1025948951 | 3300009137 | Grasslands Soil | EGGLGIAIIEALSDELEISERPGGGSSLRFVKRLS* |
Ga0066709_1026626911 | 3300009137 | Grasslands Soil | EPADLAGVVNCDLSEGGLGIAIIRAVADEVEIDERESGGSRLRFVKFLGD* |
Ga0111538_115124281 | 3300009156 | Populus Rhizosphere | GFDPAVLERAQQALDEGGLGIAIIRAVTDELDIGPNPSGGGSRLRFTKYLN* |
Ga0105249_113676472 | 3300009553 | Switchgrass Rhizosphere | GEDTSELSEGGLGLAIIRSLSDEFELGSRNGGGSRLRFVKKLP* |
Ga0105085_10359161 | 3300009820 | Groundwater Sand | TLDEGGLGIAIIRALADDLSVGPRAGGTGYCVRFTKSLS* |
Ga0105064_11216012 | 3300009821 | Groundwater Sand | EPDPGGLDEGGLGLAIIRALTDDLSIGPRAGGTGYCVRFTKSLS* |
Ga0126313_104221722 | 3300009840 | Serpentine Soil | GLGIAIIRSLADEFEAGERPQGGGTRLRFVKFLDA* |
Ga0126313_107975062 | 3300009840 | Serpentine Soil | LDEGGLGIAIIRAVTDELDIGSNPNGGGSRLRFAKYLS* |
Ga0126305_109291912 | 3300010036 | Serpentine Soil | LDEGGLGIAIIRALTDELEIGPRPEGGSRLRFTKYLT* |
Ga0126309_102292681 | 3300010039 | Serpentine Soil | LGIAIIKAVTDEFEAGKRSTGRGSRLRFVKFLDR* |
Ga0126311_117462862 | 3300010045 | Serpentine Soil | EGGLGISIIRALTDEFELVDGARGGSRLRFVKYLES* |
Ga0126321_14214431 | 3300010145 | Soil | EGGLGIAIIRAIADKVEIGQRPQGKGSRLRFEKAFA* |
Ga0126321_14494162 | 3300010145 | Soil | EGGLGIAIIRELADELELGPAESGKGSRLRFVKFIQE* |
Ga0134070_100490152 | 3300010301 | Grasslands Soil | GDGLAEGGLGIAIIQAVSDEFEAGKQAHGGGSRLRFVKLLEQ* |
Ga0134082_102524252 | 3300010303 | Grasslands Soil | GNGDLNEGGLGIAIIRAVADEVEIGEREAGGSRLRFVKFLGD* |
Ga0134080_105606571 | 3300010333 | Grasslands Soil | GGLGIAIIRALTDELEIGSRPEGGSRLRFTKLLA* |
Ga0134062_107209181 | 3300010337 | Grasslands Soil | PSALAGGGNGDLSEGGLGIAIIQAVADEVEIGGRESGGSRLRFVKLLDD* |
Ga0126372_132861861 | 3300010360 | Tropical Forest Soil | LGIAIIRALADEFHVSARERGGSTLRFVKHLTATAV* |
Ga0134125_107101312 | 3300010371 | Terrestrial Soil | EGGLGLAIIRSLSDEFELGSRNGGGSRLRFVKKLP* |
Ga0134128_127772042 | 3300010373 | Terrestrial Soil | EEEELAEGGLGIAIIKALSDEFEIREGDRGGSRLRFVKRLS* |
Ga0105239_116540532 | 3300010375 | Corn Rhizosphere | AEGGLGIAIIEALSDELEIGQGDGGGSRLRFVKHLA* |
Ga0134124_114983012 | 3300010397 | Terrestrial Soil | EEGGLGIAIIRALTDEVEIGEREGGGSRLRFVKLLND* |
Ga0137424_10100581 | 3300011412 | Soil | PLGKGEGLSEGGLGIAIIKAVADEFEAGERAEGGGSRLRFVKFLGN* |
Ga0120162_10684322 | 3300011997 | Permafrost | ALVDEELSEGGLGIAIIEALADEFEIRDRPQGGSFLRFVKHLS* |
Ga0120134_10338611 | 3300012004 | Permafrost | GLGIAIIRAIADEVEIGEGVSGGSRLRFVKFLGE* |
Ga0137376_107360931 | 3300012208 | Vadose Zone Soil | GGLGIEIIRALADEVEIGPREEGGSRLRFVKLLPD* |
Ga0137370_102976741 | 3300012285 | Vadose Zone Soil | LGIAIIRAIADEVEIGTRPGGKGSRLRFAKELGST* |
Ga0137387_107405031 | 3300012349 | Vadose Zone Soil | ALGGGGHGDLSEGGLGIAIIRAVADEVEIDERESGGSRLRFVKFLGE* |
Ga0137371_108927261 | 3300012356 | Vadose Zone Soil | LGIAIIKAVSDEFEAGKRHGGGGSRLRFVKFLDD* |
Ga0137368_109098761 | 3300012358 | Vadose Zone Soil | GPGFAAGAERADGENLVEGGLGIAIIKAVSDEFEAGQRSTGRGSRLRIVKFLDR* |
Ga0137360_105456272 | 3300012361 | Vadose Zone Soil | AGAGNGDLSEGGLGIAIIRAVADEVEIDERESGGSRLRFVKFLDE* |
Ga0134035_11136021 | 3300012391 | Grasslands Soil | GGLGIAIIRSIADELDIERRESGGSRLRFVKLLET* |
Ga0150984_1108334802 | 3300012469 | Avena Fatua Rhizosphere | EGGLGIAIIEALADELEITERAAGGSSLRFVKRLG* |
Ga0157339_10308242 | 3300012505 | Arabidopsis Rhizosphere | GLGIAIIEALTDTLEIGPRAGGGSTIRFVKRLDD* |
Ga0157288_100655822 | 3300012901 | Soil | FRSGLGIAIIRSLADELEIEPGEGRGSRLRFVKHLGAAA* |
Ga0137404_107440391 | 3300012929 | Vadose Zone Soil | AELAGEGNGDLSEGGLGIAIIRAVVDEVEIDERESGGSRLRFVKFLGE* |
Ga0164300_103380012 | 3300012951 | Soil | EEGGLGIAIIKAVSDEFEAGERAEGQGSRLRFTKLLES* |
Ga0164303_102185141 | 3300012957 | Soil | GLGIAIIRALADEVEIGERESGGSRLRFVKFLDE* |
Ga0164301_104384722 | 3300012960 | Soil | GLGIAIIQSLADELEIGRPNGGGSRLRFVKHLAG* |
Ga0164308_115809782 | 3300012985 | Soil | GGLGIAIIEALADEFEIRERPQGGSFLRFVKHLN* |
Ga0164304_102767212 | 3300012986 | Soil | ELAEGGLGIAIIEALADELEITERAEGGSSLRFVKRLS* |
Ga0164304_111553972 | 3300012986 | Soil | FDPSGDRPLREGLAEGGLGIAIIQAVSDEFEAGKQADGTGSRLRFVKLLEQ* |
Ga0164307_115685181 | 3300012987 | Soil | PGADDDLEEGGLGIEIIRALTDEVEIGEREGGGSRLRFVKLLDD* |
Ga0164305_109809371 | 3300012989 | Soil | EGGLGIAIIEALADELAITERADGGSHLRFVKHL* |
Ga0157371_112314881 | 3300013102 | Corn Rhizosphere | EDELSEGGLGIAIIEALADELQITERAAGGSSLRFVKHLA* |
Ga0157369_106968241 | 3300013105 | Corn Rhizosphere | EGGLGIAIIQALADEFEVGNRPEGAGSRLRFVKLLRE* |
Ga0157369_109836952 | 3300013105 | Corn Rhizosphere | STPPSEDDLSEGGLGIAIIQALSDEFEIGERPQGGSRLRFVKLLPAA* |
Ga0182000_104250541 | 3300014487 | Soil | DEGGLGIAIIRAVTDDLEIGARPEGGSRLRFTKFLP* |
Ga0120193_100255501 | 3300014965 | Terrestrial | PISGFDASGDRPWERLGEGGLGIAIIKAVSDEFEAGERDEGHGSKLRFVKLLDK* |
Ga0157376_128833602 | 3300014969 | Miscanthus Rhizosphere | GLGIAIIRAVSDEFEAGKQADGSGSRLRFSKFLEE* |
Ga0173483_105424842 | 3300015077 | Soil | VESDGEDSELSEGGLGIAIIRSLSDEFELGERVSGGGSRLRFVKALEG* |
Ga0173480_101228241 | 3300015200 | Soil | KFAIIRSLADELEIEPGEGRGSRLRFVKHLGAAA* |
Ga0134072_101454442 | 3300015357 | Grasslands Soil | LGIAIIKAIADEFEAGPRNGGHGSRLRFVKLLPEATR* |
Ga0134089_105593702 | 3300015358 | Grasslands Soil | LAGAGNGGLIEGGLGIAIIRAVADEVEIGGRDSGGSRLRFVKFLGE* |
Ga0132257_1000466455 | 3300015373 | Arabidopsis Rhizosphere | EGGLGIAIIEALTDTLEIGPRAGGGCTIRFVKRLDD* |
Ga0132257_1005043422 | 3300015373 | Arabidopsis Rhizosphere | GGLGLAIIRSISDEFELSDREGGGSCLRFAKKLP* |
Ga0132255_1009487241 | 3300015374 | Arabidopsis Rhizosphere | EGGLGIAIIRAVTDELEIGPSPNGGGSRLRFAKYLN* |
Ga0182037_109193631 | 3300016404 | Soil | ELVEGGLGIAIIRALADELQISGREHGGSTLRFVKHLPVTAH |
Ga0190266_100520332 | 3300017965 | Soil | AQQELDEGGLSIAIIRAVTDELEIGPSPNGGGSHLRFAKYLN |
Ga0187776_104331421 | 3300017966 | Tropical Peatland | GALEPVEGGLGIAIIRALSDELEIGFSNGGGSRLRFVKRLSG |
Ga0187777_107296032 | 3300017974 | Tropical Peatland | IAIIRALADELQISGREQGGSTLRFVKHLPVRTTTS |
Ga0187823_101189301 | 3300017993 | Freshwater Sediment | DELVEGGLGIAIIRALADELQISGREQGGSSLRFVKHLPAAAH |
Ga0184604_101824342 | 3300018000 | Groundwater Sediment | RAQEELDEGGLGIAIIRALTDELEIGARPEGGSRLRFTKYLT |
Ga0184608_100898991 | 3300018028 | Groundwater Sediment | EGGLGIAIIKAVSDEFEAGKQADGGGSRLRFVKFLED |
Ga0184620_103035301 | 3300018051 | Groundwater Sediment | AGDRPMADGLAEGGLGIAIIRAVSDEFVAGKQADGSGSRLRFVKFLED |
Ga0184623_101285312 | 3300018056 | Groundwater Sediment | EILERAQEELDEGGLGIAIIRALTDELEIGARPEGGSRLRFTKYLT |
Ga0184619_100788601 | 3300018061 | Groundwater Sediment | GGLGIAIIKAVSDEFEAGKRSNGRGSRLRFVKFLDN |
Ga0184609_102374122 | 3300018076 | Groundwater Sediment | EELDEGGLGIAIIRALTDELEIGARPEGGSRLRFTKYLT |
Ga0184639_105793292 | 3300018082 | Groundwater Sediment | AENLAEGGLGIEIIKAVSDEFEAGKRTDGRGSRLRFVKFLDR |
Ga0173481_103616021 | 3300019356 | Soil | EGGLGIAIIRAVTDELDIGPNPNGGGSRLRFAKYLN |
Ga0193741_10144081 | 3300019884 | Soil | GGLGIAIIKAVADEFEAGERPEGGGSRLRFVKFLGN |
Ga0193697_10545731 | 3300020005 | Soil | DPAGDRPMADGLAEGGLGIAIIRAVSDEFVAGKQADGSGSRLRFVKFLED |
Ga0206353_112727421 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | SEGGLGIAIIEALADEFEIRERAQGGSFLRFVKHLS |
Ga0210378_103067912 | 3300021073 | Groundwater Sediment | EDLEEGGLGIAIIKAVSDEFEAGERSKGRGSRLRFVKFLDD |
Ga0210382_105659191 | 3300021080 | Groundwater Sediment | FDPEILERAQEELDEGGLGIAIIRALTDELEIGARPEGGSRLRFTKYLT |
Ga0193719_103921042 | 3300021344 | Soil | PGFDVQGDRGDETDLEEGGLGIAIIKAVSDEFEAGERSEGHGSRLRFVKFLDN |
Ga0213882_105011972 | 3300021362 | Exposed Rock | ETELAEGGLGIAIIEALADELEIGEGERGGSRLRFVKKL |
Ga0193694_10298601 | 3300021415 | Soil | GGGNGDLNEVGLGIAIIRAVADEVEIGGRDSGGSRLRFVKFLGE |
Ga0182009_103313471 | 3300021445 | Soil | LDEGGLGIAIIRAVTDELEIGPNPRGAGSRLRFSKYLN |
Ga0222621_11335311 | 3300021510 | Groundwater Sediment | GCVPGELAGEGNGDLNEGGLGIAIIQAVTDEVEIGKRESGGSRLRFVKFLGS |
Ga0224712_101905821 | 3300022467 | Corn, Switchgrass And Miscanthus Rhizosphere | ELAEGGLGIAIIEALSDELEIGEGDGGGSRLRFVKHLA |
Ga0222623_101465001 | 3300022694 | Groundwater Sediment | EDLAEGGLGIEIIKAVSDEFEAGERGGGRGSRLRFVKFLGS |
Ga0247746_12035122 | 3300022886 | Soil | AHGDRGKDQELEEGGLGIAIIKAVSDEFEAGERSHGRGSRLRFVKFLDN |
Ga0247795_10111921 | 3300022899 | Soil | LAEGGLGIAIIRALTDEVEIGKREGGGSRLRFVKLLDA |
Ga0247800_10190001 | 3300023263 | Soil | GGLGIAIIRALTDEVEIGKREGGGSRLRFVKLLDA |
Ga0247661_10140532 | 3300024254 | Soil | GAGEEELLEEGGLGIEIIRALTDEVEIAEREGGGSRLRFVKLLD |
Ga0247670_10031724 | 3300024283 | Soil | FEPPTEPSSALVDDDLSEGGLGIAIIEALADEFEIRERAQGGSFLRFVKHLS |
Ga0247666_10084751 | 3300024323 | Soil | LVDEELSEGGLGIAIIEALADEFEIRERPQGGSFLRFVKHLS |
Ga0210142_11120582 | 3300025552 | Natural And Restored Wetlands | GGLGIAIIRALTDELTLQSGDRGGSRLRFVKRFPR |
Ga0209744_10073621 | 3300025692 | Arctic Peat Soil | PSGLEEIDFGEGGLGIAIIRAIVDDLEISEKMGGGSRLRFEKKLDS |
Ga0209226_100760511 | 3300025865 | Arctic Peat Soil | SGLEEIDFGEGGLGIAIIRAIVDDLEISEKMGGGSRLRFVKRLDS |
Ga0209540_103674561 | 3300025888 | Arctic Peat Soil | EELGDLGEGGLGLAIIRELVDELEISEKTGGGSRLRFVKKLGD |
Ga0209540_104257002 | 3300025888 | Arctic Peat Soil | DFGEGGLGIAIIREIVDDLEISEKMGGGSRLRFEKRLGS |
Ga0207654_103497752 | 3300025911 | Corn Rhizosphere | APDADELAEGGLGIAIIEALSDELEIGEGDDGGSRLRFVKHLA |
Ga0207662_101230392 | 3300025918 | Switchgrass Rhizosphere | SELSEGGLGLAIIRSLSDEFELGSRNGGGSRLRFVKKLP |
Ga0207687_102618112 | 3300025927 | Miscanthus Rhizosphere | EGGLGIAIIRAVADEVEIDERESGGSRLRFVKFLGE |
Ga0207700_111173241 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | DDELSEGGLGIAIIEALSDELEITQRDEGGSRLRFVKKLPA |
Ga0207700_118206202 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | ELVEGGLGIAIIRALADELVISGREQGGSTLRFVKRLPAPAS |
Ga0207644_116794391 | 3300025931 | Switchgrass Rhizosphere | DELLEEGGLGIEIIRALTDEVEIAEREGGGSRLRFVKLLD |
Ga0207686_104841571 | 3300025934 | Miscanthus Rhizosphere | DLGGRGNGDLSEGGLGIAIIRAVTDEVEIDERESGGSRLRFVKFLGE |
Ga0207661_101844171 | 3300025944 | Corn Rhizosphere | FDAAGDRPTEENLQEGGLGIAIIKAVSDEFEAGERAEGQGSRLRFTKLLES |
Ga0207667_104315082 | 3300025949 | Corn Rhizosphere | NALVDDDLSEGGLGIAIIEALADEFEIRERAQGGSFLRFVKHLS |
Ga0207651_118853151 | 3300025960 | Switchgrass Rhizosphere | EEGGLGIEIIRALTDEVEIAEREGGGSRLRFVKLLD |
Ga0208002_10243311 | 3300026029 | Natural And Restored Wetlands | PVPVPPEELVESGLGIAIIQALADEFEIRPREGGGSSLRFVKLLAD |
Ga0209688_10652561 | 3300026305 | Soil | ANLAAGGNGDLSEGGLGIAIIQAVSDEVEIGGRESGGSRLRFVKFLGE |
Ga0209688_10856351 | 3300026305 | Soil | EAELSESGLGIAIIRAIADEVEIGPRDSGGSRLRFVKLLPD |
Ga0209161_103776552 | 3300026548 | Soil | RQRRPERRGLGIAIIRAVADEVEIDERESGGSRLRFVKFLGE |
Ga0209009_10792731 | 3300027667 | Forest Soil | PDAENLAEGGLGIEIIKAVSDEFEAGKRAEGRGSRLRFVKFLDS |
Ga0209860_10174421 | 3300027949 | Groundwater Sand | EGNGGELDEGGLGIAIIRAVTDGLTIGPRSGGTGSCLRFTKHLD |
Ga0247682_10842272 | 3300028146 | Soil | EDELLEEGGLGIEIIRALTDEVEIAEREGGGSRLRFVKLLD |
Ga0307276_101270121 | 3300028705 | Soil | ALAGGGNGDLSEGGLGIAIIQAVADEVEIGGRESGGSRLRFVKLLDD |
Ga0307291_10080271 | 3300028707 | Soil | LDEGGLGIAIIRAVTDELDIGPNPTGGGSRLRFAKYLN |
Ga0307293_100238423 | 3300028711 | Soil | PTEDLAEGGLGIEIIKAVSDEFEAGERGGGRGSRLRFVKFLGS |
Ga0307301_102627901 | 3300028719 | Soil | DGLAEGGLGIAIIRAVSDEFVAGKQADGSGSRLRFVKFLED |
Ga0307317_100143791 | 3300028720 | Soil | EGGLGIAIIRAVTDELDIGSNPNGAGSRLRFTKYLN |
Ga0307317_102125591 | 3300028720 | Soil | GDRVNEEDLEEGGLGIAIIKAVSDEFEAGERSHGHGSRLRFVKFLDN |
Ga0307318_101651732 | 3300028744 | Soil | EGGLGIAIIRALTDELEIGARPEGGSRLRFTKYLT |
Ga0307318_103263521 | 3300028744 | Soil | EGGLGIEIIRAVTDEVEIAEREGGGSKLRFVKFLAA |
Ga0307297_100385892 | 3300028754 | Soil | ELAEGGLGIEIIRAVTDEVEIAEREGGGSKLRFVKFLAA |
Ga0307320_102690942 | 3300028771 | Soil | TEENLAEGGLGIAIIKAVSDEFEAGERSAGHGSKLRFVKLLDT |
Ga0307282_103046552 | 3300028784 | Soil | GFDPQVIERAEEELDEGGLGLAIIRAVTDELEIGPGPEGGSRLRFTKYLT |
Ga0307323_100113753 | 3300028787 | Soil | DPEVLERAQAELDEGGLGIAIIRAVTDELDIGSNSNGAGSRLRFTKYLN |
Ga0307305_100014301 | 3300028807 | Soil | GFDPKILKRAQEELDEGGLGIAIIRALTDELEIGARPEGGSRLRFTKYLT |
Ga0307310_105039611 | 3300028824 | Soil | EDLVEGGLGIEIIKAVSDEFEAGERGGGRGSRLRFVKFLGS |
Ga0307312_109721292 | 3300028828 | Soil | ELSEGGLGIEIIRAVTDEVEIEPREGGGSRLRFVKFLAS |
Ga0307312_111480482 | 3300028828 | Soil | DGELEEGGLGIEIIRALADEVEIGRRDKGGSRLRFVKFFAE |
Ga0307286_100886991 | 3300028876 | Soil | RGLGIAIIRAVADEVEIDERESGGSRLRFVKFLGD |
Ga0307308_102890931 | 3300028884 | Soil | IERAEEELDEGGLGLAIIRAVTDELEIGPGPEGGSRLRFTKYLT |
Ga0307308_103270062 | 3300028884 | Soil | LSEGGLGIAIIQALADELEIGRPNGGGSRLRFVKRLAN |
Ga0311332_115430312 | 3300029984 | Fen | QPSDALDGAELSEGGLGIAIIEALADELEIREREQGGSSLRFVKLL |
Ga0311349_111380921 | 3300030294 | Fen | DGAELSEGGLGIAIIEALADELEIREREQGGSSLRFVKLL |
Ga0247826_114275282 | 3300030336 | Soil | DRPLRDGLAEGGLGIAIIQAVSDEFEAGKQAGGGGSRLRFVKFLQQ |
Ga0268255_101562881 | 3300030516 | Agave | NGDLSEGGLGIAIIRAVADEVEIGERESGGSRLRFVKFLRD |
Ga0302046_111457472 | 3300030620 | Soil | HAGAPELDEGGLGIAIIRAVTDELQIGPRAAGPGSCLRFIKYLGQ |
Ga0311335_102452612 | 3300030838 | Fen | GDFGEGGLGLAIIRALVDELEISEKTGGGSRLRFVKNLAD |
Ga0307499_102213182 | 3300031184 | Soil | GGLGIAIIRAIADRVEIGARPEGKGSRLRFEKGLN |
Ga0307497_104533121 | 3300031226 | Soil | DDELSEGGLGIAIIKALADELEITERAAGGSSLRFVKHLA |
Ga0318493_103313651 | 3300031723 | Soil | LVEGGLGIAIIRALADELQISGREHGGSTLRFVKHLPVTAH |
Ga0318502_107857892 | 3300031747 | Soil | LEGGLGIAIIRALADEFELGLRQGRPGSRLRFMKFLPEP |
Ga0318535_103314582 | 3300031764 | Soil | GGLGIAIIEALSDELEITQRDEGGSRLRFVKKLPA |
Ga0310892_103203202 | 3300031858 | Soil | DRVNEEDLEEGGLGIAIIKAVSDEFEAGERSHGHGSRLRFVKFLDN |
Ga0311367_111036232 | 3300031918 | Fen | ELEELGDFGEGGLGLAIIRALVDELEISEKTGGGSRLRFVKNLAD |
Ga0308175_1017585181 | 3300031938 | Soil | PTEASNALVEDELSEGGLGIAIIEALADEFEIRERSQGGSFLRFVKHLS |
Ga0310901_102795681 | 3300031940 | Soil | LEEGGLGIEIIRALTDEVEIAEREGGGSRLRFVKLLD |
Ga0318513_104666961 | 3300032065 | Soil | GIAIIRALADELQISGREHGGSTLRFVKHLPVTAH |
Ga0308173_117262371 | 3300032074 | Soil | LTEGGLGIAIIRSIADELDIERRDSGGSRLRFVKLLET |
Ga0335082_105925691 | 3300032782 | Soil | ARPAAVDGRDLSEGGLGIAIIEALTDELEIGEGRDGGSRLRFVKRLA |
Ga0335072_113976422 | 3300032898 | Soil | EGGLGIAIIESLADELQIEQRPGGGSRLRFVKVLAD |
Ga0335084_116157631 | 3300033004 | Soil | VESDGEDRELTEGGLGIAIIRSLSDEFELGERGPEGGSRLRFVKHL |
Ga0310811_114970591 | 3300033475 | Soil | EGGLGIEIIRALTDEVEIGAREGGGSRLRFVKLLSD |
Ga0364930_0332108_2_115 | 3300033814 | Sediment | ESGLGLTILRALADELEIGSRDERGGSRLRFVKLLPA |
⦗Top⦘ |