| Basic Information | |
|---|---|
| Family ID | F025769 |
| Family Type | Metagenome |
| Number of Sequences | 200 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR |
| Number of Associated Samples | 149 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 80.50 % |
| % of genes near scaffold ends (potentially truncated) | 27.00 % |
| % of genes from short scaffolds (< 2000 bps) | 88.00 % |
| Associated GOLD sequencing projects | 141 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.50 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (71.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (24.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 34.62% β-sheet: 0.00% Coil/Unstructured: 65.38% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.50 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF02824 | TGS | 34.00 |
| PF04972 | BON | 25.00 |
| PF07973 | tRNA_SAD | 20.50 |
| PF00133 | tRNA-synt_1 | 12.50 |
| PF02803 | Thiolase_C | 0.50 |
| PF00551 | Formyl_trans_N | 0.50 |
| PF00108 | Thiolase_N | 0.50 |
| PF13205 | Big_5 | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0060 | Isoleucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 12.50 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 12.50 |
| COG0495 | Leucyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 12.50 |
| COG0525 | Valyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 12.50 |
| COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 71.00 % |
| Unclassified | root | N/A | 29.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2002160 | Not Available | 873 | Open in IMG/M |
| 3300000363|ICChiseqgaiiFebDRAFT_11057469 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1263 | Open in IMG/M |
| 3300001305|C688J14111_10144821 | Not Available | 729 | Open in IMG/M |
| 3300001686|C688J18823_10172737 | All Organisms → cellular organisms → Bacteria | 1473 | Open in IMG/M |
| 3300001686|C688J18823_10215566 | All Organisms → cellular organisms → Bacteria | 1289 | Open in IMG/M |
| 3300002568|C688J35102_120005059 | All Organisms → cellular organisms → Bacteria | 843 | Open in IMG/M |
| 3300002568|C688J35102_120424252 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas → Gemmatimonas aurantiaca | 1058 | Open in IMG/M |
| 3300002568|C688J35102_120492311 | Not Available | 1114 | Open in IMG/M |
| 3300003267|soilL1_10069404 | All Organisms → cellular organisms → Bacteria | 2560 | Open in IMG/M |
| 3300003267|soilL1_10119468 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1470 | Open in IMG/M |
| 3300003319|soilL2_10124085 | All Organisms → cellular organisms → Bacteria | 2721 | Open in IMG/M |
| 3300003999|Ga0055469_10100546 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 831 | Open in IMG/M |
| 3300004081|Ga0063454_101638761 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 557 | Open in IMG/M |
| 3300004114|Ga0062593_101220890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 790 | Open in IMG/M |
| 3300004153|Ga0063455_100129539 | Not Available | 1112 | Open in IMG/M |
| 3300004463|Ga0063356_101652609 | Not Available | 956 | Open in IMG/M |
| 3300004463|Ga0063356_104283639 | Not Available | 614 | Open in IMG/M |
| 3300004463|Ga0063356_106109496 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 516 | Open in IMG/M |
| 3300004780|Ga0062378_10204512 | Not Available | 550 | Open in IMG/M |
| 3300005329|Ga0070683_101579354 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005329|Ga0070683_102181614 | Not Available | 532 | Open in IMG/M |
| 3300005440|Ga0070705_100512623 | Not Available | 913 | Open in IMG/M |
| 3300005441|Ga0070700_100175299 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1488 | Open in IMG/M |
| 3300005546|Ga0070696_100503314 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300005547|Ga0070693_100549291 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
| 3300005578|Ga0068854_102203864 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
| 3300005873|Ga0075287_1045323 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 596 | Open in IMG/M |
| 3300005874|Ga0075288_1080488 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 531 | Open in IMG/M |
| 3300005937|Ga0081455_10016287 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatirosa → Gemmatirosa kalamazoonesis | 7183 | Open in IMG/M |
| 3300005937|Ga0081455_10448825 | All Organisms → cellular organisms → Bacteria | 881 | Open in IMG/M |
| 3300006237|Ga0097621_102298168 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 516 | Open in IMG/M |
| 3300006755|Ga0079222_10003714 | All Organisms → cellular organisms → Bacteria | 4869 | Open in IMG/M |
| 3300006804|Ga0079221_10620587 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300006844|Ga0075428_101280526 | All Organisms → cellular organisms → Bacteria | 771 | Open in IMG/M |
| 3300009012|Ga0066710_102010070 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 856 | Open in IMG/M |
| 3300009078|Ga0105106_10004763 | All Organisms → cellular organisms → Bacteria | 9711 | Open in IMG/M |
| 3300009094|Ga0111539_11051665 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 946 | Open in IMG/M |
| 3300009147|Ga0114129_10346848 | All Organisms → cellular organisms → Bacteria | 1968 | Open in IMG/M |
| 3300009156|Ga0111538_10683290 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1301 | Open in IMG/M |
| 3300009789|Ga0126307_10017232 | All Organisms → cellular organisms → Bacteria | 5387 | Open in IMG/M |
| 3300009789|Ga0126307_10395637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1114 | Open in IMG/M |
| 3300009789|Ga0126307_11049243 | Not Available | 659 | Open in IMG/M |
| 3300009840|Ga0126313_10184672 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1594 | Open in IMG/M |
| 3300009840|Ga0126313_10670798 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 838 | Open in IMG/M |
| 3300009840|Ga0126313_10817262 | Not Available | 759 | Open in IMG/M |
| 3300009840|Ga0126313_11475302 | Not Available | 565 | Open in IMG/M |
| 3300010038|Ga0126315_10205100 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1189 | Open in IMG/M |
| 3300010039|Ga0126309_10154961 | Not Available | 1235 | Open in IMG/M |
| 3300010039|Ga0126309_10165905 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1198 | Open in IMG/M |
| 3300010039|Ga0126309_10211916 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1078 | Open in IMG/M |
| 3300010039|Ga0126309_10883128 | Not Available | 591 | Open in IMG/M |
| 3300010040|Ga0126308_10026939 | All Organisms → cellular organisms → Bacteria | 3168 | Open in IMG/M |
| 3300010041|Ga0126312_10145449 | All Organisms → cellular organisms → Bacteria | 1643 | Open in IMG/M |
| 3300010042|Ga0126314_10040236 | All Organisms → cellular organisms → Bacteria | 2983 | Open in IMG/M |
| 3300010042|Ga0126314_10732892 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300010042|Ga0126314_10989475 | Not Available | 624 | Open in IMG/M |
| 3300010044|Ga0126310_10150113 | Not Available | 1483 | Open in IMG/M |
| 3300010045|Ga0126311_10784355 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 767 | Open in IMG/M |
| 3300010045|Ga0126311_11081679 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 659 | Open in IMG/M |
| 3300010045|Ga0126311_11559502 | Not Available | 555 | Open in IMG/M |
| 3300010166|Ga0126306_10328709 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1183 | Open in IMG/M |
| 3300010166|Ga0126306_10376746 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1106 | Open in IMG/M |
| 3300010371|Ga0134125_10115826 | All Organisms → cellular organisms → Bacteria | 2984 | Open in IMG/M |
| 3300010373|Ga0134128_10539766 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1299 | Open in IMG/M |
| 3300010399|Ga0134127_12027080 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 654 | Open in IMG/M |
| 3300010400|Ga0134122_10345101 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1294 | Open in IMG/M |
| 3300010400|Ga0134122_10382865 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1236 | Open in IMG/M |
| 3300010400|Ga0134122_10431165 | Not Available | 1173 | Open in IMG/M |
| 3300011003|Ga0138514_100013824 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1363 | Open in IMG/M |
| 3300012043|Ga0136631_10001958 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 6693 | Open in IMG/M |
| 3300012184|Ga0136610_1073026 | Not Available | 1222 | Open in IMG/M |
| 3300012212|Ga0150985_100246453 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
| 3300012212|Ga0150985_120584698 | Not Available | 614 | Open in IMG/M |
| 3300012469|Ga0150984_120330719 | Not Available | 934 | Open in IMG/M |
| 3300012469|Ga0150984_121098944 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300012469|Ga0150984_123565609 | Not Available | 734 | Open in IMG/M |
| 3300012681|Ga0136613_10008609 | All Organisms → cellular organisms → Bacteria | 5733 | Open in IMG/M |
| 3300012684|Ga0136614_10126101 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300012684|Ga0136614_10909051 | Not Available | 609 | Open in IMG/M |
| 3300012906|Ga0157295_10149405 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 699 | Open in IMG/M |
| 3300012911|Ga0157301_10081748 | Not Available | 910 | Open in IMG/M |
| 3300012929|Ga0137404_11015497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 759 | Open in IMG/M |
| 3300012951|Ga0164300_10172189 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1035 | Open in IMG/M |
| 3300012957|Ga0164303_10954463 | Not Available | 606 | Open in IMG/M |
| 3300012957|Ga0164303_11184192 | Not Available | 558 | Open in IMG/M |
| 3300012958|Ga0164299_11059610 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 602 | Open in IMG/M |
| 3300012960|Ga0164301_10553552 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 840 | Open in IMG/M |
| 3300012961|Ga0164302_11493063 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 557 | Open in IMG/M |
| 3300012986|Ga0164304_11569228 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 547 | Open in IMG/M |
| 3300012986|Ga0164304_11570755 | Not Available | 547 | Open in IMG/M |
| 3300012989|Ga0164305_10738792 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 809 | Open in IMG/M |
| 3300013102|Ga0157371_10909681 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 668 | Open in IMG/M |
| 3300013772|Ga0120158_10130603 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1432 | Open in IMG/M |
| 3300014265|Ga0075314_1047097 | Not Available | 839 | Open in IMG/M |
| 3300014497|Ga0182008_10345161 | Not Available | 788 | Open in IMG/M |
| 3300015079|Ga0167657_1008501 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1457 | Open in IMG/M |
| 3300017695|Ga0180121_10000170 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 24573 | Open in IMG/M |
| 3300017787|Ga0183260_10009016 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → Gemmatimonas | 7766 | Open in IMG/M |
| 3300017789|Ga0136617_10000191 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae | 47608 | Open in IMG/M |
| 3300017789|Ga0136617_10382499 | Not Available | 1140 | Open in IMG/M |
| 3300017997|Ga0184610_1023494 | All Organisms → cellular organisms → Bacteria | 1680 | Open in IMG/M |
| 3300017997|Ga0184610_1128680 | Not Available | 820 | Open in IMG/M |
| 3300018000|Ga0184604_10025798 | Not Available | 1445 | Open in IMG/M |
| 3300018027|Ga0184605_10151347 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1044 | Open in IMG/M |
| 3300018027|Ga0184605_10233815 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 835 | Open in IMG/M |
| 3300018027|Ga0184605_10362163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 654 | Open in IMG/M |
| 3300018028|Ga0184608_10028234 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 2095 | Open in IMG/M |
| 3300018028|Ga0184608_10179299 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 923 | Open in IMG/M |
| 3300018051|Ga0184620_10109503 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 860 | Open in IMG/M |
| 3300018053|Ga0184626_10123928 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1098 | Open in IMG/M |
| 3300018054|Ga0184621_10026172 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1832 | Open in IMG/M |
| 3300018059|Ga0184615_10430970 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 719 | Open in IMG/M |
| 3300018063|Ga0184637_10063002 | Not Available | 2268 | Open in IMG/M |
| 3300018071|Ga0184618_10325541 | Not Available | 656 | Open in IMG/M |
| 3300018071|Ga0184618_10439630 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300018075|Ga0184632_10068185 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1547 | Open in IMG/M |
| 3300018075|Ga0184632_10109280 | Not Available | 1214 | Open in IMG/M |
| 3300018076|Ga0184609_10393408 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 645 | Open in IMG/M |
| 3300018077|Ga0184633_10608867 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 514 | Open in IMG/M |
| 3300018082|Ga0184639_10031771 | All Organisms → cellular organisms → Bacteria | 2693 | Open in IMG/M |
| 3300018084|Ga0184629_10094105 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1457 | Open in IMG/M |
| 3300018422|Ga0190265_10028741 | All Organisms → cellular organisms → Bacteria | 4580 | Open in IMG/M |
| 3300018422|Ga0190265_10290114 | Not Available | 1702 | Open in IMG/M |
| 3300018422|Ga0190265_10495281 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1334 | Open in IMG/M |
| 3300018422|Ga0190265_11179007 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 885 | Open in IMG/M |
| 3300018429|Ga0190272_10669720 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 927 | Open in IMG/M |
| 3300019356|Ga0173481_10334491 | Not Available | 717 | Open in IMG/M |
| 3300019487|Ga0187893_10464625 | Not Available | 836 | Open in IMG/M |
| 3300019865|Ga0193748_1017920 | Not Available | 665 | Open in IMG/M |
| 3300019997|Ga0193711_1045719 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 528 | Open in IMG/M |
| 3300020022|Ga0193733_1036455 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1389 | Open in IMG/M |
| 3300020060|Ga0193717_1049637 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1495 | Open in IMG/M |
| 3300020202|Ga0196964_10045428 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1845 | Open in IMG/M |
| 3300021080|Ga0210382_10357938 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 644 | Open in IMG/M |
| 3300022694|Ga0222623_10034089 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300025313|Ga0209431_10230107 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1462 | Open in IMG/M |
| 3300025325|Ga0209341_10265303 | All Organisms → cellular organisms → Bacteria | 1421 | Open in IMG/M |
| 3300025325|Ga0209341_10609750 | Not Available | 854 | Open in IMG/M |
| 3300025325|Ga0209341_10681101 | Not Available | 795 | Open in IMG/M |
| 3300025327|Ga0209751_11332950 | Not Available | 513 | Open in IMG/M |
| 3300025909|Ga0207705_11075822 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300025912|Ga0207707_10729128 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 830 | Open in IMG/M |
| 3300025919|Ga0207657_10260184 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1381 | Open in IMG/M |
| 3300025933|Ga0207706_10235673 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1600 | Open in IMG/M |
| 3300025935|Ga0207709_11578287 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 545 | Open in IMG/M |
| 3300025937|Ga0207669_11341004 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 608 | Open in IMG/M |
| 3300025944|Ga0207661_10818105 | Not Available | 858 | Open in IMG/M |
| 3300026142|Ga0207698_10243291 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1641 | Open in IMG/M |
| 3300027647|Ga0214468_1118713 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 667 | Open in IMG/M |
| 3300027695|Ga0209966_1139453 | Not Available | 562 | Open in IMG/M |
| 3300027713|Ga0209286_1174301 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 782 | Open in IMG/M |
| 3300027778|Ga0209464_10116772 | Not Available | 922 | Open in IMG/M |
| 3300027787|Ga0209074_10168916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 801 | Open in IMG/M |
| 3300027909|Ga0209382_10020238 | All Organisms → cellular organisms → Bacteria | 8094 | Open in IMG/M |
| 3300027964|Ga0256864_1003001 | All Organisms → cellular organisms → Bacteria | 4216 | Open in IMG/M |
| 3300028587|Ga0247828_10563770 | Not Available | 688 | Open in IMG/M |
| 3300028711|Ga0307293_10306145 | Not Available | 504 | Open in IMG/M |
| 3300028715|Ga0307313_10025073 | All Organisms → cellular organisms → Bacteria | 1649 | Open in IMG/M |
| 3300028716|Ga0307311_10263704 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 514 | Open in IMG/M |
| 3300028717|Ga0307298_10196203 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 594 | Open in IMG/M |
| 3300028718|Ga0307307_10232792 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 586 | Open in IMG/M |
| 3300028755|Ga0307316_10260476 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 631 | Open in IMG/M |
| 3300028768|Ga0307280_10383629 | Not Available | 522 | Open in IMG/M |
| 3300028793|Ga0307299_10408708 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 509 | Open in IMG/M |
| 3300028796|Ga0307287_10040542 | All Organisms → cellular organisms → Bacteria | 1688 | Open in IMG/M |
| 3300028799|Ga0307284_10310499 | Not Available | 634 | Open in IMG/M |
| 3300028803|Ga0307281_10020009 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1929 | Open in IMG/M |
| 3300028803|Ga0307281_10059133 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1221 | Open in IMG/M |
| 3300028807|Ga0307305_10080561 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1503 | Open in IMG/M |
| 3300028814|Ga0307302_10100700 | Not Available | 1379 | Open in IMG/M |
| 3300028814|Ga0307302_10528953 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 586 | Open in IMG/M |
| 3300028824|Ga0307310_10151266 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1071 | Open in IMG/M |
| 3300028824|Ga0307310_10472489 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 629 | Open in IMG/M |
| 3300028828|Ga0307312_10030446 | All Organisms → cellular organisms → Bacteria | 3140 | Open in IMG/M |
| 3300028878|Ga0307278_10445651 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 567 | Open in IMG/M |
| 3300028881|Ga0307277_10311476 | Not Available | 699 | Open in IMG/M |
| 3300028881|Ga0307277_10312998 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 697 | Open in IMG/M |
| 3300028885|Ga0307304_10040702 | Not Available | 1680 | Open in IMG/M |
| 3300028889|Ga0247827_11090318 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 548 | Open in IMG/M |
| 3300030606|Ga0299906_10260054 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1362 | Open in IMG/M |
| 3300030606|Ga0299906_10597629 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 837 | Open in IMG/M |
| 3300030620|Ga0302046_10497095 | Not Available | 998 | Open in IMG/M |
| 3300030620|Ga0302046_11591027 | Not Available | 503 | Open in IMG/M |
| 3300031229|Ga0299913_10364493 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 1433 | Open in IMG/M |
| 3300031229|Ga0299913_11455074 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 639 | Open in IMG/M |
| 3300031548|Ga0307408_100031136 | All Organisms → cellular organisms → Bacteria | 3712 | Open in IMG/M |
| 3300031548|Ga0307408_101675030 | Not Available | 605 | Open in IMG/M |
| 3300031548|Ga0307408_102290421 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 523 | Open in IMG/M |
| 3300031731|Ga0307405_10024305 | All Organisms → cellular organisms → Bacteria | 3459 | Open in IMG/M |
| 3300031731|Ga0307405_10096807 | Not Available | 1969 | Open in IMG/M |
| 3300031852|Ga0307410_10898529 | Not Available | 759 | Open in IMG/M |
| 3300031903|Ga0307407_10133206 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1593 | Open in IMG/M |
| 3300031911|Ga0307412_11080592 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 713 | Open in IMG/M |
| 3300031913|Ga0310891_10055587 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → environmental samples → uncultured Gemmatimonadota bacterium | 1121 | Open in IMG/M |
| 3300031949|Ga0214473_10792999 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1022 | Open in IMG/M |
| 3300031995|Ga0307409_100495041 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 1189 | Open in IMG/M |
| 3300032002|Ga0307416_103137418 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → unclassified Gemmatimonadales → Gemmatimonadales bacterium | 553 | Open in IMG/M |
| 3300032005|Ga0307411_10710131 | Not Available | 877 | Open in IMG/M |
| 3300032075|Ga0310890_10119614 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300032211|Ga0310896_10712136 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 569 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 24.00% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 11.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 10.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 5.50% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 4.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 2.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.50% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.50% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 1.00% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.50% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.50% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 0.50% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.50% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.50% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.50% |
| Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.50% |
| Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300003267 | Sugarcane bulk soil Sample L1 | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300003999 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleA_D2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004780 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare1Fresh | Environmental | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005873 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 | Environmental | Open in IMG/M |
| 3300005874 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_404 | Environmental | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009078 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300009840 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105A | Environmental | Open in IMG/M |
| 3300010038 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot106 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010041 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot104A | Environmental | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010166 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot27 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011003 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t9i015 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012184 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ134 (22.06) | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012681 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ272 (21.06) | Environmental | Open in IMG/M |
| 3300012684 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ279 (21.06) | Environmental | Open in IMG/M |
| 3300012906 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S212-509R-1 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Host-Associated | Open in IMG/M |
| 3300015079 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-6b, vegetation/snow interface) | Environmental | Open in IMG/M |
| 3300017695 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ540 (21.06) (version 2) | Environmental | Open in IMG/M |
| 3300017787 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ497 (22.06) (version 2) | Environmental | Open in IMG/M |
| 3300017789 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ322 (21.06) | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
| 3300018054 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1 | Environmental | Open in IMG/M |
| 3300018059 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_65_coex | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
| 3300019865 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1s1 | Environmental | Open in IMG/M |
| 3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
| 3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
| 3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
| 3300020202 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_10 | Environmental | Open in IMG/M |
| 3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
| 3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
| 3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025327 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027647 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 HiSeq | Environmental | Open in IMG/M |
| 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027713 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare1Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027964 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 HiSeq | Environmental | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028711 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_150 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
| 3300028768 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119 | Environmental | Open in IMG/M |
| 3300028793 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159 | Environmental | Open in IMG/M |
| 3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
| 3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
| 3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030606 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT145D125 | Environmental | Open in IMG/M |
| 3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
| 3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Host-Associated | Open in IMG/M |
| 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Host-Associated | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Host-Associated | Open in IMG/M |
| 3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Host-Associated | Open in IMG/M |
| 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Host-Associated | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_20021602 | 3300000033 | Soil | MENDQVTLGGSELIRWIVVAALVIAGIGLFFYFAPSTKPAVPPSVEESPR* |
| ICChiseqgaiiFebDRAFT_110574692 | 3300000363 | Soil | MDDDRVVLSGSELIRWLIVALVVLAGVGLFFYFAPSSKPAVPPSVQESPR* |
| C688J14111_101448212 | 3300001305 | Soil | MDDDRVTLSGSELLRWVVVAAIVIAGIALFFYFAPSTKPAVPPTVEEGPR* |
| C688J18823_101727372 | 3300001686 | Soil | MDDDRITLSGSELLRWMVVAAVVIAGIALFFYFAPSTKPAVPPTVQEGPR* |
| C688J18823_102155663 | 3300001686 | Soil | MDDDRDVMSGSELIRWIIVALVVLAGVGLFFYFAPSSRPA |
| C688J35102_1200050591 | 3300002568 | Soil | MDDDRDVMSGSELIRWIIVALVVLAGVGLFFYFAPSSRTAVPPSVQETPR* |
| C688J35102_1204242523 | 3300002568 | Soil | MDDDRVALTGSELVRWMVVAAVIIAGIVLFFYFAPSTDPAVPPSV |
| C688J35102_1204923112 | 3300002568 | Soil | LSGSELLRWVVVAAIVIAGIALFFYFAPSTKPAVPPTVEEGPR* |
| soilL1_100694043 | 3300003267 | Sugarcane Root And Bulk Soil | MDDDRSVISGSELVRWLVVALLVIAGIALFFYFAPSTRTAVPPSVQESPR* |
| soilL1_101194683 | 3300003267 | Sugarcane Root And Bulk Soil | MDNDQVTVGRSELLRWIVVAALIVAGVALYFIFAPSTRPAVAPTVEEIPR* |
| soilL2_101240852 | 3300003319 | Sugarcane Root And Bulk Soil | MDEHRVELSGSELLRWIIVALVVIAGIVLFFVFAPSSKPAVPPSVQEVTQ* |
| Ga0055469_101005462 | 3300003999 | Natural And Restored Wetlands | MENDQVTVGRSELLRWVVVAALIVSGVALYFVFAPSTRPAVPPTVEESPR* |
| Ga0063454_1016387611 | 3300004081 | Soil | MDDDRLAGSELFRWMIVAALIVAGIVLFLYFAPSTKPAVPPSVEESPR* |
| Ga0062593_1012208902 | 3300004114 | Soil | MLAGNSPSPEPRMDDDRKTLSGSELMRWVVVAVMVIAGIGLFFYFAPSSQPAVPPSVQETPR* |
| Ga0063455_1001295392 | 3300004153 | Soil | MDDDRLAGSELFRWMIVAALILAGIVLFLYFAPSTKPAVPPSVEESPR* |
| Ga0063356_1016526091 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDDDQVKLGGSELVRWMVVAALIIVGIVLFLYFAPSTKPAIPPSVEESPR* |
| Ga0063356_1042836392 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDNDQVTVGRSELLRWLVVAALIVVGVALYFIFAPSTRPAVPPTVEETPR* |
| Ga0063356_1061094961 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MDDDRTALSGSELIRWLVVAAVIIAGIVLFFYFAPSTKPAVPPTVQESPR* |
| Ga0062378_102045121 | 3300004780 | Wetland Sediment | MENDQVSLAGSELFRWIVVAVLIIAGIGLFLYFAPSTKPAVPPSVEESPR* |
| Ga0070683_1015793542 | 3300005329 | Corn Rhizosphere | PMDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR* |
| Ga0070683_1021816142 | 3300005329 | Corn Rhizosphere | PMDDDRVTLSGSELLRWVVVAAIVIAGIALFFYFAPSTKPAVPPTVQEGPR* |
| Ga0070705_1005126231 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDDRVTLSGSELLRWMVVAAIVIAGIALFFYFAPSTKPAVPPTVQEGPR* |
| Ga0070700_1001752992 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR* |
| Ga0070696_1005033142 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MENDQVTLAGSELVRWIVVALLVIAGIGLFIYFAPSTKPALPPSVEESPR* |
| Ga0070693_1005492911 | 3300005547 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDDRVTLSGSELLRWMVVAAIVIAGIALFFYFAPSTKPAVPPTVQ |
| Ga0068854_1022038642 | 3300005578 | Corn Rhizosphere | RASPMDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR* |
| Ga0075287_10453232 | 3300005873 | Rice Paddy Soil | MDNDQVTVGRSELLRWIVVAALIVAGVALYFVFAPSTRPAVPPTVEESPR* |
| Ga0075288_10804882 | 3300005874 | Rice Paddy Soil | MENDQVTVGRSELLRWMVVAALIVAGVALYFVFAPSTRPAVPPTVEESPR* |
| Ga0081455_100162877 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MNDDRVEVSGSELARWLVVVAIIIAGIGLFFYFAPTSKPSVPPSVEESSQ* |
| Ga0081455_104488252 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDDDKVQLSGSELVRWIIIAAIIIAGIGLYFYFAPSTPPAVPPSVQESPR* |
| Ga0097621_1022981682 | 3300006237 | Miscanthus Rhizosphere | MDDDRVTLSGSELLRWMVVAAIVIAGIALFFYFAPSTKPAVPP |
| Ga0079222_100037143 | 3300006755 | Agricultural Soil | MNDHRAELSGSELMRWLIVALVVVAGIALFFYFGPSSKPAVPPSVQESPR* |
| Ga0079221_106205872 | 3300006804 | Agricultural Soil | MNDHRAELSGSELMRWLIVALVVVAGIALFFYYGPSSKPAVPPSVQESPR* |
| Ga0075428_1012805263 | 3300006844 | Populus Rhizosphere | MEDDRVQLSGSELVRWMVVALVVLAGVGLFFLFAPSSKPAVPASVQETTP* |
| Ga0066710_1020100701 | 3300009012 | Grasslands Soil | MENDQVTLAGSELVRWIVVAVLVIAGIGLFIYFAPSTKPALPPSVEESPR |
| Ga0105106_100047636 | 3300009078 | Freshwater Sediment | MEHDRLELSGWELIRWLVVAALIIAGIGLFFYFAPSTKPVVPPSVEESGP* |
| Ga0111539_110516653 | 3300009094 | Populus Rhizosphere | MDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKP |
| Ga0114129_103468482 | 3300009147 | Populus Rhizosphere | MDDDRVALSGSELIRWMIVVAIIVAGIGLFFYFAPSSKPAVPPTVQESPR* |
| Ga0111538_106832902 | 3300009156 | Populus Rhizosphere | MDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTTPAVPPTVQEGPR* |
| Ga0126307_100172322 | 3300009789 | Serpentine Soil | VMDQDREVLTGSELGRWVMVAVLIIAGIALFLYFARSTQPVVAPTVQEPAR* |
| Ga0126307_103956372 | 3300009789 | Serpentine Soil | MDDDRVTLFSSELVRWVVVAAIVIAGIALFFYFAPSTKPAVPPTVQEGPQ* |
| Ga0126307_110492432 | 3300009789 | Serpentine Soil | MQDDRVTLSGSELVRWMVVVAIVIAGIVLFFRFAPTTKPAIPPSVQESPR* |
| Ga0126313_101846723 | 3300009840 | Serpentine Soil | MDDDRVTLSSSEMVRWVAVAAIVIAGIALFFYFAPSTKPAVPPTVQEGPR* |
| Ga0126313_106707981 | 3300009840 | Serpentine Soil | MDQDREVLTGSELARWIIVAVLIIAGVALFFYFARSTQPVVPPTVQEPAR* |
| Ga0126313_108172621 | 3300009840 | Serpentine Soil | MDDDRVTLTGSELVRWMVVAAVIIAGIVLFFYFAPSTEPAVPPSVQEAPR* |
| Ga0126313_114753021 | 3300009840 | Serpentine Soil | VTLSASELLRWMIVVAVIIAGIGLFFYFAPSTEPAVPPSVQESPR* |
| Ga0126315_102051002 | 3300010038 | Serpentine Soil | MQDDRVTLSGSELVRWMVVVAIVIAGIVLFFHFAPTTKPAVPPSVQESSR* |
| Ga0126309_101549612 | 3300010039 | Serpentine Soil | MDDDRVTMSGSDLVRWMVVAAVIIAGIALFFYFAPSTKPAVPPSIQEAPR* |
| Ga0126309_101659052 | 3300010039 | Serpentine Soil | MEREQMTLTGSELVRWIIVAVIAAAGIGLFFYFAPSTEPAVPPSVQESPQ* |
| Ga0126309_102119163 | 3300010039 | Serpentine Soil | MDDDRVALTGSELVRWMVVAAVIIAGIVLFFYFAPSTEPAVPTSVQEGPRER* |
| Ga0126309_108831281 | 3300010039 | Serpentine Soil | MEDQRVTLSGSELLRWMIVAAVIIAGIGLFFYFAPSTEPAVPPSVQESPR* |
| Ga0126308_100269392 | 3300010040 | Serpentine Soil | MEDQRVTLSASELLRWMIVVAVIIAGIGLFFYFAPSTEPAVPPSVQESPR* |
| Ga0126312_101454491 | 3300010041 | Serpentine Soil | RSSTGRAMDQDREVLTGSELARWIIVAVLIIAGVALFFYFARSTQPVVPPTVQEPAR* |
| Ga0126314_100402363 | 3300010042 | Serpentine Soil | MDDDRVTLSSSEMVRWVAVAAIVIVGIALFFYFAPSTKPAVPPTVQEGPR* |
| Ga0126314_107328922 | 3300010042 | Serpentine Soil | MEREQMTLAGSELVRWIIVAVVAAAGIGLFFYFAPSTEPAVPPSVQESPR* |
| Ga0126314_109894752 | 3300010042 | Serpentine Soil | MEDDQVTLGGSDLVRWIVVAALVIAGIGLFFYFAPSTKPAVPPSVEESPR* |
| Ga0126310_101501132 | 3300010044 | Serpentine Soil | MDDDRVTLSSSELVRWVAVAAIVIAGIALFFYFAPSTKPAVPPTVQEGPR* |
| Ga0126311_107843551 | 3300010045 | Serpentine Soil | MEDQRVTLSASELLRWMIVVAVIIAGIGLFFYFAPST |
| Ga0126311_110816792 | 3300010045 | Serpentine Soil | MDQDREVLTGSELARWIIVAVLIIAGVALFFYFARSTQPVVPPTVQEPAQ* |
| Ga0126311_115595021 | 3300010045 | Serpentine Soil | MDQDREVLTGSELARWVIVAVLIIAGIALFFYFAPSTQPVVPPTVQEPAR* |
| Ga0126306_103287092 | 3300010166 | Serpentine Soil | MEDDRVQLSGSELVRWMIVALVVLAGVGLFFYFAPSGKPAVPASVQEVTP* |
| Ga0126306_103767463 | 3300010166 | Serpentine Soil | MQDDRVTLSGAELVRWMVVVAIVIAGIVLFFYFAPTTK |
| Ga0134125_101158261 | 3300010371 | Terrestrial Soil | MDDDRVTLSGSELLRWMVVAVIVIAGIGLFFYFAPSTK |
| Ga0134128_105397662 | 3300010373 | Terrestrial Soil | MDDNRAELSGSELMRWLIVALVVVAGIALFFYFGPSSKPAVPPSVQESPR* |
| Ga0134127_120270802 | 3300010399 | Terrestrial Soil | MDDDRITLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVP |
| Ga0134122_103451013 | 3300010400 | Terrestrial Soil | MDHERVALSGSELIRWLVVAVLVIAGIGLFFYFAPTTEPVV |
| Ga0134122_103828652 | 3300010400 | Terrestrial Soil | MDDDRTALSGSELIRWMVVAVIIIAGIALFFYFGPSSKPTVPPSIQEAPR* |
| Ga0134122_104311652 | 3300010400 | Terrestrial Soil | DDDRVTLSGSELLRWMVVAAIVIAGIALFFYFAPSTKPAVPPTVQEGPR* |
| Ga0138514_1000138243 | 3300011003 | Soil | MENDQVTLGGSELVRWMVVAVLVIAGIGLFLYFAPSTKPAVPPSVEESPR* |
| Ga0136631_100019583 | 3300012043 | Polar Desert Sand | MDHDRVELSGSELIRWLVVAVLIIAGIGLFFYFAPSSRPVVRPSVEESGL* |
| Ga0136610_10730263 | 3300012184 | Polar Desert Sand | MENDRVVLTGSEMVRWLIVAALIVAGVGLFFYFAKSTRPVVSPTVEETVR* |
| Ga0150985_1002464532 | 3300012212 | Avena Fatua Rhizosphere | PMDDDRITLSGSELLRWVVVAAIVIAGIALFFYFAPSTKPAVPPTVEEGPR* |
| Ga0150985_1205846982 | 3300012212 | Avena Fatua Rhizosphere | VNFFAVRALPMDDDRVALTGSELVRWMVVAAVIIAGIVLFFYFAPSTDPAVPPSVQEPPR |
| Ga0150984_1203307191 | 3300012469 | Avena Fatua Rhizosphere | AVNFFAVRALPMDDDRVALTGSELVRWMVVAAVIIAGIVLFFYFAPSTAPPVPPSVQEPPR* |
| Ga0150984_1210989441 | 3300012469 | Avena Fatua Rhizosphere | QSRKFFARALPMDDDRVTLSGSELLRWVVVAAIVIAGIALFFYFAPSTKPAVPPTVEEGPR* |
| Ga0150984_1235656091 | 3300012469 | Avena Fatua Rhizosphere | RRKVFPPEPRMDDDRDVMSGSELIRWIIVALVVLAGVGLFFYFAPSSRPAVPPSVQETPR |
| Ga0136613_100086093 | 3300012681 | Polar Desert Sand | MEQDRVSLTGSELLRWLIVAAMIIAGVGLFFYFAPTTHPVVPPTVQESVR* |
| Ga0136614_101261012 | 3300012684 | Polar Desert Sand | MDQDRAELSGSELIRWLVVAALIIAGIALFFYFAPATRPVVPPSVEEPGS* |
| Ga0136614_109090512 | 3300012684 | Polar Desert Sand | MDHESAEVTGSELIRWIIVVALVIVGIGLFFYFAPVTQPVVSPTVEETVR* |
| Ga0157295_101494052 | 3300012906 | Soil | MDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPTVPPTVQEGPR* |
| Ga0157301_100817482 | 3300012911 | Soil | DDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR* |
| Ga0137404_110154972 | 3300012929 | Vadose Zone Soil | MENDQVTLAGSELVRWMVVAVLVIAGIGLFLYFAPSTKPAVPPSVEESPR* |
| Ga0164300_101721892 | 3300012951 | Soil | MDDDRVTLSGSELFRWVVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR* |
| Ga0164303_109544631 | 3300012957 | Soil | MDDDRTTLSGSELIRWVIVAVLVLVGVGLYFYFAPSSQPAVPPSVQESPR* |
| Ga0164303_111841921 | 3300012957 | Soil | MDDDRVTLSGSELLRWMVVAVIVIAGIGLFFYFAPSTKPAVPPTVQEGPR* |
| Ga0164299_110596102 | 3300012958 | Soil | MDDDRVTLSGSELLRWVVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR* |
| Ga0164301_105535522 | 3300012960 | Soil | MNDDRTTLSGSELMRWVVVAVVVLAGIGLFFYFAPSSQPAVPPSVQETPR* |
| Ga0164302_114930632 | 3300012961 | Soil | MDDDRVALSGSELIRWMIVAAIIIAGIGLFFYFAPSSKPAVPPTVQESPR* |
| Ga0164304_115692282 | 3300012986 | Soil | MDDDRVALSGSELIRWMVVAAIIIAGIVLFFYFASSTKPAVPPTVQESPR* |
| Ga0164304_115707551 | 3300012986 | Soil | APEPHMDDNRAELSGSELMRWLIVALVVVAGIALFFYFGPSSKPAVPPSVQESPR* |
| Ga0164305_107387922 | 3300012989 | Soil | MDDDRTTLSGSELMRWVVVAVVVLAGIGLFFYFAPSSQPAVPPSVQETPR* |
| Ga0157371_109096811 | 3300013102 | Corn Rhizosphere | MDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEG |
| Ga0120158_101306034 | 3300013772 | Permafrost | MDEDRVTLAGSDLARWIVIAVIIIAGVGLFLYFAPSAKPAVPPTVEEVPQ* |
| Ga0075314_10470971 | 3300014265 | Natural And Restored Wetlands | MDRDRISLTGSELFRWIFVAALIVAGIGLFFYFARSAQPIVPPTVEESVR* |
| Ga0182008_103451612 | 3300014497 | Rhizosphere | MDDNRAELSGSELMRWLIVALVVVAGIALFFYFAPSSKPAVPPSVQESPR* |
| Ga0167657_10085013 | 3300015079 | Glacier Forefield Soil | MDHDRVELSGSELIRWLVVAALVVAGIGLFFYFAPSSKPVVPPSVEEPAP* |
| Ga0180121_1000017013 | 3300017695 | Polar Desert Sand | MDHDRVELSGSELIRWLVVAVLIIAGIGLFFYFAPSSRPVVRPSVEESGL |
| Ga0183260_100090164 | 3300017787 | Polar Desert Sand | MEQDRVSLTGSELLRWLIVAAMIIAGVGLFFYFAPTTHPVVPPTVQESVR |
| Ga0136617_1000019131 | 3300017789 | Polar Desert Sand | MENDRVVLTGSEMVRWLIVAALIVAGVGLFFYFAKSTRPVVSPTVEETVR |
| Ga0136617_103824992 | 3300017789 | Polar Desert Sand | MDQERITLAGAELIRWLILAALIVAGIALFFYFGPSTQPVVPPSVQETPR |
| Ga0184610_10234942 | 3300017997 | Groundwater Sediment | MDHDRVELRGSELIRWLVVAALIIVGIGLFFYFAPSSRPVVPPSVEESGP |
| Ga0184610_11286802 | 3300017997 | Groundwater Sediment | MEQERAELRGSELIRWLVVAALIIAGIGLFFCFAPSTKPVVPPSVGESGP |
| Ga0184604_100257982 | 3300018000 | Groundwater Sediment | MENDQVTLAGSELVRWMVVAVLVIAGIGLFLYFAPSTKPAVPPSVEESPR |
| Ga0184605_101513472 | 3300018027 | Groundwater Sediment | MENDQVTLAGSELVRWVVVAAIVIVGIGLFLYFAPTTKPALPPSVEESPR |
| Ga0184605_102338151 | 3300018027 | Groundwater Sediment | MENDQVTLAGSELVRWMVIAVLVIAGIGLFLYFAPSTKPAVPPSVEESPP |
| Ga0184605_103621632 | 3300018027 | Groundwater Sediment | MENDQVTLAGSELVRWMVVAVLVIAGIGLFLYFAPSTQPAVPPSVEESPR |
| Ga0184608_100282343 | 3300018028 | Groundwater Sediment | MENDQVTLAGSELVRWIVVAALVIAGIGLFFYFAPSTKPAVPPSVEESPR |
| Ga0184608_101792992 | 3300018028 | Groundwater Sediment | MEQERAELRGSELIRWLVVAALIVAGIGLFFYFAPASRPVVLPSVEEPGR |
| Ga0184620_101095033 | 3300018051 | Groundwater Sediment | MEQERAELRGSELIRWLVVAALIVAGIGLFFYFAPASRPVVLPSVEE |
| Ga0184626_101239283 | 3300018053 | Groundwater Sediment | MDHDRVELTGSELIRWLVVAALIIAGIGLFFYFAPASRPVVPPSVEESGP |
| Ga0184621_100261723 | 3300018054 | Groundwater Sediment | MDHDRVELSGSELIRWLVVAALIVAGIGLFFYFAPASRPVVLPSVEEPGR |
| Ga0184615_104309702 | 3300018059 | Groundwater Sediment | MDQDRVELSGGELIRWLVVAALIIAGIGLFFYFAPSTKPVVPPSVEESGP |
| Ga0184637_100630022 | 3300018063 | Groundwater Sediment | MDHDRVEVSGSELIRWLVVAALIIAGIGLFFYFAPSTRPVVTPSVEESGP |
| Ga0184618_103255411 | 3300018071 | Groundwater Sediment | MENDQVTLAGSELVRWIVVAVLVIAGVGLFLYFAPSTKPAVPPSVEESPR |
| Ga0184618_104396302 | 3300018071 | Groundwater Sediment | MSAGIFFPLGESIMENDQVTLAGSELVRWMVVAVLVIAGIGLFLYFAPSTKPAVPPSVEESPR |
| Ga0184632_100681853 | 3300018075 | Groundwater Sediment | MDHDRVELRGSELIRWLVVAVLIIVGIGLFFYFAPASRPVVPPSVEESGP |
| Ga0184632_101092801 | 3300018075 | Groundwater Sediment | KSPLTRHLMDHDRVELRGSELIRWLVVAALIIVGIGLFFYFAPSSRPVVPPSVEESGP |
| Ga0184609_103934082 | 3300018076 | Groundwater Sediment | MENDQVTLAGSELVRWIVVAALVIAGIGLFLYFAPSTKPAVPPSVEESPR |
| Ga0184633_106088671 | 3300018077 | Groundwater Sediment | MDHDRVELSGSELIRWLVVAALVIAGIGLFFYFAPSSKPVVPPSVEESGP |
| Ga0184639_100317713 | 3300018082 | Groundwater Sediment | MDHDRVELSGSELIRWLVVAALIIVGIGLFFYFAPSSRPVVPPSVEESGP |
| Ga0184629_100941053 | 3300018084 | Groundwater Sediment | MDHDRVELRGSELIRWLVVAALIIVGIGLFFYFAPSSRPVVPPSVEESSP |
| Ga0190265_100287413 | 3300018422 | Soil | MDRDRVELSGSELIRWLVVAAIIIAGIGLFFYFAPSTEPVVRPSIEELGR |
| Ga0190265_102901142 | 3300018422 | Soil | MDHDRIELSGSELIRWLIVAALIIAGIALFFYFAPSTTPVVPPSVEEPGR |
| Ga0190265_104952812 | 3300018422 | Soil | MDHDRVEVSGSELIRWLVVAALIIAGIGLFFYFAPSTKPVVRPSVEEQGQ |
| Ga0190265_111790072 | 3300018422 | Soil | MDHDRVELSGSELMRWLAVAAIIIAGIALFFYFAPSTQPVVRPSVEESGR |
| Ga0190272_106697202 | 3300018429 | Soil | MDHDRAELSGSELIRWLVVAALIIAGIGLFFCFAPSTKPVVPPSVGESGR |
| Ga0173481_103344912 | 3300019356 | Soil | MDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR |
| Ga0187893_104646252 | 3300019487 | Microbial Mat On Rocks | MDKDRTELAGTELLRWAVVAAIVIAGIALFFYFAASTEPVVPPTVQEAAP |
| Ga0193748_10179202 | 3300019865 | Soil | MENDQVTLAGSELVRWIVVAVLVVVGIGLFLYFAPSTKPALPPSVEESPR |
| Ga0193711_10457192 | 3300019997 | Soil | MDHDRAELRGSELIRWLVVAALIIAGIGLFFYFAPA |
| Ga0193733_10364552 | 3300020022 | Soil | MDDERVALSGSELIRWMVVAAIIIAGIGLFFYFAPSSKPVVPPSVQESPR |
| Ga0193717_10496373 | 3300020060 | Soil | MDRDRVEVSGSELIRWLVVAALIIAGIGLFFYFAPSTKPVVRPSVEELGR |
| Ga0196964_100454283 | 3300020202 | Soil | MNDDKVTLSGSELIRWLIIAVVIIAGIALYFYFAPSTEPAVPPSVQESSR |
| Ga0210382_103579382 | 3300021080 | Groundwater Sediment | MENDQVTLAGSELVRWIVVAALVIAGIGLFLYFAPSTQPAVPPSVEESPR |
| Ga0222623_100340893 | 3300022694 | Groundwater Sediment | MDHDRAELRGSELIRWLVVAVLIIVGIGLFFYFAPASRPVVPPSVEESGP |
| Ga0209431_102301072 | 3300025313 | Soil | MDHDRAELSGSELIRWLVVAALIIVGIGLFFYFAPSTRPVVPPSVEETGS |
| Ga0209341_102653031 | 3300025325 | Soil | MEHDRLEVSGWELSRWLVVAALIIAGIGLFFYFAPSTKPVVPPSVEESGP |
| Ga0209341_106097502 | 3300025325 | Soil | MDHDRAELSGSELIRWLLVAALIIVGIGLFFYFAPLTRPVVPPSVEETGS |
| Ga0209341_106811012 | 3300025325 | Soil | MDHDRVELSGSELIRWLVVAALIIAGVGLFFYFTPSTKPVVPPSVEESGP |
| Ga0209751_113329501 | 3300025327 | Soil | EHDRLELSGWELIRWLVVAALIIAGIGLFFYFAPSTKPVVPPSVEESGP |
| Ga0207705_110758221 | 3300025909 | Corn Rhizosphere | SSNFFARASPMDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR |
| Ga0207707_107291283 | 3300025912 | Corn Rhizosphere | MDDDRVTLSGSELLRWMVVAAIVIAGIALFFYFAPSTK |
| Ga0207657_102601843 | 3300025919 | Corn Rhizosphere | MDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPA |
| Ga0207706_102356732 | 3300025933 | Corn Rhizosphere | MDDDRVTLSGSELLRLMVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR |
| Ga0207709_115782871 | 3300025935 | Miscanthus Rhizosphere | MDDDRVTLSGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVP |
| Ga0207669_113410042 | 3300025937 | Miscanthus Rhizosphere | MDDDRVTISGSELLRWMVVAAIVIAGIGLFFYFAPSTKPAVPPTVQEGPR |
| Ga0207661_108181051 | 3300025944 | Corn Rhizosphere | PMDDDRVTLSGSELLRWVVVAAIVIAGIALFFYFAPSTKPAVPPTVQEGPR |
| Ga0207698_102432911 | 3300026142 | Corn Rhizosphere | MDDDRVTLSGSELLRWMVVAPIVIAGIGLFFYFAPSTKPAVPPTVQEGPR |
| Ga0214468_11187131 | 3300027647 | Soil | MDQERVSLTGSELFRWLFMAALIIAGIGLFFYFAPSTEPVVPPTVQESDR |
| Ga0209966_11394532 | 3300027695 | Arabidopsis Thaliana Rhizosphere | MDDDQVKLGGSELVRWMVVAALIIVGIVLFLYFAPSTKPAIPPSVEESPR |
| Ga0209286_11743012 | 3300027713 | Freshwater Sediment | MEHDRLELSGWELIRWLVVAALIIAGIGLFFYFAPSTKPVVPPSVEESGP |
| Ga0209464_101167722 | 3300027778 | Wetland Sediment | MENDQVSLAGSELFRWIVVAVLIIAGIGLFLYFAPSTKPAVPPSVEESPR |
| Ga0209074_101689162 | 3300027787 | Agricultural Soil | MNDHRAELSGSELMRWLIVALVVVAGIALFFYFGPSSKPAVPPSVQESPR |
| Ga0209382_100202385 | 3300027909 | Populus Rhizosphere | MEDDRVQLSGSELVRWMVVALVVLAGVGLFFLFAPSSKPAVPASVQETTP |
| Ga0256864_10030013 | 3300027964 | Soil | MDKDRAELAGSELIRWAVVAVIIIAGIVLFFYLAPSTEPVVPPTVEESAP |
| Ga0247828_105637702 | 3300028587 | Soil | MDDDRVTLSGSELLRWMVVAAIVIAGIALFFYFAPSTKPAVPPTVQEGPR |
| Ga0307293_103061451 | 3300028711 | Soil | HLMEQERAELRGSELIRWLVVAALIVAGIGLFFYFAPASRPVVLPSVEEPGR |
| Ga0307313_100250732 | 3300028715 | Soil | MGKDRVELARSELFRWALVAAIIIAGIVLFFYFAPNTEPVVPPTVQENAP |
| Ga0307311_102637042 | 3300028716 | Soil | MDEDRVTLAGSDLIRWLIIAAIIIAGIGLFLYFAPSAKPAVPPTVEEVPQ |
| Ga0307298_101962031 | 3300028717 | Soil | MENDQVTLAGSELVRWMVVAVLVIAGIGLFLYFAPSTKPAVPPSVEES |
| Ga0307307_102327921 | 3300028718 | Soil | MENDQVTLAGSELVRWIVVAALVIAGIGLFLYFAPSTQPAVPPSV |
| Ga0307316_102604762 | 3300028755 | Soil | MENDQVTLAGSELVRWMVVAVLVIAGIGLFLYFAPSTKPAVP |
| Ga0307280_103836292 | 3300028768 | Soil | FPLGESIMENDQVTLAGSELVRWMVVAVLVIAGIGLFLYFAPSTKPAVPPSVEESPR |
| Ga0307299_104087081 | 3300028793 | Soil | MEQERAELRGSELIRWLVVAALIVAGIGLFFYFAPAS |
| Ga0307287_100405421 | 3300028796 | Soil | ENDQVTLAGSELVRWIVVAALVIAGIGLFLYFAPSTKPAVPPSVEESPR |
| Ga0307284_103104992 | 3300028799 | Soil | SIMENDEVTLAGSELVRWAVVAALVIAGIGLFLYFAPSTKPAVPPSVEESPR |
| Ga0307281_100200092 | 3300028803 | Soil | MDHDRVELRGSELIRWLVVAALIIAGIGLFFYFAPASRPVVPPSVEESGP |
| Ga0307281_100591333 | 3300028803 | Soil | MDHDRVELSGSELIRWLVVAALVIAGIGLFFYFAPLTEPVVRPSVEE |
| Ga0307305_100805613 | 3300028807 | Soil | MSAGIFFPLGESIMENDEVTLAGSELVRWAVVAALVIAGIGLFLYFAPSTKPAVPPSVEESPR |
| Ga0307302_101007002 | 3300028814 | Soil | MNAGIFFPLGESLMENDQVTLAGSELVRWIVVAVLVIAGIGLFLYFAPSTKPAVPPSVEESPP |
| Ga0307302_105289532 | 3300028814 | Soil | MEQERAELRGSELIRWLVVAALIVAGIGLFFYFAPASRPVVLPSVEESGR |
| Ga0307310_101512663 | 3300028824 | Soil | MENDQVTLAGSELVRWIVIAVLIIAGVGLFLYFAPSTRPA |
| Ga0307310_104724892 | 3300028824 | Soil | MDEDRVTLAGSDLIRWLIIAALIIAGIGLFLYFAPSAKPA |
| Ga0307312_100304463 | 3300028828 | Soil | MENDEVTLAGSELVRWAVVAALVIAGIGLFLYFAPSTKPAVPPSVEESPR |
| Ga0307278_104456513 | 3300028878 | Soil | MDDDRMALSGSELVRWMIVAAIIIAGIGLYFYFAPSTEPAVPPSVQEVPR |
| Ga0307277_103114761 | 3300028881 | Soil | PLGESIMENDQVTLAGSELVRWIVVAALVIAGIGLFFYFAPSTKPAVPPSVEESPR |
| Ga0307277_103129982 | 3300028881 | Soil | MDDDRVVLSGSELIRWVIVALVILAGVGLFFYFAPSSKPAVPPSVQESPR |
| Ga0307304_100407022 | 3300028885 | Soil | MDEDRVTLAGSDLIRWLIIAGIIIAGIGLFLYFAPSAKPAVPPTVEEVPQ |
| Ga0247827_110903182 | 3300028889 | Soil | MDDDRVTLSGSELLRWMVVAAIVIAGIALFFYFAPSTKPAV |
| Ga0299906_102600542 | 3300030606 | Soil | MDNDRVELSASELVRWALVAAVIIAGLVLFFYLAPSTDPVIPPTVQERAP |
| Ga0299906_105976291 | 3300030606 | Soil | MDDDRVVLSGSELVRWMVVAAIIIAGIGLFFYFAPSSKPAVAPSVQESPR |
| Ga0302046_104970952 | 3300030620 | Soil | MDDDRVVLSGSELVRWMVVAIIIIAGIGLFFYFGPSSEPAVPPSIQESPR |
| Ga0302046_115910272 | 3300030620 | Soil | MDQERAELSGSELIRWLVVAALIIVGIGLFFYFAPSSKPVVPPSVDESAP |
| Ga0299913_103644932 | 3300031229 | Soil | MEHERTTLTGMELVRWLVVAALIIAGIALFFYFAPSTQPVVPPTVQESPR |
| Ga0299913_114550742 | 3300031229 | Soil | MDRDRVVLTGSEVVRWLIVAALIAAGIGLFFYFARSTRPVVPPTVEESVR |
| Ga0307408_1000311363 | 3300031548 | Rhizosphere | MDDDRVVLSGSELLRWMIVAIVVIAGIALFFYFAPSTKPAVPPSVQEAPR |
| Ga0307408_1016750302 | 3300031548 | Rhizosphere | MDDDRVVLTGSELIRWLIIAAVIIAGIGLFFYFAPSTDPAVPPSVEETSR |
| Ga0307408_1022904212 | 3300031548 | Rhizosphere | MENDQVTLSGSELIRWMVIAALIVGGIGLYLYFAPSTKPVVPPSVEESPR |
| Ga0307405_100243052 | 3300031731 | Rhizosphere | MDDDRVVLSRSELLRWMIVAIVVIAGIALFFYFAPSTKPAVPPSVQEAPR |
| Ga0307405_100968072 | 3300031731 | Rhizosphere | MDDDRVVLTGSELIRWLIIAAVIIAGIGLFFYFAPSTNPAVPPSVEETSR |
| Ga0307410_108985291 | 3300031852 | Rhizosphere | MDDDRVTLSSSEMVRWVAVAAIVIAGIALFFYFAPSTKPAVPPTVQEGPR |
| Ga0307407_101332061 | 3300031903 | Rhizosphere | MDEDRVVVSGSELIRWVIIALVVIAGIGLFFYFAPSTEPA |
| Ga0307412_110805922 | 3300031911 | Rhizosphere | MDEDRVVVSGSELIRWVIIALVVIAGIGLFFYFAPSTEPAVPPTVQETPR |
| Ga0310891_100555871 | 3300031913 | Soil | MDDDRVTLSGSELLRWMVVAAIVIAGIALFFYFAPS |
| Ga0214473_107929991 | 3300031949 | Soil | MEHDRVELSGWELIRWLVVAALIIAGIGLFFYFAPSTKPVVPPSVEESGP |
| Ga0307409_1004950413 | 3300031995 | Rhizosphere | MDDDHVALTGSELVRWMVVAAVIIAGIALFFYFAPSTKPAVPPSVQEAPR |
| Ga0307416_1031374181 | 3300032002 | Rhizosphere | MDDDRVALTGSELVRWLVVAAVVIAGIVLFFYFAP |
| Ga0307411_107101311 | 3300032005 | Rhizosphere | HVALTGSELVRWMVVAAVIIAGIALFFYFAPSTKPAVPPSVQEAPR |
| Ga0310890_101196141 | 3300032075 | Soil | REASPMDDDRVTLSGSELLRWMVVAAIVIAGIALFFYFAPSTKPAVPPTVQEGPR |
| Ga0310896_107121362 | 3300032211 | Soil | PKQEFFARTSPMDDDRVTLSGSELLRWMVVAAIVIAGIALFFYFAPSTKPAVPPTVQEGP |
| ⦗Top⦘ |