| Basic Information | |
|---|---|
| Family ID | F025762 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 43 residues |
| Representative Sequence | AYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS |
| Number of Associated Samples | 161 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.01 % |
| % of genes near scaffold ends (potentially truncated) | 99.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.50 % |
| Associated GOLD sequencing projects | 145 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.41 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (28.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (32.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (53.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 32.39% β-sheet: 0.00% Coil/Unstructured: 67.61% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.41 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF05402 | PqqD | 41.50 |
| PF01061 | ABC2_membrane | 25.50 |
| PF13471 | Transglut_core3 | 6.00 |
| PF14907 | NTP_transf_5 | 4.50 |
| PF13180 | PDZ_2 | 4.00 |
| PF00005 | ABC_tran | 3.00 |
| PF12698 | ABC2_membrane_3 | 1.50 |
| PF01966 | HD | 0.50 |
| PF06325 | PrmA | 0.50 |
| PF06508 | QueC | 0.50 |
| PF02371 | Transposase_20 | 0.50 |
| PF13474 | SnoaL_3 | 0.50 |
| PF08281 | Sigma70_r4_2 | 0.50 |
| PF02538 | Hydantoinase_B | 0.50 |
| PF08335 | GlnD_UR_UTase | 0.50 |
| PF13506 | Glyco_transf_21 | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0146 | N-methylhydantoinase B/oxoprolinase/acetone carboxylase, alpha subunit | Amino acid transport and metabolism [E] | 1.00 |
| COG0037 | tRNA(Ile)-lysidine synthase TilS/MesJ | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0137 | Argininosuccinate synthase | Amino acid transport and metabolism [E] | 0.50 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.50 |
| COG0301 | Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0482 | tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domain | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0519 | GMP synthase, PP-ATPase domain/subunit | Nucleotide transport and metabolism [F] | 0.50 |
| COG0603 | 7-cyano-7-deazaguanine synthase (queuosine biosynthesis) | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0780 | NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamily | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1606 | ATP-utilizing enzyme, PP-loop superfamily | General function prediction only [R] | 0.50 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG2844 | UTP:GlnB (protein PII) uridylyltransferase | Signal transduction mechanisms [T] | 0.50 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.50 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.00 % |
| Unclassified | root | N/A | 4.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000579|AP72_2010_repI_A01DRAFT_1042934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 655 | Open in IMG/M |
| 3300001356|JGI12269J14319_10060812 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2156 | Open in IMG/M |
| 3300001545|JGI12630J15595_10013518 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1757 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101690209 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 532 | Open in IMG/M |
| 3300004080|Ga0062385_11192680 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300004082|Ga0062384_100457656 | All Organisms → cellular organisms → Bacteria | 836 | Open in IMG/M |
| 3300004101|Ga0058896_1254061 | All Organisms → cellular organisms → Bacteria | 852 | Open in IMG/M |
| 3300004157|Ga0062590_100575845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 982 | Open in IMG/M |
| 3300005180|Ga0066685_11039274 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300005332|Ga0066388_108091247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 525 | Open in IMG/M |
| 3300005436|Ga0070713_101544192 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300005436|Ga0070713_102091351 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005467|Ga0070706_100089814 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2849 | Open in IMG/M |
| 3300005538|Ga0070731_10042316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 3049 | Open in IMG/M |
| 3300005538|Ga0070731_10515427 | Not Available | 796 | Open in IMG/M |
| 3300005540|Ga0066697_10570773 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005542|Ga0070732_10451443 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 777 | Open in IMG/M |
| 3300005552|Ga0066701_10071585 | All Organisms → cellular organisms → Bacteria | 1966 | Open in IMG/M |
| 3300005554|Ga0066661_10231487 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
| 3300005556|Ga0066707_10362407 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300005561|Ga0066699_11094358 | All Organisms → cellular organisms → Bacteria | 549 | Open in IMG/M |
| 3300005563|Ga0068855_101066138 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300005569|Ga0066705_10219478 | All Organisms → cellular organisms → Bacteria | 1197 | Open in IMG/M |
| 3300005575|Ga0066702_10827162 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300005586|Ga0066691_10567761 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300005598|Ga0066706_10188287 | All Organisms → cellular organisms → Bacteria | 1579 | Open in IMG/M |
| 3300005602|Ga0070762_10270767 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1062 | Open in IMG/M |
| 3300005610|Ga0070763_10436613 | Not Available | 741 | Open in IMG/M |
| 3300005610|Ga0070763_10962960 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300005921|Ga0070766_10470538 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
| 3300006028|Ga0070717_11617219 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300006354|Ga0075021_10470350 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
| 3300006354|Ga0075021_10990247 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
| 3300006358|Ga0068871_100089361 | All Organisms → cellular organisms → Bacteria | 2564 | Open in IMG/M |
| 3300006797|Ga0066659_10817072 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 773 | Open in IMG/M |
| 3300006797|Ga0066659_11933277 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 501 | Open in IMG/M |
| 3300006804|Ga0079221_11650921 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300006893|Ga0073928_10188880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1624 | Open in IMG/M |
| 3300006954|Ga0079219_11044692 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300007255|Ga0099791_10080877 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300007258|Ga0099793_10450022 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300009012|Ga0066710_103266820 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300009038|Ga0099829_11570532 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300009088|Ga0099830_10390255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1124 | Open in IMG/M |
| 3300009088|Ga0099830_10829882 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300009089|Ga0099828_10647460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 950 | Open in IMG/M |
| 3300009089|Ga0099828_10652434 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300009098|Ga0105245_10382548 | All Organisms → cellular organisms → Bacteria | 1402 | Open in IMG/M |
| 3300009143|Ga0099792_10732842 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300009698|Ga0116216_10829385 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300010048|Ga0126373_10081188 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
| 3300010048|Ga0126373_10876332 | All Organisms → cellular organisms → Bacteria | 961 | Open in IMG/M |
| 3300010154|Ga0127503_10793243 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010304|Ga0134088_10648697 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300010320|Ga0134109_10028004 | All Organisms → cellular organisms → Bacteria | 1773 | Open in IMG/M |
| 3300010343|Ga0074044_10911529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 575 | Open in IMG/M |
| 3300010358|Ga0126370_11608631 | All Organisms → cellular organisms → Bacteria | 622 | Open in IMG/M |
| 3300010359|Ga0126376_12234090 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300010360|Ga0126372_11500064 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300010360|Ga0126372_12152384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300010366|Ga0126379_10371232 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300010376|Ga0126381_101080742 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300010877|Ga0126356_10666514 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 783 | Open in IMG/M |
| 3300011269|Ga0137392_10275861 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
| 3300011269|Ga0137392_10485064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1027 | Open in IMG/M |
| 3300011271|Ga0137393_10163677 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1864 | Open in IMG/M |
| 3300011271|Ga0137393_10729129 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300011271|Ga0137393_10776617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 819 | Open in IMG/M |
| 3300011271|Ga0137393_11079283 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 682 | Open in IMG/M |
| 3300011271|Ga0137393_11226629 | All Organisms → cellular organisms → Bacteria | 636 | Open in IMG/M |
| 3300012189|Ga0137388_10223868 | All Organisms → cellular organisms → Bacteria | 1704 | Open in IMG/M |
| 3300012189|Ga0137388_10561446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1061 | Open in IMG/M |
| 3300012189|Ga0137388_11032592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
| 3300012198|Ga0137364_10403431 | All Organisms → cellular organisms → Bacteria | 1023 | Open in IMG/M |
| 3300012199|Ga0137383_11347332 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 507 | Open in IMG/M |
| 3300012201|Ga0137365_10682623 | All Organisms → cellular organisms → Bacteria | 751 | Open in IMG/M |
| 3300012202|Ga0137363_10049773 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2997 | Open in IMG/M |
| 3300012203|Ga0137399_10450980 | All Organisms → cellular organisms → Bacteria | 1076 | Open in IMG/M |
| 3300012203|Ga0137399_10908289 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300012203|Ga0137399_11070896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 679 | Open in IMG/M |
| 3300012203|Ga0137399_11098426 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300012203|Ga0137399_11374236 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300012205|Ga0137362_10986808 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300012206|Ga0137380_10462852 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300012207|Ga0137381_11599672 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300012208|Ga0137376_11752652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300012209|Ga0137379_11831649 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300012210|Ga0137378_10352657 | All Organisms → cellular organisms → Bacteria | 1367 | Open in IMG/M |
| 3300012211|Ga0137377_11294932 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300012211|Ga0137377_11454195 | All Organisms → cellular organisms → Bacteria | 612 | Open in IMG/M |
| 3300012361|Ga0137360_10155050 | All Organisms → cellular organisms → Bacteria | 1819 | Open in IMG/M |
| 3300012361|Ga0137360_10199325 | All Organisms → cellular organisms → Bacteria | 1619 | Open in IMG/M |
| 3300012362|Ga0137361_10093863 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 2595 | Open in IMG/M |
| 3300012362|Ga0137361_10133895 | Not Available | 2198 | Open in IMG/M |
| 3300012363|Ga0137390_10271014 | All Organisms → cellular organisms → Bacteria | 1682 | Open in IMG/M |
| 3300012582|Ga0137358_10423257 | All Organisms → cellular organisms → Bacteria | 900 | Open in IMG/M |
| 3300012925|Ga0137419_11734431 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 533 | Open in IMG/M |
| 3300012929|Ga0137404_12106894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300012930|Ga0137407_10691482 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → unclassified Oscillatoria → Oscillatoria sp. | 960 | Open in IMG/M |
| 3300012971|Ga0126369_12643931 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
| 3300012975|Ga0134110_10334341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300014154|Ga0134075_10430290 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300015054|Ga0137420_1264089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 749 | Open in IMG/M |
| 3300015241|Ga0137418_11124989 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300015242|Ga0137412_10123354 | All Organisms → cellular organisms → Bacteria | 2098 | Open in IMG/M |
| 3300015242|Ga0137412_10227558 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300015356|Ga0134073_10146152 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300016371|Ga0182034_10057586 | All Organisms → cellular organisms → Bacteria | 2601 | Open in IMG/M |
| 3300016422|Ga0182039_11212841 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300016445|Ga0182038_11476908 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300017656|Ga0134112_10379718 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
| 3300017659|Ga0134083_10508160 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300017955|Ga0187817_10740834 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300017972|Ga0187781_10247039 | All Organisms → cellular organisms → Bacteria | 1262 | Open in IMG/M |
| 3300018006|Ga0187804_10510539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300018060|Ga0187765_10163427 | All Organisms → cellular organisms → Bacteria | 1265 | Open in IMG/M |
| 3300018433|Ga0066667_10054403 | All Organisms → cellular organisms → Bacteria | 2436 | Open in IMG/M |
| 3300020199|Ga0179592_10211783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
| 3300020579|Ga0210407_10548509 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 902 | Open in IMG/M |
| 3300020579|Ga0210407_11278251 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300020581|Ga0210399_10178969 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300020581|Ga0210399_10292132 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1361 | Open in IMG/M |
| 3300020581|Ga0210399_10295756 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300020581|Ga0210399_11125496 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 627 | Open in IMG/M |
| 3300021086|Ga0179596_10278717 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300021178|Ga0210408_10244229 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300021178|Ga0210408_10396402 | All Organisms → cellular organisms → Bacteria | 1100 | Open in IMG/M |
| 3300021180|Ga0210396_11651916 | All Organisms → cellular organisms → Bacteria | 522 | Open in IMG/M |
| 3300021432|Ga0210384_11770934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300021475|Ga0210392_10960372 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 640 | Open in IMG/M |
| 3300021477|Ga0210398_10694593 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 823 | Open in IMG/M |
| 3300021478|Ga0210402_10073031 | All Organisms → cellular organisms → Bacteria | 3038 | Open in IMG/M |
| 3300021478|Ga0210402_10533393 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1089 | Open in IMG/M |
| 3300021559|Ga0210409_11320375 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300024251|Ga0247679_1077399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 559 | Open in IMG/M |
| 3300025928|Ga0207700_11310138 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300025938|Ga0207704_10076313 | All Organisms → cellular organisms → Bacteria | 2147 | Open in IMG/M |
| 3300025949|Ga0207667_11531682 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300026281|Ga0209863_10034083 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300026295|Ga0209234_1305347 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300026304|Ga0209240_1223835 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300026310|Ga0209239_1166798 | All Organisms → cellular organisms → Bacteria | 849 | Open in IMG/M |
| 3300026332|Ga0209803_1203517 | All Organisms → cellular organisms → Bacteria | 725 | Open in IMG/M |
| 3300026334|Ga0209377_1170395 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300026481|Ga0257155_1086647 | Not Available | 512 | Open in IMG/M |
| 3300026490|Ga0257153_1089788 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300026530|Ga0209807_1342436 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026548|Ga0209161_10511675 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 532 | Open in IMG/M |
| 3300026555|Ga0179593_1168806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3390 | Open in IMG/M |
| 3300026557|Ga0179587_11035065 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300027181|Ga0208997_1071533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300027371|Ga0209418_1045106 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. J18 | 780 | Open in IMG/M |
| 3300027671|Ga0209588_1051627 | All Organisms → cellular organisms → Bacteria | 1330 | Open in IMG/M |
| 3300027737|Ga0209038_10022982 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Brocadia → Candidatus Brocadia sapporoensis | 1839 | Open in IMG/M |
| 3300027738|Ga0208989_10089518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales | 1051 | Open in IMG/M |
| 3300027738|Ga0208989_10311388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300027817|Ga0209112_10116828 | Not Available | 873 | Open in IMG/M |
| 3300027842|Ga0209580_10145695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1164 | Open in IMG/M |
| 3300027842|Ga0209580_10334627 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300027846|Ga0209180_10133240 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300027846|Ga0209180_10136234 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300027855|Ga0209693_10241122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 886 | Open in IMG/M |
| 3300027855|Ga0209693_10414298 | Not Available | 650 | Open in IMG/M |
| 3300027855|Ga0209693_10421325 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 644 | Open in IMG/M |
| 3300027857|Ga0209166_10371942 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 745 | Open in IMG/M |
| 3300027869|Ga0209579_10079412 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes | 1736 | Open in IMG/M |
| 3300027875|Ga0209283_10480314 | All Organisms → cellular organisms → Bacteria | 802 | Open in IMG/M |
| 3300027894|Ga0209068_10556328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 665 | Open in IMG/M |
| 3300028792|Ga0307504_10281449 | All Organisms → cellular organisms → Bacteria | 620 | Open in IMG/M |
| 3300028798|Ga0302222_10252022 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300028800|Ga0265338_10603168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 765 | Open in IMG/M |
| 3300028906|Ga0308309_10126357 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Candidatus Brocadiia → Candidatus Brocadiales → Candidatus Brocadiaceae → Candidatus Jettenia → Candidatus Jettenia caeni | 2023 | Open in IMG/M |
| 3300028906|Ga0308309_10774620 | All Organisms → cellular organisms → Bacteria | 834 | Open in IMG/M |
| 3300030862|Ga0265753_1102107 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 582 | Open in IMG/M |
| 3300030991|Ga0073994_12360132 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300030991|Ga0073994_12363815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 601 | Open in IMG/M |
| 3300031122|Ga0170822_16379401 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300031549|Ga0318571_10129771 | All Organisms → cellular organisms → Bacteria | 854 | Open in IMG/M |
| 3300031668|Ga0318542_10178967 | All Organisms → cellular organisms → Bacteria | 1063 | Open in IMG/M |
| 3300031708|Ga0310686_103570673 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300031720|Ga0307469_10439940 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300031720|Ga0307469_11398011 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 667 | Open in IMG/M |
| 3300031768|Ga0318509_10542536 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300031797|Ga0318550_10315986 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300031820|Ga0307473_10778329 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
| 3300031823|Ga0307478_11326806 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300031879|Ga0306919_11152475 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300031910|Ga0306923_11720645 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300031947|Ga0310909_10009530 | All Organisms → cellular organisms → Bacteria | 6558 | Open in IMG/M |
| 3300031954|Ga0306926_10542668 | All Organisms → cellular organisms → Bacteria | 1425 | Open in IMG/M |
| 3300031954|Ga0306926_12434621 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300031962|Ga0307479_10545466 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1142 | Open in IMG/M |
| 3300032001|Ga0306922_10999388 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 863 | Open in IMG/M |
| 3300032180|Ga0307471_100042195 | All Organisms → cellular organisms → Bacteria | 3669 | Open in IMG/M |
| 3300032770|Ga0335085_10290216 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1944 | Open in IMG/M |
| 3300032898|Ga0335072_11009627 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 763 | Open in IMG/M |
| 3300032955|Ga0335076_10132884 | Not Available | 2409 | Open in IMG/M |
| 3300033158|Ga0335077_11410260 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300033475|Ga0310811_10754255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 923 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 28.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 12.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 8.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.00% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.50% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.50% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.50% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 0.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.50% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000579 | Forest soil microbial communities from Amazon forest - Pasture72 2010 replicate I A01 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001545 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004101 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF228 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300005180 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 | Environmental | Open in IMG/M |
| 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Host-Associated | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005575 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010154 | Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010877 | Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012199 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014154 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09212015 | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300024251 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK20 | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026281 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046 (SPAdes) | Environmental | Open in IMG/M |
| 3300026295 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 08_20_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
| 3300026490 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-A | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027181 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027371 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300030862 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030991 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031122 | Oak Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
| 3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| AP72_2010_repI_A01DRAFT_10429341 | 3300000579 | Forest Soil | EVVVQPGTVEAYQKAVELDPNGPYGQQAKQGLEALQQIAPGIDTKTKRKKS* |
| JGI12269J14319_100608121 | 3300001356 | Peatlands Soil | PEFAPGTIEAYQKAVELDPNGPFGKQAQEGLAQLQQMAPGIDIKVNQKKKKS* |
| JGI12630J15595_100135183 | 3300001545 | Forest Soil | MAGPIVTGTVEAYQKAVELDPNGGPNSYGAQAKLGLEALQQIQPG |
| JGIcombinedJ26739_1016902091 | 3300002245 | Forest Soil | KIEVQFAPGTVEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGLDTKVNVRKKKS* |
| Ga0062385_111926801 | 3300004080 | Bog Forest Soil | GTVEAYQKAEELDPLTLGAQAKEGLEQLKAIAPGIDTKVNLKKKKS* |
| Ga0062384_1004576562 | 3300004082 | Bog Forest Soil | APGTIEAYQKAIELDPNGPFGQQAKEGLAQLQQMAPGIDIRVNAKKKKS* |
| Ga0058896_12540611 | 3300004101 | Forest Soil | VVFAPGTIEAYQKAIELDPNGPYGEQAKLGLEQLQQMAPGIDIKVKAKKKS* |
| Ga0062590_1005758451 | 3300004157 | Soil | AIDLDPNGPYGQDAKKGLEQLQLMAPGVDIKVNVKKKKS* |
| Ga0066685_110392742 | 3300005180 | Soil | GTIEAYQKAVELDPSGTWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS* |
| Ga0066388_1080912471 | 3300005332 | Tropical Forest Soil | PGTIEAYQKAIELDPNGTYGAQAKQGLEQLQAMAPGIDLKVNVKKKKP* |
| Ga0070713_1015441922 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | YQKAVELDPNGPYGQQAKQGLEALAQIAPGIDTKTKATGKKKS* |
| Ga0070713_1020913512 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | PGTVEAYQHAIELDPNGQWGQQAKQGLDMLNQIAPGIATSVTTKKKKS* |
| Ga0070706_1000898141 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | AIELDPNGPWGQQAKQGLDMLNQIAPGIATSVTTKKKKS* |
| Ga0070707_1010907733 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | EAYQHAIELDPNGPWGQQAKQGLDMLNQIAPGIATSVTTKKKKS* |
| Ga0070731_100423161 | 3300005538 | Surface Soil | PGTVEAYQKALELDPNGQWGAQAKQGLEQLQAIAPGIDTKLNVKKKKS* |
| Ga0070731_105154271 | 3300005538 | Surface Soil | DPNGTYGQQAKQGLEALAQIAPGIDTKTKTGKKKS* |
| Ga0066697_105707731 | 3300005540 | Soil | PGTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKINVKKKKS* |
| Ga0070732_104514433 | 3300005542 | Surface Soil | DPNGTYGQQAKAGLEQLQQMAPGIDLKVNVRKKKS* |
| Ga0066701_100715853 | 3300005552 | Soil | KAVELDPNGTWGQQAKQGLEQLQLMAPGIETKVNLKKKKS* |
| Ga0066661_102314871 | 3300005554 | Soil | APGTVEAYQKAEDLDPNGPWGQQAKQGLTDLKALGAGIETKVNVKKKKS* |
| Ga0066707_103624071 | 3300005556 | Soil | VPDVQPGTVEAYQHAIELDPNGPWGQQAKQGLDMLNQIAPGIATSVTTKKKKS* |
| Ga0066699_110943582 | 3300005561 | Soil | PGTIEAYQKAIELDPNGTYGQQAKAGLEQLQQMAPGIDLKVNVRKKKS* |
| Ga0068855_1010661383 | 3300005563 | Corn Rhizosphere | GTLEAYQKAVELDPNGPYGQQAKQGIDALAQMDKGIETRVKAAKKKS* |
| Ga0066705_102194784 | 3300005569 | Soil | QFAPGTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS* |
| Ga0066702_108271621 | 3300005575 | Soil | LPGTLEAYQKAVELDPNGPYGQQAKQGIDALASMDKGIETRVKAGKKKS* |
| Ga0066691_105677612 | 3300005586 | Soil | AVELDPNGTWGQQAKQGLDQLQLMAPGIDTKVNMKKKKS* |
| Ga0066706_101882875 | 3300005598 | Soil | VELDPNGTWGQQAKQGLDQLQLMAPGIDTKVNMKKKKS* |
| Ga0070762_102707672 | 3300005602 | Soil | DLDPNGTYGQQAKQGLEALAQIAPGIDTKLKKKKS* |
| Ga0070763_104366132 | 3300005610 | Soil | DPNGPYGQQAKQGLEALAQIAPGIDTKTKSTGKKKS* |
| Ga0070763_109629601 | 3300005610 | Soil | EFAPGTIEAYQKALELDPNGPFGQQAKEGLAQLQQMAPGIDIRVTKKKKS* |
| Ga0070766_104705382 | 3300005921 | Soil | LAPGTVEAYQKAVDLDPNGPWGAQAKQGLEQLQAIAPGIDIKVSVKKKKS* |
| Ga0070717_116172192 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | YQKALELDPNGPYGQQAKQGLEALQQIAPGIDTKTKRKKS* |
| Ga0075021_104703502 | 3300006354 | Watersheds | FAPGTIEAYQKAVELDPNGAWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS* |
| Ga0075021_109902472 | 3300006354 | Watersheds | FAPGTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS* |
| Ga0068871_1000893611 | 3300006358 | Miscanthus Rhizosphere | DLDPNGPWGQQAKQGLDMLNQISPGIATSVTTKKKKS* |
| Ga0066659_108170721 | 3300006797 | Soil | QFAPGTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKINVKKKKS* |
| Ga0066659_119332771 | 3300006797 | Soil | GTVEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS* |
| Ga0079221_116509211 | 3300006804 | Agricultural Soil | YQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS* |
| Ga0073928_101888802 | 3300006893 | Iron-Sulfur Acid Spring | DLDPNGQWGAQAKQGLEQLQAIAPGIDIKVNVKKKKS* |
| Ga0079219_110446922 | 3300006954 | Agricultural Soil | EAYQRAVELDPTGTWGQQAKQGLDGLQQIAPGIDTKVNTKKKKS* |
| Ga0099791_100808771 | 3300007255 | Vadose Zone Soil | EVITFAPGTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS* |
| Ga0099793_104500222 | 3300007258 | Vadose Zone Soil | ELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS* |
| Ga0066710_1032668202 | 3300009012 | Grasslands Soil | QFAPGTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKINVKKKKS |
| Ga0099829_115705322 | 3300009038 | Vadose Zone Soil | ELDPNGTWGQQAKQGLDQLQLMAPGIDTKVNMKKKKS* |
| Ga0099830_103902551 | 3300009088 | Vadose Zone Soil | REEVQLAPGTVEAYQKAEELDPNGPWGQQAKQGLTDLKALGAGIEMKVNVKKKKS* |
| Ga0099830_108298821 | 3300009088 | Vadose Zone Soil | PSGQWGQQAKQGLEQLQLMAPGIDIKVNVKKKKS* |
| Ga0099828_106474601 | 3300009089 | Vadose Zone Soil | PGTVEAYQKAAELDPNGPYGQQAKQGLEALQQVAPGIDTKIKKKKS* |
| Ga0099828_106524343 | 3300009089 | Vadose Zone Soil | GTVEAYQKAVDLDPNGTYGQQAKQGLEALQQITPGFDTKLKKKKS* |
| Ga0105245_103825484 | 3300009098 | Miscanthus Rhizosphere | VTVLPGTLEAYQKAVELDPNGPYGQQAKQGIDALAQMDKGIETKVKAAKKKS* |
| Ga0099792_107328422 | 3300009143 | Vadose Zone Soil | PGTVEAYQKAIELDPNGGPNSYGAQAKQGLEALQQIAPGIDTKVNVKKKKS* |
| Ga0116216_108293851 | 3300009698 | Peatlands Soil | TIEAYQKAIELDPNGPWGQQAKQGLDQLQMMAPGIDLKVNVKKKKS* |
| Ga0126373_100811885 | 3300010048 | Tropical Forest Soil | LAPGTVEAYQKAEELDPNGPWGTQAKQGLTDLKALGAGIDTKVNVRKKKS* |
| Ga0126373_108763321 | 3300010048 | Tropical Forest Soil | KQIPEFAPGTIEAYQKAIELDPNGTYGAQAKQGLEQLQAMAPGIDLKVNVKKKKP* |
| Ga0127503_107932431 | 3300010154 | Soil | ITFAPGTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNMKKKKS* |
| Ga0134088_106486972 | 3300010304 | Grasslands Soil | YPKAGVLHPSGQWGQQAKQGLEQLQLMAPGIDIKVNVKKKKS* |
| Ga0134109_100280041 | 3300010320 | Grasslands Soil | LDPNGTWGQQAKQGLEQLQLMAPGIETKVNLKKKKS* |
| Ga0074044_109115292 | 3300010343 | Bog Forest Soil | QKAVELDPNGPYGQQAKQGLEQLQQIAPGINIKVDAKKKKSS* |
| Ga0126370_116086311 | 3300010358 | Tropical Forest Soil | IVFAPGTIEAYQKAIELDPNGSYGADAKKGLEQLQAMAPGIDLKVSKKKKP* |
| Ga0126376_122340901 | 3300010359 | Tropical Forest Soil | VDLDPNGPWGAQAKQGLTDLQAMGAAGIDAKVNTKKKKS* |
| Ga0126372_115000642 | 3300010360 | Tropical Forest Soil | PNGPYGQQAKQGLDALAQIAPGIDTKMKTGKKKS* |
| Ga0126372_121523841 | 3300010360 | Tropical Forest Soil | TVEAYQKAVELDPNGTYGQQAKQGLEALAQIAPGIDTKTKVTGKKKS* |
| Ga0126379_103712324 | 3300010366 | Tropical Forest Soil | QKAIELDPNGTYGQQAKAGLEQLQQMAPGIDLKVNVRKKKS* |
| Ga0126381_1010807423 | 3300010376 | Tropical Forest Soil | LDPNGPWGAQAKQGLTDLQAMGAAGIDAKVNTKKKKS* |
| Ga0126356_106665142 | 3300010877 | Boreal Forest Soil | QPGTVEAYQKAVELDPNGTYGQQAKQGLEALAAIAPGIDTKTKVKKKS* |
| Ga0137392_102758611 | 3300011269 | Vadose Zone Soil | KAVELDPSGQWGQQAKQGLEQLQLMAPGIDIKVNLKKKKS* |
| Ga0137392_104850641 | 3300011269 | Vadose Zone Soil | FAPGTIEAYQKAIELDPNGQWGQQAKQGLEQLQLMAPGIDIRVNVKKKKT* |
| Ga0137393_101636772 | 3300011271 | Vadose Zone Soil | AYQKAAELDPNGPYGQQAKQGLEALQQLAPGIDTKVKKKKS* |
| Ga0137393_107291291 | 3300011271 | Vadose Zone Soil | ELDPNGQWGQQAKQGLEQLQLMAPGIDIKVNVKKKKT* |
| Ga0137393_107766171 | 3300011271 | Vadose Zone Soil | LDPSGQWGQQAKQGLEQLQLMAPGIDIKVNVKKKKS* |
| Ga0137393_110792832 | 3300011271 | Vadose Zone Soil | PDVQPGTVEAYQHAIELDPNGPWGTQAKQGLDMLNQISPGIATSVTAKKKKP* |
| Ga0137393_112266291 | 3300011271 | Vadose Zone Soil | LDPNGVWGQQAKQGLEQLQLMAPGIETKVNLKKKKS* |
| Ga0137388_102238681 | 3300012189 | Vadose Zone Soil | QKALELDPNGVWGQQAKQGLEQLQLMAPGIETKVNLKKKKS* |
| Ga0137388_105614463 | 3300012189 | Vadose Zone Soil | EAYQKAAELDPNGPYGQQAKQGLEALQQIAPGIDTKVKKKKS* |
| Ga0137388_110325922 | 3300012189 | Vadose Zone Soil | YRKAIELDPNGPYGAQAKQGLESLQAMGVSGIDTKMLTRKKK* |
| Ga0137364_104034313 | 3300012198 | Vadose Zone Soil | EAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS* |
| Ga0137383_113473322 | 3300012199 | Vadose Zone Soil | RPGTVEAYRGAVELDPTGRWGQQAKQGLDGLQQIAPGIDTKVNTKKKKS* |
| Ga0137365_106826231 | 3300012201 | Vadose Zone Soil | QKAVELDPNGPYGQQAKAGLEQLQQMAPGIDLKVYGKKKKS* |
| Ga0137363_100497731 | 3300012202 | Vadose Zone Soil | ELDPNGPYGQQAKQGLEALQQIAPGIDTKVKKKKS* |
| Ga0137399_104509801 | 3300012203 | Vadose Zone Soil | RFAPGTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIETKVNVRKKKS* |
| Ga0137399_109082891 | 3300012203 | Vadose Zone Soil | DPNGTWGQQAKQGLDQLQLMAPGIDTKVNMKKKKS* |
| Ga0137399_110708961 | 3300012203 | Vadose Zone Soil | EAYQKALDLDPNGTYGQQAKQGLEALQQIAPGIDTKLKKKKS* |
| Ga0137399_110984262 | 3300012203 | Vadose Zone Soil | VQPGTVEAYQKAVDLDPSGPYGQQAKQGLEALQQIAPGIDTKTKRKKS* |
| Ga0137399_113742361 | 3300012203 | Vadose Zone Soil | KAVELDPSGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS* |
| Ga0137362_109868081 | 3300012205 | Vadose Zone Soil | QKAVELDPSGQWGQQAKQGLEQLQLMAPGIDIKVNVKKKKS* |
| Ga0137380_104628524 | 3300012206 | Vadose Zone Soil | GTIEAYQKAVELDPNGQWGQQAKQGLEQLQLMAPGIDIKVNVKKKKS* |
| Ga0137381_115996722 | 3300012207 | Vadose Zone Soil | VEAYQKAEELDPNGQWGQQAKQGLTDLKALGAGIETKVNVRKKKS* |
| Ga0137376_117526522 | 3300012208 | Vadose Zone Soil | ELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS* |
| Ga0137379_118316492 | 3300012209 | Vadose Zone Soil | VELDPSGQWGQQAKQGLEQLQLMAPGIDIKVNVKKKKS* |
| Ga0137378_103526574 | 3300012210 | Vadose Zone Soil | EELDPNGPWGQQAKQGLTDLKALGAGIETKVNVKKKKS* |
| Ga0137377_112949322 | 3300012211 | Vadose Zone Soil | YQRAVELDPTGTWGQQAKQGLDGLQQIAPGIDTKVNTKKKKS* |
| Ga0137377_114541952 | 3300012211 | Vadose Zone Soil | QKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS* |
| Ga0137360_101550501 | 3300012361 | Vadose Zone Soil | VVQFAPGTIEAYQKAVELDPNGTWGQQAKQGLDQLQLMAPGIDTKVNMKKKKS* |
| Ga0137360_101993251 | 3300012361 | Vadose Zone Soil | LDPNGTWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS* |
| Ga0137361_100938634 | 3300012362 | Vadose Zone Soil | EVIVQPGTVEAYQKAAELDPNGPYGQQAKQGLEALQQIAPGIDTKVKKKKS* |
| Ga0137361_101338951 | 3300012362 | Vadose Zone Soil | VELDPNGPYGQQAKQGLEALQEIAPGIDTKLKKKKS* |
| Ga0137390_102710144 | 3300012363 | Vadose Zone Soil | APGTGEAYQKAEELDPNGPWGQQAKQGLTDLKALGAGIETKVNLKKKKS* |
| Ga0137358_104232571 | 3300012582 | Vadose Zone Soil | AVELDPNGPYGQQAKLGLEALQQMAPGIDTKVKKKRS* |
| Ga0137419_117344311 | 3300012925 | Vadose Zone Soil | KAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS* |
| Ga0137404_121068941 | 3300012929 | Vadose Zone Soil | GTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS* |
| Ga0137407_106914821 | 3300012930 | Vadose Zone Soil | AVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS* |
| Ga0126369_126439311 | 3300012971 | Tropical Forest Soil | DPNGPYGAQAKQGLEALSQIAPGIDTKINVRKKKS* |
| Ga0134110_103343411 | 3300012975 | Grasslands Soil | YEKAVELDPNGTWVQQAKQGLEQLQLMAPGIETKVNLKKKKS* |
| Ga0134075_104302902 | 3300014154 | Grasslands Soil | KAEELDPNGPWGQQAKQGLTDLKALGAGIETKVNVKKKKS* |
| Ga0137420_12640891 | 3300015054 | Vadose Zone Soil | GTVEAYQKAVELDPNGPYGQQAKQGLEALQEISPGIDTKLKKKKS* |
| Ga0137418_111249892 | 3300015241 | Vadose Zone Soil | DPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS* |
| Ga0137412_101233541 | 3300015242 | Vadose Zone Soil | FAPGTIEAYQKAVELDPTGTWGQQAKQGLDQLQLMAPGIDTKVNMKKKKS* |
| Ga0137412_102275581 | 3300015242 | Vadose Zone Soil | FAPGTIEAYQKAVELDPTGTWGQQAKQGLEQLQLMAPGIDIKVNMKKKKS* |
| Ga0134073_101461521 | 3300015356 | Grasslands Soil | KAVELDPNGPYGQQAKAGLEQLQQMAPGIDLKVYGKKKKS* |
| Ga0182034_100575861 | 3300016371 | Soil | KAVELDPNGPYGAQAKQGLEAVQAMTGGIDTKVGGKKKKP |
| Ga0182039_112128411 | 3300016422 | Soil | VEAYQHAVDLDPNGTWGQQAKQGLDMLQQIAPGIATSINAKKKKS |
| Ga0182038_114769082 | 3300016445 | Soil | QPGTVEAYQHAVELDPNGPWGQQAKQGLDMLQQIAPGIATSVNAKKKKS |
| Ga0134112_103797181 | 3300017656 | Grasslands Soil | FAPGTIEAYQKAVELDPNGQWGQQAKQGLEQLQLMASGIDIKVNVKKKKS |
| Ga0134083_105081601 | 3300017659 | Grasslands Soil | TIEAYQKAVELDPSGQWGQQAKQGLEQLQLMAPGIDIKVNVKKKKS |
| Ga0187817_107408342 | 3300017955 | Freshwater Sediment | GTVEAYQKAVELDPNGVYGLQAKQGLDALAQIAPGIDTKLKKKKS |
| Ga0187781_102470391 | 3300017972 | Tropical Peatland | IELDPNGPYGQQAKAGLEQLQQMAPGIDLKVNVKKKKS |
| Ga0187804_105105391 | 3300018006 | Freshwater Sediment | TVEAYQKAVELDPNGVYGQQAKQGLDALAQIAPGIDIKLKKKKS |
| Ga0187765_101634272 | 3300018060 | Tropical Peatland | EKAVELDPNGVYGQQAKQGLDALAQLAPGIQTSVKKKKKS |
| Ga0066667_100544034 | 3300018433 | Grasslands Soil | EAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS |
| Ga0179592_102117831 | 3300020199 | Vadose Zone Soil | VEAYQKAVELDPKGPYGEQAKQGLDALAQMAPGIDTKTKVKKKS |
| Ga0210407_105485091 | 3300020579 | Soil | VQFAPGTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS |
| Ga0210407_112782512 | 3300020579 | Soil | VLAPGTLEAYQKAVELDPNGAWGQQAKQGVEQLQAIIPGIDIKVNVKKKKS |
| Ga0210399_101789692 | 3300020581 | Soil | FAPGTIEAYQKAVELDPNGPFGQQAKEGLAQLQQMAPGIDIRVTKKKKS |
| Ga0210399_102921321 | 3300020581 | Soil | ELDPSGPWGTQAKQGLDMLNQIAPGIATSVTAKKKKT |
| Ga0210399_102957563 | 3300020581 | Soil | QKAIELDPDGVFGKQAKEGLAQLQQMAPGIDIRVTKKKKS |
| Ga0210399_111254962 | 3300020581 | Soil | YQKAVELDPNGQWGAQAKQGLTDLQAMGAGIDAKVNMKKKKS |
| Ga0179596_102787173 | 3300021086 | Vadose Zone Soil | QKAVDLDPSGPYGQQAKQGLEALQQIAPGIDTKTKRKKS |
| Ga0210408_102442291 | 3300021178 | Soil | LDPNGNWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS |
| Ga0210408_103964024 | 3300021178 | Soil | QKAEELDPNGPWGQQAKQGLTDLKALGAGIETKVNVKKKKS |
| Ga0210396_116519161 | 3300021180 | Soil | YQKALELDPNGPYGQQAKQGLEALQQIAPGIDTKTKRKKS |
| Ga0210384_117709342 | 3300021432 | Soil | FAPGTIEAYQKAVELDPNGNWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS |
| Ga0210392_109603722 | 3300021475 | Soil | YQKAVELDPNGQYGQQAKQGLEALAQIAPGIDTKTKVAKKKS |
| Ga0210398_106945931 | 3300021477 | Soil | EFAPGTIEAYQKAIELDPNGPFGQQAKEGLAQLQQMAPGIDIRVSAKKKKS |
| Ga0210402_100730311 | 3300021478 | Soil | AVELDPSGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS |
| Ga0210402_105333932 | 3300021478 | Soil | ELDPNGPFGQQAKEGLAQLQQMAPGIDIRVSAKKKKS |
| Ga0210409_113203751 | 3300021559 | Soil | YQKAVELDPNGPFGQQAKEGLAQLQQMAPGIDIRVTKKKKS |
| Ga0247679_10773991 | 3300024251 | Soil | VFAPGTIEAYQKAIDLDPNGPYGQDAKKGLEQLQLMAPGVDIKVNVKKKKS |
| Ga0207700_113101381 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | AYQKAVELDPNGPYGQQAKQGLEALAQIAPGIDTKTKATGKKKS |
| Ga0207704_100763134 | 3300025938 | Miscanthus Rhizosphere | LDPNGPYGQQAKQGIDALAQMDKGIETRVKAAKKKS |
| Ga0207667_115316821 | 3300025949 | Corn Rhizosphere | GTLEAYQKAVELDPNGPYGQQAKQGIDALAQMDKGIETRVKAAKKKS |
| Ga0209863_100340833 | 3300026281 | Prmafrost Soil | KALELDPKGPYGEQAKQGLDALAQMAPGIDTKTKVKKKS |
| Ga0209234_13053472 | 3300026295 | Grasslands Soil | FAPGTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS |
| Ga0209240_12238351 | 3300026304 | Grasslands Soil | ELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVRKKKS |
| Ga0209239_11667983 | 3300026310 | Grasslands Soil | EAYQKAIELDPNGTYGQQAKAGLEQLQQMAPGIDLKVNVRKKKS |
| Ga0209803_12035171 | 3300026332 | Soil | ELDPSGQWGQQAKQGLEQLQLMAPGIDIKVNVKKKKS |
| Ga0209377_11703951 | 3300026334 | Soil | AYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS |
| Ga0257155_10866471 | 3300026481 | Soil | YQKALELDPTGPFGQQAKEGLAQLQQMAPGIDIRVTKKKKS |
| Ga0257153_10897882 | 3300026490 | Soil | LDPNGPWGQQAKQGLDMLNQIAPGIATSVTTKKKKS |
| Ga0209807_13424362 | 3300026530 | Soil | YQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKINVKKKKS |
| Ga0209161_105116751 | 3300026548 | Soil | DPNGTWGQQAKQGLEQLQLMAPGIETKVNLKKKKS |
| Ga0179593_11688061 | 3300026555 | Vadose Zone Soil | GTIEGLQKAVELDPSEPGANRPSRLEQLQLMAPGIDTK |
| Ga0179587_110350652 | 3300026557 | Vadose Zone Soil | KAVELDPNGTWGQQAKLGLEQLQLMAPGIDTKVNVRKKKS |
| Ga0208997_10715332 | 3300027181 | Forest Soil | GTIEAYQKAVELDPNGAWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS |
| Ga0209418_10451061 | 3300027371 | Forest Soil | AIDLDPNGPWGQQAKQGLDMLNQIAPGIATSVTVKKKKS |
| Ga0209588_10516273 | 3300027671 | Vadose Zone Soil | ELDPNGTWGQQAKQGLEQLQLMAPGLDTKVNVKKKKS |
| Ga0209038_100229823 | 3300027737 | Bog Forest Soil | GTVEAYQKALDLDPNGPWGAQAREGLTQLQAIAPGIDIKVTAKKKKS |
| Ga0208989_100895183 | 3300027738 | Forest Soil | LDPNGTWGQQAKLGLEQLQLMAPGIDTKVNVRKKKS |
| Ga0208989_103113882 | 3300027738 | Forest Soil | GTIEAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNLKKKKS |
| Ga0209112_101168281 | 3300027817 | Forest Soil | VVQPGTVEAYQKAVELDPNGPYGQQAKQGLEALAQIAPGIDTKTKATGKKKS |
| Ga0209580_101456951 | 3300027842 | Surface Soil | VELDPNGPYGQQAKQGLEQLQQIAPGIDTKVKKKKS |
| Ga0209580_103346272 | 3300027842 | Surface Soil | EAYQHAVELDPNGTWGTQAKQGLDMLQQIAPGIATSVSAKKKKS |
| Ga0209180_101332404 | 3300027846 | Vadose Zone Soil | FAPGTIEAYQKAIELDPNGQWGQQAKQGLEQLQLMAPGIDIRVNVKKKKT |
| Ga0209180_101362341 | 3300027846 | Vadose Zone Soil | EAYQKAVELDPNGTWGQQAKQGLEQLQLMAPGIDTKVNMKKKKS |
| Ga0209693_102411221 | 3300027855 | Soil | APGTIEAYQKALELDPNGPFGQQAKEGLAQLQQMAPGIDIRVTKKKKS |
| Ga0209693_104142981 | 3300027855 | Soil | DPNGPYGQQAKQGLEALAQIAPGIDTKTKSTGKKKS |
| Ga0209693_104213251 | 3300027855 | Soil | AYQKAVELDPKGPYGEQAKQGLDALAQIAPGIDTKTKAKKKS |
| Ga0209166_103719422 | 3300027857 | Surface Soil | AVELDPNGPYGQDAKKGLEQLQLMAPGVDIKVNVKKKKS |
| Ga0209579_100794123 | 3300027869 | Surface Soil | PGTVEAYQKALELDPNGQWGAQAKQGLEQLQAIAPGIDTKLNVKKKKS |
| Ga0209283_104803143 | 3300027875 | Vadose Zone Soil | GTVEAYQKAEELDPNGPWGQQAKQGLTDLKALGAGIETKVNLKKKKS |
| Ga0209068_105563282 | 3300027894 | Watersheds | FAPGTIEAYQKAVELDPNGAWGQQAKQGLEQLQLMAPGIDTKVNVKKKKS |
| Ga0307504_102814491 | 3300028792 | Soil | VEAYQKAAELDPNGPYGQQAKQGLEALQQIAPGIDTKVKKKKS |
| Ga0302222_102520222 | 3300028798 | Palsa | QKAVELDPNGTYGQQAKQGLEALAQIAPGIDTKVKKKKS |
| Ga0265338_106031682 | 3300028800 | Rhizosphere | KAVELDPTGPFGQQAKEGLAQLQQMAPGIDIRVTKKKKS |
| Ga0308309_101263573 | 3300028906 | Soil | EAYKKAVELDPDGVFGKQAQEGLAQLQQMAPGIDIRVTKKKKS |
| Ga0308309_107746203 | 3300028906 | Soil | YQKAVELDPNGPYGQQAKQGLEALAQMAPGIDTKTKVKKKS |
| Ga0265753_11021072 | 3300030862 | Soil | VELDPDGVFGKQAQEGLAQLQQMAPGIDIRVTKKKKS |
| Ga0073994_123601321 | 3300030991 | Soil | KAVELDPTGPYGQQAKLGLEALQQMAPGIDTKVKKKRS |
| Ga0073994_123638151 | 3300030991 | Soil | VEAYQKAVELDPNGGPNSYGAQAKLGLEALQQIQPGIDTKVNTRKKKN |
| Ga0170822_163794011 | 3300031122 | Forest Soil | KEVVQFAPGTIEAYQKAVELDPNGTWGQQAKQGLDQLQLMAPGIDTKVNMKKKKS |
| Ga0318571_101297711 | 3300031549 | Soil | YQHAVDLDPNGPWGQQAKQGLDMLQQIAPGIATSVNAKKKKS |
| Ga0318542_101789673 | 3300031668 | Soil | AVELDPNGPWGQQAKQGLDMLQQIAPGIATSVNAKKKKS |
| Ga0310686_1035706732 | 3300031708 | Soil | ELDPNGPFGQQAKEGLAQLQQMAPGIDIRVSSKKKKS |
| Ga0307469_104399401 | 3300031720 | Hardwood Forest Soil | LDPNGPYGAQAKQGLDALQQIAPGIDMKVNTKKKKS |
| Ga0307469_113980112 | 3300031720 | Hardwood Forest Soil | GTIEAYQKAIELDPNGPYGAEAKKGLEQLQLMAPGIDTKVNTKKKKS |
| Ga0318509_105425362 | 3300031768 | Soil | PDVQPGTVEAYQHAVDLDPNGPWGQQAKQGLDMLQQIAPGIATSVNAKKKKS |
| Ga0318550_103159861 | 3300031797 | Soil | YQKAIELDPNGTYGQQAKAGLEQLQQMAPGIDLKVNVRKKKS |
| Ga0307473_107783292 | 3300031820 | Hardwood Forest Soil | AYQHAIDLDPNGPWGQQAKQGLDMLNQIAPGIATSVTTKKKKS |
| Ga0307478_113268062 | 3300031823 | Hardwood Forest Soil | QFAPGTIEAYQKAVELDPNGTWGQQAKQGLDQLQLMAPGIDTKVNVKKKKS |
| Ga0306919_111524751 | 3300031879 | Soil | YQHAVELDPNGPWGQQAKQGLDMLQQIAPGIATSVNAKKKKS |
| Ga0306923_117206452 | 3300031910 | Soil | QKAVELDPNGPYGAQAKQGLEAVQAMTGGIDTKVGGKKKKP |
| Ga0310909_100095301 | 3300031947 | Soil | GTIEAYQKAIELDPNGTYGQQAKAGLEQLQQMAPGIDLKVNVRKKKS |
| Ga0306926_105426683 | 3300031954 | Soil | VPDVQPGTVEAYQHAVDLDPNGPWGQQAKQGLDMLQQIAPGIATSVNAKKKKS |
| Ga0306926_124346212 | 3300031954 | Soil | TLKPGTVEAYQKAVELDPNGPYGAQAKQGLEAVQAMTGGIDTKVGGKKKKP |
| Ga0307479_105454661 | 3300031962 | Hardwood Forest Soil | EAYQKAVELDPNGTYGAQAKQGLDALQQIAPGIEMKVNTKKKKS |
| Ga0306922_109993882 | 3300032001 | Soil | VDLDPNGPWGAQAKQGLTDLQALGAGIDVKVNVKKKKS |
| Ga0307471_1000421957 | 3300032180 | Hardwood Forest Soil | EAYQKAVELDPNGPYGQQAKQGLEALAQIAPGIDTKTKVKKKS |
| Ga0335085_102902161 | 3300032770 | Soil | KCIQLDPNGPWGAQAKDGLAQLQAMGAGVDTKVNVKKKP |
| Ga0335072_110096272 | 3300032898 | Soil | LDPNGTYGQQAKQGLEALAQIAPGIDTKTKVSKKKS |
| Ga0335076_101328842 | 3300032955 | Soil | LDPNGPWGQQAKAGLEQLQAMGAGVDTKVNVKKKP |
| Ga0335077_114102602 | 3300033158 | Soil | AIELDPNGPYGKQAKEGLEQLQQMAPGIDIKVNAKKKKS |
| Ga0310811_107542552 | 3300033475 | Soil | KAIDLDPNGPYGQDAKKGLEQLQLMAPGVDIKVNVKKKKS |
| ⦗Top⦘ |