| Basic Information | |
|---|---|
| Family ID | F025728 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 44 residues |
| Representative Sequence | LQEDARFRAAVREGIAQADRGEFIEEEEMDARLEQMLRS |
| Number of Associated Samples | 174 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 28.79 % |
| % of genes near scaffold ends (potentially truncated) | 64.50 % |
| % of genes from short scaffolds (< 2000 bps) | 82.50 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (90.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa (9.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (22.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (46.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 46.27% β-sheet: 0.00% Coil/Unstructured: 53.73% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF05016 | ParE_toxin | 29.00 |
| PF00171 | Aldedh | 2.00 |
| PF03167 | UDG | 1.00 |
| PF00580 | UvrD-helicase | 1.00 |
| PF12704 | MacB_PCD | 1.00 |
| PF03330 | DPBB_1 | 1.00 |
| PF04014 | MazE_antitoxin | 1.00 |
| PF12833 | HTH_18 | 1.00 |
| PF06827 | zf-FPG_IleRS | 1.00 |
| PF03460 | NIR_SIR_ferr | 0.50 |
| PF13735 | tRNA_NucTran2_2 | 0.50 |
| PF01261 | AP_endonuc_2 | 0.50 |
| PF05221 | AdoHcyase | 0.50 |
| PF01638 | HxlR | 0.50 |
| PF00754 | F5_F8_type_C | 0.50 |
| PF00749 | tRNA-synt_1c | 0.50 |
| PF01850 | PIN | 0.50 |
| PF00005 | ABC_tran | 0.50 |
| PF04932 | Wzy_C | 0.50 |
| PF02661 | Fic | 0.50 |
| PF00670 | AdoHcyase_NAD | 0.50 |
| PF01208 | URO-D | 0.50 |
| PF13936 | HTH_38 | 0.50 |
| PF07021 | MetW | 0.50 |
| PF00753 | Lactamase_B | 0.50 |
| PF01916 | DS | 0.50 |
| PF01934 | HepT-like | 0.50 |
| PF01259 | SAICAR_synt | 0.50 |
| PF02518 | HATPase_c | 0.50 |
| PF06739 | SBBP | 0.50 |
| PF13669 | Glyoxalase_4 | 0.50 |
| PF04397 | LytTR | 0.50 |
| PF13411 | MerR_1 | 0.50 |
| PF11645 | PDDEXK_5 | 0.50 |
| PF16697 | Yop-YscD_cpl | 0.50 |
| PF01541 | GIY-YIG | 0.50 |
| PF05532 | CsbD | 0.50 |
| PF01979 | Amidohydro_1 | 0.50 |
| PF00034 | Cytochrom_C | 0.50 |
| PF08281 | Sigma70_r4_2 | 0.50 |
| PF14403 | CP_ATPgrasp_2 | 0.50 |
| PF01116 | F_bP_aldolase | 0.50 |
| PF12680 | SnoaL_2 | 0.50 |
| PF13278 | Obsolete Pfam Family | 0.50 |
| PF01019 | G_glu_transpept | 0.50 |
| PF11412 | DsbC | 0.50 |
| PF03737 | RraA-like | 0.50 |
| PF00903 | Glyoxalase | 0.50 |
| PF04542 | Sigma70_r2 | 0.50 |
| PF00578 | AhpC-TSA | 0.50 |
| PF02602 | HEM4 | 0.50 |
| PF05015 | HigB-like_toxin | 0.50 |
| PF03572 | Peptidase_S41 | 0.50 |
| PF02540 | NAD_synthase | 0.50 |
| PF09907 | HigB_toxin | 0.50 |
| PF05697 | Trigger_N | 0.50 |
| PF00135 | COesterase | 0.50 |
| PF00665 | rve | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0014 | Gamma-glutamyl phosphate reductase | Amino acid transport and metabolism [E] | 2.00 |
| COG4230 | Delta 1-pyrroline-5-carboxylate dehydrogenase | Amino acid transport and metabolism [E] | 2.00 |
| COG1012 | Acyl-CoA reductase or other NAD-dependent aldehyde dehydrogenase | Lipid transport and metabolism [I] | 2.00 |
| COG0210 | Superfamily I DNA or RNA helicase | Replication, recombination and repair [L] | 1.00 |
| COG3973 | DNA helicase IV | Replication, recombination and repair [L] | 1.00 |
| COG3663 | G:T/U-mismatch repair DNA glycosylase | Replication, recombination and repair [L] | 1.00 |
| COG0499 | S-adenosylhomocysteine hydrolase | Coenzyme transport and metabolism [H] | 1.00 |
| COG1573 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.00 |
| COG0692 | Uracil-DNA glycosylase | Replication, recombination and repair [L] | 1.00 |
| COG1074 | 3’-5’ helicase subunit RecB of the DNA repair enzyme RecBCD (exonuclease V) | Replication, recombination and repair [L] | 1.00 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.50 |
| COG4941 | Predicted RNA polymerase sigma factor, contains C-terminal TPR domain | Transcription [K] | 0.50 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.50 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 0.50 |
| COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 0.50 |
| COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 0.50 |
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 0.50 |
| COG3307 | O-antigen ligase | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 0.50 |
| COG3549 | Plasmid maintenance system killer protein | Defense mechanisms [V] | 0.50 |
| COG4584 | Transposase | Mobilome: prophages, transposons [X] | 0.50 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1899 | Deoxyhypusine synthase | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1733 | DNA-binding transcriptional regulator, HxlR family | Transcription [K] | 0.50 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.50 |
| COG1587 | Uroporphyrinogen-III synthase | Coenzyme transport and metabolism [H] | 0.50 |
| COG1191 | DNA-directed RNA polymerase specialized sigma subunit | Transcription [K] | 0.50 |
| COG0793 | C-terminal processing protease CtpA/Prc, contains a PDZ domain | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
| COG0684 | RNA degradosome component RraA (regulator of RNase E activity) | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0568 | DNA-directed RNA polymerase, sigma subunit (sigma70/sigma32) | Transcription [K] | 0.50 |
| COG0544 | FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
| COG0407 | Uroporphyrinogen-III decarboxylase HemE | Coenzyme transport and metabolism [H] | 0.50 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.50 |
| COG0191 | Fructose/tagatose bisphosphate aldolase | Carbohydrate transport and metabolism [G] | 0.50 |
| COG0171 | NH3-dependent NAD+ synthetase | Coenzyme transport and metabolism [H] | 0.50 |
| COG0152 | Phosphoribosylaminoimidazole-succinocarboxamide synthase | Nucleotide transport and metabolism [F] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 90.00 % |
| Unclassified | root | N/A | 10.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000955|JGI1027J12803_108451649 | All Organisms → cellular organisms → Bacteria | 1227 | Open in IMG/M |
| 3300001471|JGI12712J15308_10187429 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 541 | Open in IMG/M |
| 3300001593|JGI12635J15846_10127041 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1792 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_101613479 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300004091|Ga0062387_101607300 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300004092|Ga0062389_103171204 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 616 | Open in IMG/M |
| 3300004114|Ga0062593_102721541 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300004139|Ga0058897_11112845 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300004152|Ga0062386_101310948 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300004477|Ga0068971_1416817 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300005332|Ga0066388_106142955 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 606 | Open in IMG/M |
| 3300005335|Ga0070666_11460306 | All Organisms → cellular organisms → Bacteria | 511 | Open in IMG/M |
| 3300005467|Ga0070706_101121702 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella → Granulicella tundricola | 724 | Open in IMG/M |
| 3300005538|Ga0070731_10885466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Caulobacter → Caulobacter vibrioides | 592 | Open in IMG/M |
| 3300005541|Ga0070733_10203642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 1294 | Open in IMG/M |
| 3300005542|Ga0070732_10823342 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
| 3300005549|Ga0070704_100475411 | All Organisms → cellular organisms → Bacteria | 1080 | Open in IMG/M |
| 3300005602|Ga0070762_10005196 | All Organisms → cellular organisms → Bacteria | 6293 | Open in IMG/M |
| 3300005610|Ga0070763_10011362 | All Organisms → cellular organisms → Bacteria | 3682 | Open in IMG/M |
| 3300005610|Ga0070763_10636278 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300006050|Ga0075028_100626167 | All Organisms → cellular organisms → Bacteria | 641 | Open in IMG/M |
| 3300006052|Ga0075029_100603737 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300006057|Ga0075026_100895545 | All Organisms → cellular organisms → Bacteria | 545 | Open in IMG/M |
| 3300006162|Ga0075030_100196930 | All Organisms → cellular organisms → Bacteria | 1623 | Open in IMG/M |
| 3300006638|Ga0075522_10025067 | All Organisms → cellular organisms → Bacteria | 3691 | Open in IMG/M |
| 3300006796|Ga0066665_11216147 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 575 | Open in IMG/M |
| 3300006893|Ga0073928_10310728 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300007255|Ga0099791_10272954 | All Organisms → cellular organisms → Bacteria | 804 | Open in IMG/M |
| 3300009032|Ga0105048_10801888 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 848 | Open in IMG/M |
| 3300009088|Ga0099830_10863431 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 748 | Open in IMG/M |
| 3300009137|Ga0066709_102499554 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300009156|Ga0111538_11776001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 776 | Open in IMG/M |
| 3300009252|Ga0103863_10056247 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300009523|Ga0116221_1080085 | Not Available | 1463 | Open in IMG/M |
| 3300009523|Ga0116221_1427183 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 577 | Open in IMG/M |
| 3300009551|Ga0105238_10249905 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1751 | Open in IMG/M |
| 3300009624|Ga0116105_1111149 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300009634|Ga0116124_1161687 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300009635|Ga0116117_1107689 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300009640|Ga0116126_1061560 | All Organisms → cellular organisms → Bacteria | 1430 | Open in IMG/M |
| 3300009665|Ga0116135_1094169 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1079 | Open in IMG/M |
| 3300009698|Ga0116216_10516534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 722 | Open in IMG/M |
| 3300009700|Ga0116217_10871248 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 553 | Open in IMG/M |
| 3300009764|Ga0116134_1009342 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4282 | Open in IMG/M |
| 3300009839|Ga0116223_10157543 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1407 | Open in IMG/M |
| 3300009873|Ga0131077_11438744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300010373|Ga0134128_13193740 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300010376|Ga0126381_100035953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5959 | Open in IMG/M |
| 3300010376|Ga0126381_103106514 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 658 | Open in IMG/M |
| 3300010379|Ga0136449_100084180 | All Organisms → cellular organisms → Bacteria | 6678 | Open in IMG/M |
| 3300010379|Ga0136449_100223653 | All Organisms → cellular organisms → Bacteria | 3537 | Open in IMG/M |
| 3300010379|Ga0136449_101268525 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1152 | Open in IMG/M |
| 3300012189|Ga0137388_11912915 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 523 | Open in IMG/M |
| 3300012201|Ga0137365_11114268 | Not Available | 568 | Open in IMG/M |
| 3300012204|Ga0137374_10943008 | Not Available | 630 | Open in IMG/M |
| 3300012212|Ga0150985_106352592 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1378 | Open in IMG/M |
| 3300012923|Ga0137359_10180059 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1887 | Open in IMG/M |
| 3300012927|Ga0137416_11726670 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300012929|Ga0137404_11272045 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes | 678 | Open in IMG/M |
| 3300012960|Ga0164301_10831412 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300012975|Ga0134110_10457751 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300014162|Ga0181538_10193058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 1147 | Open in IMG/M |
| 3300014165|Ga0181523_10407343 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300014167|Ga0181528_10093322 | All Organisms → cellular organisms → Bacteria | 1639 | Open in IMG/M |
| 3300014167|Ga0181528_10604639 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300014167|Ga0181528_10765665 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300014199|Ga0181535_10054348 | All Organisms → cellular organisms → Bacteria | 2740 | Open in IMG/M |
| 3300014201|Ga0181537_10398201 | Not Available | 945 | Open in IMG/M |
| 3300014489|Ga0182018_10275308 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 921 | Open in IMG/M |
| 3300014498|Ga0182019_10244250 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1179 | Open in IMG/M |
| 3300014499|Ga0182012_10153506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1658 | Open in IMG/M |
| 3300014838|Ga0182030_10156493 | All Organisms → cellular organisms → Bacteria | 2874 | Open in IMG/M |
| 3300014969|Ga0157376_12471769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300015063|Ga0167649_100870 | All Organisms → cellular organisms → Bacteria | 4272 | Open in IMG/M |
| 3300015360|Ga0163144_11002287 | Not Available | 799 | Open in IMG/M |
| 3300017931|Ga0187877_1305189 | All Organisms → cellular organisms → Bacteria | 608 | Open in IMG/M |
| 3300017931|Ga0187877_1365674 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300017943|Ga0187819_10298462 | All Organisms → cellular organisms → Bacteria | 937 | Open in IMG/M |
| 3300017975|Ga0187782_10045509 | All Organisms → cellular organisms → Bacteria | 3195 | Open in IMG/M |
| 3300017975|Ga0187782_10206929 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1469 | Open in IMG/M |
| 3300017988|Ga0181520_11070247 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 531 | Open in IMG/M |
| 3300018006|Ga0187804_10579683 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300018007|Ga0187805_10154968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1042 | Open in IMG/M |
| 3300018008|Ga0187888_1204017 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 784 | Open in IMG/M |
| 3300018017|Ga0187872_10112701 | All Organisms → cellular organisms → Bacteria | 1345 | Open in IMG/M |
| 3300018019|Ga0187874_10294677 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300018026|Ga0187857_10481887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300018034|Ga0187863_10732689 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 559 | Open in IMG/M |
| 3300018037|Ga0187883_10445637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300018044|Ga0187890_10514806 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300018062|Ga0187784_11194642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
| 3300018085|Ga0187772_11312497 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300018433|Ga0066667_10152240 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 1633 | Open in IMG/M |
| 3300018468|Ga0066662_10062864 | All Organisms → cellular organisms → Bacteria | 2440 | Open in IMG/M |
| 3300018482|Ga0066669_11378501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 639 | Open in IMG/M |
| 3300020057|Ga0163151_10003582 | All Organisms → cellular organisms → Bacteria | 22131 | Open in IMG/M |
| 3300020581|Ga0210399_10770166 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 787 | Open in IMG/M |
| 3300020581|Ga0210399_11330706 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300020583|Ga0210401_10547668 | All Organisms → cellular organisms → Bacteria | 1019 | Open in IMG/M |
| 3300021171|Ga0210405_10000953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 35204 | Open in IMG/M |
| 3300021171|Ga0210405_11009093 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300021178|Ga0210408_10770306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 755 | Open in IMG/M |
| 3300021180|Ga0210396_10053861 | All Organisms → cellular organisms → Bacteria | 3683 | Open in IMG/M |
| 3300021180|Ga0210396_11192017 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300021180|Ga0210396_11621072 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300021181|Ga0210388_10040301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3872 | Open in IMG/M |
| 3300021401|Ga0210393_11359576 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 568 | Open in IMG/M |
| 3300021403|Ga0210397_10916384 | Not Available | 679 | Open in IMG/M |
| 3300021403|Ga0210397_11597363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 506 | Open in IMG/M |
| 3300021404|Ga0210389_10036887 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3754 | Open in IMG/M |
| 3300021406|Ga0210386_11195335 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300021432|Ga0210384_10371941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1287 | Open in IMG/M |
| 3300021433|Ga0210391_10087063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2466 | Open in IMG/M |
| 3300021476|Ga0187846_10067943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1557 | Open in IMG/M |
| 3300021477|Ga0210398_10525345 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 963 | Open in IMG/M |
| 3300022557|Ga0212123_10628301 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300024295|Ga0224556_1179995 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300025576|Ga0208820_1085304 | All Organisms → cellular organisms → Bacteria | 799 | Open in IMG/M |
| 3300025862|Ga0209483_1018134 | All Organisms → cellular organisms → Bacteria | 3685 | Open in IMG/M |
| 3300025906|Ga0207699_11348481 | Not Available | 528 | Open in IMG/M |
| 3300025910|Ga0207684_10830960 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 780 | Open in IMG/M |
| 3300026979|Ga0207817_1037918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300027104|Ga0208095_1001224 | All Organisms → cellular organisms → Bacteria | 1564 | Open in IMG/M |
| 3300027512|Ga0209179_1025458 | Not Available | 1180 | Open in IMG/M |
| 3300027521|Ga0209524_1020771 | All Organisms → cellular organisms → Bacteria | 1356 | Open in IMG/M |
| 3300027676|Ga0209333_1144977 | Not Available | 639 | Open in IMG/M |
| 3300027703|Ga0207862_1143259 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 715 | Open in IMG/M |
| 3300027825|Ga0209039_10121551 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1104 | Open in IMG/M |
| 3300027854|Ga0209517_10056851 | All Organisms → cellular organisms → Bacteria | 2893 | Open in IMG/M |
| 3300027855|Ga0209693_10057347 | All Organisms → cellular organisms → Bacteria | 1916 | Open in IMG/M |
| 3300027869|Ga0209579_10015613 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4417 | Open in IMG/M |
| 3300027869|Ga0209579_10216516 | All Organisms → cellular organisms → Bacteria | 1026 | Open in IMG/M |
| 3300027882|Ga0209590_10441458 | All Organisms → cellular organisms → Bacteria | 841 | Open in IMG/M |
| 3300027903|Ga0209488_11216452 | Not Available | 506 | Open in IMG/M |
| 3300027908|Ga0209006_10015935 | All Organisms → cellular organisms → Bacteria | 6809 | Open in IMG/M |
| 3300027908|Ga0209006_10073542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3047 | Open in IMG/M |
| 3300028047|Ga0209526_10726888 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Anabaenopsis → Anabaenopsis elenkinii → Anabaenopsis elenkinii CCIBt3563 | 622 | Open in IMG/M |
| 3300028773|Ga0302234_10396642 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 591 | Open in IMG/M |
| 3300028882|Ga0302154_10479070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 593 | Open in IMG/M |
| 3300029882|Ga0311368_10500775 | Not Available | 874 | Open in IMG/M |
| 3300029883|Ga0311327_10566258 | Not Available | 687 | Open in IMG/M |
| 3300029907|Ga0311329_10803223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Paludibaculum → Paludibaculum fermentans | 600 | Open in IMG/M |
| 3300029908|Ga0311341_10792510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300029913|Ga0311362_11144583 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300030007|Ga0311338_10207207 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2253 | Open in IMG/M |
| 3300030007|Ga0311338_11925820 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 528 | Open in IMG/M |
| 3300030011|Ga0302270_10325692 | All Organisms → cellular organisms → Bacteria | 838 | Open in IMG/M |
| 3300030013|Ga0302178_10441710 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300030043|Ga0302306_10057492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1529 | Open in IMG/M |
| 3300030043|Ga0302306_10309471 | Not Available | 605 | Open in IMG/M |
| 3300030399|Ga0311353_10201690 | All Organisms → cellular organisms → Bacteria | 1868 | Open in IMG/M |
| 3300030399|Ga0311353_10644759 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300030503|Ga0311370_11269478 | All Organisms → cellular organisms → Bacteria | 791 | Open in IMG/M |
| 3300030509|Ga0302183_10077589 | All Organisms → cellular organisms → Bacteria | 1311 | Open in IMG/M |
| 3300030518|Ga0302275_10270892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 952 | Open in IMG/M |
| 3300030519|Ga0302193_10289925 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300030520|Ga0311372_11064504 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300030580|Ga0311355_10552714 | Not Available | 1095 | Open in IMG/M |
| 3300030617|Ga0311356_10934677 | Not Available | 814 | Open in IMG/M |
| 3300031028|Ga0302180_10544033 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300031040|Ga0265754_1038905 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300031231|Ga0170824_121490344 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 729 | Open in IMG/M |
| 3300031232|Ga0302323_100578946 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1214 | Open in IMG/M |
| 3300031234|Ga0302325_10040256 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 9461 | Open in IMG/M |
| 3300031236|Ga0302324_100138441 | All Organisms → cellular organisms → Bacteria | 4020 | Open in IMG/M |
| 3300031236|Ga0302324_102924103 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 571 | Open in IMG/M |
| 3300031344|Ga0265316_10041937 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3659 | Open in IMG/M |
| 3300031524|Ga0302320_11934043 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 556 | Open in IMG/M |
| 3300031525|Ga0302326_12888181 | Not Available | 591 | Open in IMG/M |
| 3300031708|Ga0310686_106391912 | All Organisms → cellular organisms → Bacteria | 1612 | Open in IMG/M |
| 3300031708|Ga0310686_111724348 | All Organisms → cellular organisms → Bacteria | 1572 | Open in IMG/M |
| 3300031715|Ga0307476_10883849 | All Organisms → cellular organisms → Bacteria | 660 | Open in IMG/M |
| 3300031718|Ga0307474_10080195 | All Organisms → cellular organisms → Bacteria | 2428 | Open in IMG/M |
| 3300031754|Ga0307475_10101595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2246 | Open in IMG/M |
| 3300031754|Ga0307475_10550895 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Granulicella | 925 | Open in IMG/M |
| 3300031788|Ga0302319_10080223 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4876 | Open in IMG/M |
| 3300031788|Ga0302319_11320829 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300031823|Ga0307478_11539526 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300031996|Ga0308176_10112733 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2415 | Open in IMG/M |
| 3300032004|Ga0307414_12129424 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300032180|Ga0307471_104294586 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300032205|Ga0307472_101000186 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300032261|Ga0306920_102167565 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300032420|Ga0335397_10431748 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1092 | Open in IMG/M |
| 3300032770|Ga0335085_12261950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 545 | Open in IMG/M |
| 3300032782|Ga0335082_10225191 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1766 | Open in IMG/M |
| 3300032805|Ga0335078_11361178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 805 | Open in IMG/M |
| 3300032805|Ga0335078_11894622 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300032892|Ga0335081_11349779 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 801 | Open in IMG/M |
| 3300032892|Ga0335081_11506119 | Not Available | 745 | Open in IMG/M |
| 3300032893|Ga0335069_10052998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 5307 | Open in IMG/M |
| 3300032893|Ga0335069_10310467 | Not Available | 1874 | Open in IMG/M |
| 3300032897|Ga0335071_10623500 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1030 | Open in IMG/M |
| 3300033405|Ga0326727_10163877 | All Organisms → cellular organisms → Bacteria | 2568 | Open in IMG/M |
| 3300033433|Ga0326726_12069092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 554 | Open in IMG/M |
| 3300033977|Ga0314861_0136773 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300034124|Ga0370483_0160359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales | 758 | Open in IMG/M |
| 3300034163|Ga0370515_0235527 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 9.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 9.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 5.50% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 5.50% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 5.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 4.50% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 4.00% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 3.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.50% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.50% |
| Freshwater Microbial Mat | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Microbial Mat | 1.00% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 1.00% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 1.00% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 1.00% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 1.00% |
| River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 0.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.50% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.50% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.50% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.50% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.50% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.50% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.50% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.50% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Wastewater | Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001471 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004139 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF230 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004477 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 65 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006638 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300009032 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-05 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009252 | Microbial communities of water from Amazon river, Brazil - RCM16 | Environmental | Open in IMG/M |
| 3300009523 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG | Environmental | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009634 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_150 | Environmental | Open in IMG/M |
| 3300009635 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_10 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
| 3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300009873 | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant | Engineered | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012960 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014167 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
| 3300014499 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaG | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015063 | Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-3b, vegetated patch on medial moraine) | Environmental | Open in IMG/M |
| 3300015360 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.BULKMAT1 | Environmental | Open in IMG/M |
| 3300017931 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
| 3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
| 3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018037 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300020057 | Freshwater microbial mat bacterial communities from Lake Vanda, McMurdo Dry Valleys, Antarctica - Oligotrophic Lake LV.19.MP5.IB-2 | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025576 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025862 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL2-A (SPAdes) | Environmental | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026979 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 13 (SPAdes) | Environmental | Open in IMG/M |
| 3300027104 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF024 (SPAdes) | Environmental | Open in IMG/M |
| 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027703 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027826 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028773 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300028882 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029883 | I_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029907 | I_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300029908 | II_Bog_E1 coassembly | Environmental | Open in IMG/M |
| 3300029913 | III_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030011 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030043 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031040 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
| 3300031524 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_3 | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031996 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2 | Environmental | Open in IMG/M |
| 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Host-Associated | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032420 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (spades assembly) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032897 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.5 | Environmental | Open in IMG/M |
| 3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034163 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_04D_14 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI1027J12803_1084516492 | 3300000955 | Soil | KEDEQFRAAVREGIAEADRGLFIEEAEMATRLEKL |
| JGI12712J15308_101874292 | 3300001471 | Forest Soil | LVKKAALRLLERDARFRAAVHKGLEQADRSEFIGEAEMDARIERMIQP* |
| JGI12635J15846_101270412 | 3300001593 | Forest Soil | MAPLSLLQQHARFRAAVRKGVAQADLGEFIEEEEVDARLEQMLHS* |
| JGIcombinedJ26739_1016134793 | 3300002245 | Forest Soil | DHRFRAAVREGIAQADRGEFIEETEMDARLEQMLRS* |
| Ga0062387_1016073001 | 3300004091 | Bog Forest Soil | ILVKDAALRLIEGETEFRAGVREGIAQADRGEFVEEEEMNARFERMLRP* |
| Ga0062389_1031712041 | 3300004092 | Bog Forest Soil | DAERLVKDAALRLLEEDARFRAAVREGIAQADRGEFMEQEEMNARLEQMLRS* |
| Ga0062593_1027215411 | 3300004114 | Soil | LPSSSFPYSDVREGIAQADRGEFIEEEELDARLHQMLRL* |
| Ga0058897_111128451 | 3300004139 | Forest Soil | LVKDAALRLLEEDARFRAAVREGVAQADRGQFIEQEEMDARLEQMLRS* |
| Ga0062386_1013109482 | 3300004152 | Bog Forest Soil | VRLLEEDARFRAAVREGIAQADRGEFIEEEETDARLEQMLRS* |
| Ga0068971_14168171 | 3300004477 | Peatlands Soil | KDAALRLLEQDARFRAAVREGIAQADREEFIEEEEMDARIERMVSF* |
| Ga0066388_1061429552 | 3300005332 | Tropical Forest Soil | MEVHFTPEDARFRAAVIEGKAYADRGEFIEEEEMDARFEEMLRS* |
| Ga0070666_114603062 | 3300005335 | Switchgrass Rhizosphere | LDLLAEDVRFRAAVQEGIAQADRGEFIEEAEMDARLQQMLRS* |
| Ga0070706_1011217021 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VKYAALRLLEEDASFHAAVLEGIAQADRGEFMEEAEMEVRLEQMLRS* |
| Ga0070734_100400194 | 3300005533 | Surface Soil | VKNAALRLTDEEDFLESVQQGIAEADRGEFIEDEEMDTRIERMLRSEMRIR* |
| Ga0070731_108854661 | 3300005538 | Surface Soil | LVNDAALRLLQEEVRFCAAIRAGLAQADRRGFIEEEEMDVRLDQMLRS* |
| Ga0070733_102036422 | 3300005541 | Surface Soil | MVKDAALRLLEEDAQFLAAVRKGIAEADRGELIDKEEMDARIRWMLER* |
| Ga0070732_108233422 | 3300005542 | Surface Soil | RVRAAVREGITQADEGKFIEESDMDARLERMLRT* |
| Ga0070704_1004754112 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | VKDAALRLLEEDARFRAAVREGIAQADRGEFIEEDEMYARLEEMLRS* |
| Ga0070762_100051962 | 3300005602 | Soil | MPPCAFLEQDARFRAAVRESIAQADREEFIEEEEVDARIERMLTS* |
| Ga0070763_100113624 | 3300005610 | Soil | MPPCAFLEQDARFRAAVRESIAQADREEFIEEEEVDARIQRMLTS* |
| Ga0070763_106362783 | 3300005610 | Soil | LLEQDARFRAAVREGIAQADRGKFIEDEEMDARIERMLNS* |
| Ga0075028_1006261673 | 3300006050 | Watersheds | LQEDARFRAAVREGIAQADRGELIEEEEMDARLEQMLRS* |
| Ga0075029_1006037373 | 3300006052 | Watersheds | ETLVKSAALRLLEEDARFRAAVRDGIAQADRGEFIEEEEMDALFEEMLRS* |
| Ga0075026_1008955451 | 3300006057 | Watersheds | EEEERFRAAVLEGKANADRGEFIEDEEMDARFEEMLRS* |
| Ga0075030_1001969303 | 3300006162 | Watersheds | VKDAALRLLEQDARFRAAVREGIAQADRGEFIEEEEMAARLEQMLRS* |
| Ga0075522_100250674 | 3300006638 | Arctic Peat Soil | MDVNLTQEEEERFRAAVLEGKAYADRGVFIEEEEMDERFEEMLRS* |
| Ga0066665_112161472 | 3300006796 | Soil | DEEARFRAAVLEGKAYADRGEFIEEEEMDARFEEMLRS* |
| Ga0073928_103107281 | 3300006893 | Iron-Sulfur Acid Spring | QDARFRAAVREGIAQADREEFIEEEEMDARIERMLNS* |
| Ga0099791_102729542 | 3300007255 | Vadose Zone Soil | LRLLQEDAGFRAALQEGIAQADRGEFIEEREMDDRLEQMLRS* |
| Ga0105048_108018882 | 3300009032 | Freshwater | MRLLDEDARFRAAVLEAKAYADRSEFIEEEEMDARFEQMLST* |
| Ga0099830_108634311 | 3300009088 | Vadose Zone Soil | MPPCARWNRTLVFRAAVREGIAQADREEFIEEEEMDARIERMLNS* |
| Ga0066709_1024995541 | 3300009137 | Grasslands Soil | RFRAAVQEGVAQADRGEFIEEEEMDARLEQMLRS* |
| Ga0111538_117760011 | 3300009156 | Populus Rhizosphere | RLLEEDERFRAAVLEGKAHADRGEFIDEKEMDARFEQMLRS* |
| Ga0103863_100562472 | 3300009252 | River Water | HFRAAVREGSAQADQGQLIEESEMDALFEQMLRA* |
| Ga0116221_10800852 | 3300009523 | Peatlands Soil | AVRKGTAQADRGEFIEEEEMDARIERMLNSCISC* |
| Ga0116221_14271831 | 3300009523 | Peatlands Soil | MCQRHLGARRLDAALRLLEEDSRFRAAVREGIAQADQGEFIEEKEMDARLEQMLHSEE* |
| Ga0105238_102499051 | 3300009551 | Corn Rhizosphere | AHLVKDAALRLLEENAKFRAAVRRGIEEADRGELLDHQDVVARIEQRFQSR* |
| Ga0116105_11111493 | 3300009624 | Peatland | ARFRAAVREGIAQADRGEFIEQADMDVRLEQMLRS* |
| Ga0116124_11616871 | 3300009634 | Peatland | LLEEDAHFRAAVREGIAQADRGEFIEQEEMDARLEQMLRS* |
| Ga0116117_11076891 | 3300009635 | Peatland | DARFRAAVREGAAQADRGELIEEQEMNARLEQMLRS* |
| Ga0116126_10615602 | 3300009640 | Peatland | LVKDAALRLLEEDARFRAAVREGIAQADRGELIEEKEMDAHLEQMFRS* |
| Ga0116135_10941693 | 3300009665 | Peatland | VEDAALRLIQEDARFRAAVREGVAQADRGELIEEEEMNARLEQMLRS* |
| Ga0116216_105165341 | 3300009698 | Peatlands Soil | ALRLIEEEARFRAAVREGIAQADRGEFIEEEMDARLEQMLRS* |
| Ga0116217_108712482 | 3300009700 | Peatlands Soil | RFRAAVREGIAQADRGEFIEQEEMDARLEQMLRS* |
| Ga0116134_10093423 | 3300009764 | Peatland | VRFRAAALECKACADRGEFIEEEEMDARFEQMLRS* |
| Ga0116223_101575431 | 3300009839 | Peatlands Soil | LQEEARFRAAVREGIAQADRGEFIEEEEMDARLEQMLRS* |
| Ga0131077_114387441 | 3300009873 | Wastewater | ARFRAAVLQGKACADRGEFIEEEEMDARFEEMLRP* |
| Ga0134128_131937401 | 3300010373 | Terrestrial Soil | EQLLKDAALRLLEEDARFREAVREGIEQADRGEFIEEDEMDALFEEMLRS* |
| Ga0126381_1000359535 | 3300010376 | Tropical Forest Soil | MCGNKRFRAAVREGIAQADRGEFIKEEEMDAHLEQMLRS* |
| Ga0126381_1031065141 | 3300010376 | Tropical Forest Soil | ARFRAAVGEGIAQADRGDFIEEAEMDARLEQMLRS* |
| Ga0136449_10008418011 | 3300010379 | Peatlands Soil | TDAERLVKDAALRLLQEEARFRAAVREGIAQAETPTKGACQADRGEYIEEEEMDARLEQMLRS* |
| Ga0136449_1002236533 | 3300010379 | Peatlands Soil | VKDAALRLLEQDARFRAAMLEGIAQADREEFIEEEEMDARIERMLNS* |
| Ga0136449_1012685251 | 3300010379 | Peatlands Soil | VKDAALRLLQEDAHFRAAVREGIAQADRGEFIEEEGMDARLEQMLRS* |
| Ga0137388_119129152 | 3300012189 | Vadose Zone Soil | ELVKRAALLLLGKDAHFRAAVLEGKAYADRGEFIEEEEMDARFEQMLRS* |
| Ga0137365_111142681 | 3300012201 | Vadose Zone Soil | DARFRSAVRTGIDQADGGEFIEEEMDAHFEEMLRS* |
| Ga0137374_109430081 | 3300012204 | Vadose Zone Soil | EDEAFRAAVQLGIDQADRGELIDEADMDARVERLLRS* |
| Ga0150985_1063525921 | 3300012212 | Avena Fatua Rhizosphere | AAMRLLDRLLDEDVRFRAAVMEGKAYADRGEFIEEEEMDARFEQMLRS* |
| Ga0137359_101800593 | 3300012923 | Vadose Zone Soil | KDAALRLLQEDARFRAAVREGIAQADRGEFIGEEEMDARLEQMLRS* |
| Ga0137416_117266701 | 3300012927 | Vadose Zone Soil | ALALIDQDRKFRAAVQEGLAQADRGEFIEEAEMNERLEKMLRS* |
| Ga0137404_112720453 | 3300012929 | Vadose Zone Soil | DAALSLLQEDARFRAAVREGIAQADRGEFIDEAEMGARLEQMLRS* |
| Ga0164301_108314121 | 3300012960 | Soil | MVKDAAMRLLDEDARFRAAVMEGKAYADRGEFIEEEEMDKRFEEMLRS* |
| Ga0134110_104577511 | 3300012975 | Grasslands Soil | ARFRAAVREGIAQADRGEFIEEAEMDARLEQMLRS* |
| Ga0181538_101930581 | 3300014162 | Bog | AERLVKDAALRLLAEDARFRAAVRSGMAQADRGEFIEEEEMDVRLEQMLRS* |
| Ga0181523_104073431 | 3300014165 | Bog | VRLLEEDARFRAAVREGIAQADRGEFIDEVEMSARLEQMLRS* |
| Ga0181528_100933222 | 3300014167 | Bog | VRLVTEDAMRLLQEEARFRATVREGIPQADRGEFIDEQEMDARLEQMLRS* |
| Ga0181528_106046393 | 3300014167 | Bog | EEDARFRAAVREGIAQADRGEFIEEEEMNARFERMLQS* |
| Ga0181528_107656651 | 3300014167 | Bog | DAALRLIQEDARFRAAVREGVAQADRGELIEEEEMNARLEQMLRS* |
| Ga0181535_100543484 | 3300014199 | Bog | RFRAGVCKGVEQADLGMFVEESEMDARIHRLLGN* |
| Ga0181537_103982011 | 3300014201 | Bog | EEDAGFRAAVGEGMAQADRGELIEEREMDARLEQMLRS* |
| Ga0182018_102753082 | 3300014489 | Palsa | MEEPFHPKQEDSSFRAAVEEGIAQADRGEFIEEEQMDTRLEQILRS* |
| Ga0182019_102442501 | 3300014498 | Fen | TDAKELVKDAALRLLEQDARFRAAVREGIAQADRGQFIEEKEMDARLEQMLRS* |
| Ga0182012_101535061 | 3300014499 | Bog | QEEARFRAAVREGIAQADQGELIDEDEMDARLEQMLRS* |
| Ga0182030_101564934 | 3300014838 | Bog | MHGEGCMVQDAALRLLQEEARFRAAVREGIAQADRGEFIEEEEMDAGRRSRLVAY* |
| Ga0157376_124717692 | 3300014969 | Miscanthus Rhizosphere | EDLVKDAALRLLEEDARFRAGVREGIAQADRGQLIDEQDMDARFEQMLNS* |
| Ga0167649_1008704 | 3300015063 | Glacier Forefield Soil | VKDAALRLLQEDQRFRAAAREGIAQADQGQFIEEEEMDARLEQMLRS* |
| Ga0163144_110022872 | 3300015360 | Freshwater Microbial Mat | MEAHFTDEQVTRFRAAVLVGKTYADRSEFIEEEEMDARFEQMLRS* |
| Ga0187877_13051891 | 3300017931 | Peatland | ARFRAAVREGIAQADRGEFIDDAEMNARLEQILRA |
| Ga0187877_13656742 | 3300017931 | Peatland | LIEDDARFRAAVRKGIDQAEHGLFIEEAEMNARFTCLQNA |
| Ga0187819_102984622 | 3300017943 | Freshwater Sediment | DEDARFRAAVREGIAQADRGEFIEEEEMDARFEQMLRA |
| Ga0187782_100455093 | 3300017975 | Tropical Peatland | KNAAVRLLEEDARFRAAVREGVAQAERGEFIEEAEMNARLERILRS |
| Ga0187782_102069291 | 3300017975 | Tropical Peatland | LECLVKDAALRLLERDARFRDAVRKGLHQADNGEFVEEQEMNARIDRMLD |
| Ga0181520_110702472 | 3300017988 | Bog | DPEQLIKDAALSLLDEDRRFREAVRTGIAQADRGELIEEAEMDARVERMFQS |
| Ga0187804_105796831 | 3300018006 | Freshwater Sediment | EDARFRSAVREGIAQADRGEFIEEQEMSARLEQMLRS |
| Ga0187805_101549681 | 3300018007 | Freshwater Sediment | HAALRLLEEDARFRAAVREGIAQADRGGFIEEEEMDARFEEMLRS |
| Ga0187888_12040173 | 3300018008 | Peatland | RLLEEDARFRAAVREGIAQADRGEFIGEAEMNARLEQMLRS |
| Ga0187872_101127012 | 3300018017 | Peatland | VKDAALRLLEEDARFRAAVREGIAQADRGELIEEKEMDAHLEQMFRS |
| Ga0187874_102946771 | 3300018019 | Peatland | ARFRAAVREGIAQSERGEFIEEEEMNARLEQMLRS |
| Ga0187857_104818871 | 3300018026 | Peatland | ARFRAAVREGIAQADRGEFIDEAEMNARLEQILRA |
| Ga0187863_107326891 | 3300018034 | Peatland | DARFRAAVQGGIAQADREEFIEEEEMNARIERMLNS |
| Ga0187883_104456371 | 3300018037 | Peatland | SDPEQLIKDAALSLLDEDRRFREAVQAGIAQADRGDLIEEAEMDARVERMFQS |
| Ga0187890_105148062 | 3300018044 | Peatland | LEQDARFRAAVQEGIAQADREEFIEEEEMNARIERMLNS |
| Ga0187784_111946421 | 3300018062 | Tropical Peatland | LSLVEEDGRFRAAVREGIEQADRGEFIEEEEMDVRVERMFQS |
| Ga0187772_113124971 | 3300018085 | Tropical Peatland | APNLVKDAALRLLEEDARFRAAVSEGVAQGDHGEFIGEEEMDARFEQMLRS |
| Ga0066667_101522402 | 3300018433 | Grasslands Soil | LQEDARFDAAVREGVAQADRGEFIEEEEMDARLEQMLRS |
| Ga0066662_100628641 | 3300018468 | Grasslands Soil | LRLLEDDAHFRSTVREGIAQADRGEFIEEEMDARFEEMLRS |
| Ga0066669_113785011 | 3300018482 | Grasslands Soil | AALRLVEEDAKFRAAVREGIAQADRGELIDHDEVVARIERRLQSRPR |
| Ga0163151_1000358210 | 3300020057 | Freshwater Microbial Mat | MEAHFTDEQVTRFRAAVLVGKTYADRSEFIEEEEMDARFEQMLRS |
| Ga0210399_107701662 | 3300020581 | Soil | LRLLEQDARFRAAVREGISQADRGGFIEEEEMDARIERMLNS |
| Ga0210399_113307061 | 3300020581 | Soil | VKDAALRLLEQDARFRVAVREGIAQADREEFIKEEEMDARIERMLNS |
| Ga0210401_105476682 | 3300020583 | Soil | VKDAALRLLEEDAHFRPAVREGIEQAGRGEFIDPGECIDEAEMKDRLEPMLRA |
| Ga0210405_1000095323 | 3300021171 | Soil | VTDAALRLLEQDAHFRAAVREGIAQADLEGFIEEEEMDARMERMLSS |
| Ga0210405_110090932 | 3300021171 | Soil | VKDAALRQLQEDARFRAAVREGIAQADRGELIGEEEMDARLEQMLRS |
| Ga0210408_107703061 | 3300021178 | Soil | QEETHFRAAVREGIAQADRGEFIEEEEMDARLEQMLRP |
| Ga0210396_100538614 | 3300021180 | Soil | LRLLEQAARFRAAVWEGVAQAEREEFIEEQEMDARIERMLNS |
| Ga0210396_111920172 | 3300021180 | Soil | LVKEAALGLLQEDAHFRAAVREGIAQANRGEFIEEDEKDEV |
| Ga0210396_116210721 | 3300021180 | Soil | MPPCAFLEQDARFRAAVRESIAQADREEFIEEEEVDARIERMLTS |
| Ga0210388_100403012 | 3300021181 | Soil | VKEAALRLLQEVTPFRAVVREGIAPANQVEFIEEEERDARFEEMLRS |
| Ga0210393_113595761 | 3300021401 | Soil | RLLREDARFRAAVREGVAQADRGEFIEEEEMDARLEQMLRS |
| Ga0210397_109163842 | 3300021403 | Soil | SRLLERDGRLGASVREGIAQAGREEFIGGGEMDARGGRMVES |
| Ga0210397_115973631 | 3300021403 | Soil | LRLLEQDSRFRAAVREGIAQADRGEFIEEEEMEARIERMLNS |
| Ga0210389_100368874 | 3300021404 | Soil | VKNAALRVLEDVSFRAAVREGIAQADRGEFIDEEEMDARFEEMLRT |
| Ga0210386_111953352 | 3300021406 | Soil | VKEAALGLLQEDAHFRAAVREGIAQANRGEFIEEDEKDEV |
| Ga0210384_103719412 | 3300021432 | Soil | MEPGPIRERLAKDALRLLQEDARFRAAVREGLAQAERGEFIEIEEEEMDARLEQLLRS |
| Ga0210391_100870634 | 3300021433 | Soil | VKDAALRVVEDVQFRAAVREGIAQADRGEFIEEEEMDARFEEMLRS |
| Ga0187846_100679433 | 3300021476 | Biofilm | VKDAALRLLEEDARFRAAVREGVAQADRGEFIEEEEMEAPLAQMLRS |
| Ga0210398_105253453 | 3300021477 | Soil | ERLVKDAALRLIEEDARFRAAAREGIAQADRGEFIEEEEMNARLEQMLRS |
| Ga0212123_106283012 | 3300022557 | Iron-Sulfur Acid Spring | QDARFRAAVREGIAQADREEFIEEEEMDARIERMLNS |
| Ga0224556_11799952 | 3300024295 | Soil | MEEPFHPKQEDSSFRAAVEEGIAQADRGEFIEEEQMDTRLEQILRS |
| Ga0208820_10853042 | 3300025576 | Peatland | LVKDAALRLLEEDARFRAAVREGIAQADRGELIEEKEMDAHLEQMFRS |
| Ga0209483_10181343 | 3300025862 | Arctic Peat Soil | MDVNLTQEEEERFRAAVLEGKAYADRGVFIEEEEMDERFEEMLRS |
| Ga0207699_113484813 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | EQFRVAVSEGIAAADRGEFIDEAEMDARFRKLLQS |
| Ga0207684_108309602 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MPIFRAAVREGIAQADRGEFIEEEEMDARFEEMLRS |
| Ga0207817_10379182 | 3300026979 | Tropical Forest Soil | LLEEDARFRAAVREGVAQADRGEFIEEAEMNARLEQMLHS |
| Ga0208095_10012244 | 3300027104 | Forest Soil | MGARTLKAMEYPFASAEEDAHFRAAVREGIAQAERGEFIEEEEMDERFEQMLRS |
| Ga0209179_10254581 | 3300027512 | Vadose Zone Soil | AARFRVAVREGIAQADRGEFIEQEEMDARLEQMLRS |
| Ga0209524_10207713 | 3300027521 | Forest Soil | VKDAALRLLQEDARFRAAVREGIAQADRGELIGEEEMDARLEQMLRS |
| Ga0209333_11449771 | 3300027676 | Forest Soil | MAPLSLLQQHARFRAAVRKGVAQADLGEFIEEEEVDARLEQMLHS |
| Ga0207862_11432591 | 3300027703 | Tropical Forest Soil | VKDAAMRLLEDDARFRAAVRKGIEQADRGEFIDEDEMDARI |
| Ga0209039_101215513 | 3300027825 | Bog Forest Soil | DAALRLLQENARFRAVVREGIAQANRGEFIEEEEMDARFEEMLRS |
| Ga0209060_102546942 | 3300027826 | Surface Soil | VKNAALRLTDEEDFLESVQQGIAEADRGEFIEDEEMDTRIERMLRSEMRIR |
| Ga0209517_100568512 | 3300027854 | Peatlands Soil | VKDAALRLLEQDARFRAAMLEGIAQADREEFIEEEEMDARIERMLNS |
| Ga0209693_100573472 | 3300027855 | Soil | MPPCAFLEQDARFRAAVRESIAQADREEFIEKEEVDARIERMLTS |
| Ga0209579_100156132 | 3300027869 | Surface Soil | VKDTALRLLEEGARFRAAVREGIAQADRGEFIEEEMDARLEQMLRS |
| Ga0209579_102165162 | 3300027869 | Surface Soil | VNDAALRLLQEEVRFCAAIRAGLAQADRRGFIEEEEMDVRLDQMLRS |
| Ga0209590_104414582 | 3300027882 | Vadose Zone Soil | QEDAGFRAAVQEGIAQADRGEFIEEREMDDRLEQMLRS |
| Ga0209488_112164522 | 3300027903 | Vadose Zone Soil | DASELRKETALRLLDLDARFRTAVLEGKAYADRGEFIEEEEMDARFEQMLRS |
| Ga0209006_100159354 | 3300027908 | Forest Soil | LRLLERDARFRAAVHKGLEQADRSEFIGEAEMDARIERMIQP |
| Ga0209006_100735424 | 3300027908 | Forest Soil | MRLCAFQDEARFRAAVREGIAQADRGEFIEQDEMDARLEQMLRS |
| Ga0209526_107268881 | 3300028047 | Forest Soil | DAALRLLQEDARFRAAVREGVAQADRGEFIGEEEMDARVKRMFRP |
| Ga0302234_103966421 | 3300028773 | Palsa | KEGTNLARLVKQAALYLILRDDVFRATVREGIAQADRGEFIEEEMDARLEQMLRS |
| Ga0302154_104790703 | 3300028882 | Bog | FRAAVREGIAQADRGEFIGQSKMEQEEMDARLQQMLRS |
| Ga0311368_105007752 | 3300029882 | Palsa | QLVKDAALRLLQEDARFRAAVREGSARADRGEFIEQQEMDARLEQMLRS |
| Ga0311327_105662582 | 3300029883 | Bog | ETERLVKNAALRLLEEESRFRAAVTEGIAQANRGEFIEEEEEEMDAHLEAMLRS |
| Ga0311329_108032232 | 3300029907 | Bog | LVKDAAMRAVEDPQFRAAVREGLAQADRGEFIEEEEMDARFEEMLRS |
| Ga0311341_107925102 | 3300029908 | Bog | TDAIRLVTEAALRLLQEDARFRAAVREGIAQADRGEFIGQSKMEQEEMDARLQQMLRS |
| Ga0311362_111445832 | 3300029913 | Bog | EAERLVKDAALRLLEDDARFRSAVREGIAQADRGEFIEHEEMELRIEQMLRS |
| Ga0311338_102072072 | 3300030007 | Palsa | VKDAALRLLQEEARFRVAVREGIAQADRGEFIEEEMDARLEQMLRS |
| Ga0311338_119258202 | 3300030007 | Palsa | LVKDAALRLLREGARFRAAVREGIAQADRGEFIEEDEMDARLEQMLRS |
| Ga0302270_103256921 | 3300030011 | Bog | RLVRDAAVRLLAEDARFRAAVREGITQADRGEFIEEEMNARFERMLQS |
| Ga0302178_104417101 | 3300030013 | Palsa | GTNLARLVKQAALYLILRDDVFRATVREGIAQADRGEFIEETEMDSRFERMVSL |
| Ga0302306_100574922 | 3300030043 | Palsa | LLHSESESAHARFRAAVREGIAQADRGEFIEEGEMDARLEQMLRS |
| Ga0302306_103094712 | 3300030043 | Palsa | RLLQEDARFRAAVREGSARADRGEFIEQQEMDARLEQMLRS |
| Ga0311353_102016902 | 3300030399 | Palsa | DARFRAAVREGVAHADRGEFIEEEEMDARLEQMLRS |
| Ga0311353_106447592 | 3300030399 | Palsa | LQEDARFRAAVREGIAQADRGEFIEEEEMDARLEQMLRS |
| Ga0311370_112694781 | 3300030503 | Palsa | LVKDAALRLLQEDARFRDAVREGIAQADRGEFIEEGEMDARLEQMLRS |
| Ga0302183_100775891 | 3300030509 | Palsa | AKEGTNLARLVKQAALYLILRDDVFRATVREGIAQADRGEFIEETEMDSRFERMVSL |
| Ga0302275_102708923 | 3300030518 | Bog | LVTEAALRLLQEDARFRAAVREGIAQADRGEFIGQSKMEQEEMDARLQQMLRS |
| Ga0302193_102899251 | 3300030519 | Bog | EKDAALRLLNEEARFRAAVRAGIAQADRGEFIEEEEMDARLEQMLRS |
| Ga0311372_110645043 | 3300030520 | Palsa | LVKDAALRLLEDARFRAAVREGIEQADRGEFIEEAEMDALFEQMLRA |
| Ga0311355_105527144 | 3300030580 | Palsa | LRLLQQDARFRAAVREGVAHADRGEFIEEEEMDARLEQMLRS |
| Ga0311356_109346772 | 3300030617 | Palsa | ALRLLQEDARFRAAVREGSARADRGEFIEQQEMDARLEQMLRS |
| Ga0302180_105440332 | 3300031028 | Palsa | VKEAALRLLQEDARFRAAVREVTAQADRGEFIEQEEMDARLEQMLRS |
| Ga0265754_10389052 | 3300031040 | Soil | DAAPRLLKEEARFRAAVRERIAQADRGEFIEEEEMDARLEQMLRS |
| Ga0170824_1214903441 | 3300031231 | Forest Soil | ARFRAAVREGLAQADRGEFIEEEEMDARLEQMLRS |
| Ga0302323_1005789463 | 3300031232 | Fen | VKDAALRLLQEDARFRAAVREGIAQADRTEFIEEEEMDARLEQMLQS |
| Ga0302325_100402563 | 3300031234 | Palsa | LAKDAAWRLLQEEARFRAAVREGVAQADRGEFIEEEEMDARLEQMLRA |
| Ga0302324_1001384413 | 3300031236 | Palsa | LVKDAALRLLQEEARFRVAVREGIAQADRGEFIEEEMDARLEQMLRS |
| Ga0302324_1029241033 | 3300031236 | Palsa | KSAALRLLEEDARFRAGVKRGLDAAARGDFIEEEAMDASIERMLQS |
| Ga0265316_100419377 | 3300031344 | Rhizosphere | RLLQEDARFRAAVREGIAQADRGEFIEEEDMDARLEQMLRS |
| Ga0302320_119340431 | 3300031524 | Bog | TEAERLVKDAALRLLEDDARFRSAVREGIAQADRGEFIEHEEMELRIEQMLRS |
| Ga0302326_128881811 | 3300031525 | Palsa | DGIAPEEEARFSAAVPEGIEQADRGELIEEAEMDAMFERLLHS |
| Ga0310686_1063919121 | 3300031708 | Soil | VKDAALRLLEQDARFRAAVREGIAQADREEFIEEQEMDARIERMLNS |
| Ga0310686_1117243481 | 3300031708 | Soil | AALRLLEEDVRFRAAVREGIAQADRSEFIEQEEMDARLEQMLRS |
| Ga0307476_108838492 | 3300031715 | Hardwood Forest Soil | DAALRLLEEGARFRAAVREGIAQADRGEFIEEEMDARLEQMLRS |
| Ga0307474_100801955 | 3300031718 | Hardwood Forest Soil | GGVDTESFVKNAALRLMEDERFRAAVREGIAQADRGEFVPEAEVDALFERLLRP |
| Ga0307475_101015951 | 3300031754 | Hardwood Forest Soil | AALRLLQEDARFRAAVREGIAQADRGELIEEEEMNARLEQMPRS |
| Ga0307475_105508951 | 3300031754 | Hardwood Forest Soil | LLEQDARFRAAVREGIAQADRGEFIEEEEMDARIERMLDS |
| Ga0302319_100802237 | 3300031788 | Bog | DAALHLLEEDAHFRVAVQKGLEQADRGEFIDEEEMDARIKAMLGS |
| Ga0302319_113208291 | 3300031788 | Bog | VKDAALRLLREESRFLEAVREGIAQADRGEFIEEEEMDARLEQMLRS |
| Ga0307478_115395261 | 3300031823 | Hardwood Forest Soil | IQENIRFRAEVRKGVEQADRGEFIEEAEMDARVERMLRR |
| Ga0308176_101127331 | 3300031996 | Soil | ALRFLAEDARFRSAVREGIAQADRGEFIEGAAMDARFEEMLRS |
| Ga0307414_121294241 | 3300032004 | Rhizosphere | LRLLEDDARFRAAVAEGVAQADRGEFVNEPDMDARFEQMLNS |
| Ga0307471_1042945861 | 3300032180 | Hardwood Forest Soil | AALRLLEEDARFRAAVREGVEQADRGEFIEEAEMASRLEQMLRS |
| Ga0307472_1010001862 | 3300032205 | Hardwood Forest Soil | ARFRAAVREGIAQADRGEFIEEEEMDARLEQLLRS |
| Ga0306920_1021675651 | 3300032261 | Soil | LLEEDARFRAAVKEGIAQADGGEFIEEEEMDARFEQMLKS |
| Ga0335397_104317481 | 3300032420 | Freshwater | RLLDEDARFRAAVLEAKAYADRGEFIEEEEMDARFEQMLST |
| Ga0335085_122619501 | 3300032770 | Soil | DARFRAAVREGIAQADRGEFIEEEEMEARIERMLNS |
| Ga0335082_102251913 | 3300032782 | Soil | QSEDNARFRAAVREGIAQADRGKFIEEEEMDALLERMLRQGREKR |
| Ga0335078_113611782 | 3300032805 | Soil | RLVKEAAVRLLEEDARFRAAVREGIAQADRGEFIEEEEMNARLEQMLRS |
| Ga0335078_118946222 | 3300032805 | Soil | MPGFHAAVREGIAQADRGEFIEEEEMDARFEQMLRS |
| Ga0335081_113497791 | 3300032892 | Soil | KDAALRLLEEEARFRAAVREGVAQADRGEFLEEEEMDARFEQMLRSE |
| Ga0335081_115061191 | 3300032892 | Soil | EEDARFRAAVREGIGQADRGEFIEEAEMDARLEQMLRS |
| Ga0335069_100529983 | 3300032893 | Soil | VKDAALRLVDEEERFRAAVLEGKAYADRGEFIEEEEMDARFAELLRS |
| Ga0335069_103104672 | 3300032893 | Soil | MARTDLSELWNDPSFRAALRKGVAQADRGEFVEAEEMNARFEKMLRS |
| Ga0335071_106235003 | 3300032897 | Soil | KDAALRLLTEDEQFRAAVREGIAAADRGEFIEHDEVWANIEKILRS |
| Ga0326727_101638771 | 3300033405 | Peat Soil | SRFRAAVQKGIEQADRGEFIEEEEMDARIEQMLNS |
| Ga0326726_120690921 | 3300033433 | Peat Soil | KDAALRLREDEVHFRAAVREGIAQANRGEFLAEEEMDARFEAMLRS |
| Ga0314861_0136773_1092_1208 | 3300033977 | Peatland | EEDARFRAAVREGLAQADRGQFIEEAEMNARLEQMLRS |
| Ga0370483_0160359_1_120 | 3300034124 | Untreated Peat Soil | MEEPFHPKQEDSSFRAAVEEGIAQADRGEFIEEEQMDTRL |
| Ga0370515_0235527_12_155 | 3300034163 | Untreated Peat Soil | VKEAALRLLQEDARFRAAVREGIAQADRGEFIEEGEMDARLEQMLRS |
| ⦗Top⦘ |