| Basic Information | |
|---|---|
| Family ID | F025712 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 36 residues |
| Representative Sequence | MHGMLSAAIMILAYAVVAIAAGYTAVKVIRGGPHDG |
| Number of Associated Samples | 145 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 45.50 % |
| % of genes near scaffold ends (potentially truncated) | 21.50 % |
| % of genes from short scaffolds (< 2000 bps) | 71.00 % |
| Associated GOLD sequencing projects | 136 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.58 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (59.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (21.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (48.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.58 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF08768 | THAP4_heme-bd | 50.50 |
| PF02635 | DrsE | 18.50 |
| PF08353 | MurT_C | 5.50 |
| PF07685 | GATase_3 | 5.50 |
| PF01475 | FUR | 2.50 |
| PF01571 | GCV_T | 2.00 |
| PF08669 | GCV_T_C | 1.50 |
| PF00005 | ABC_tran | 1.00 |
| PF14748 | P5CR_dimer | 1.00 |
| PF01619 | Pro_dh | 1.00 |
| PF00535 | Glycos_transf_2 | 1.00 |
| PF00850 | Hist_deacetyl | 1.00 |
| PF05768 | Glrx-like | 0.50 |
| PF16363 | GDP_Man_Dehyd | 0.50 |
| PF12679 | ABC2_membrane_2 | 0.50 |
| PF07702 | UTRA | 0.50 |
| PF07730 | HisKA_3 | 0.50 |
| PF04545 | Sigma70_r4 | 0.50 |
| PF13490 | zf-HC2 | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0769 | UDP-N-acetylmuramyl tripeptide synthase | Cell wall/membrane/envelope biogenesis [M] | 5.50 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 2.50 |
| COG0123 | Acetoin utilization deacetylase AcuC or a related deacetylase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.00 |
| COG0506 | Proline dehydrogenase | Amino acid transport and metabolism [E] | 1.00 |
| COG0695 | Glutaredoxin | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
| COG3118 | Chaperedoxin CnoX, contains thioredoxin-like and TPR-like domains, YbbN/TrxSC family | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 0.50 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 0.50 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 0.50 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 60.00 % |
| Unclassified | root | N/A | 40.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002245|JGIcombinedJ26739_100544637 | All Organisms → cellular organisms → Bacteria | 1038 | Open in IMG/M |
| 3300005332|Ga0066388_106007029 | Not Available | 613 | Open in IMG/M |
| 3300005332|Ga0066388_106369290 | Not Available | 595 | Open in IMG/M |
| 3300005339|Ga0070660_100449938 | Not Available | 1068 | Open in IMG/M |
| 3300005533|Ga0070734_10584880 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 636 | Open in IMG/M |
| 3300005537|Ga0070730_10541668 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 746 | Open in IMG/M |
| 3300005538|Ga0070731_11033221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300005548|Ga0070665_100422495 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1342 | Open in IMG/M |
| 3300005577|Ga0068857_100106605 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2517 | Open in IMG/M |
| 3300005602|Ga0070762_10347246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 945 | Open in IMG/M |
| 3300005610|Ga0070763_10016527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3176 | Open in IMG/M |
| 3300005610|Ga0070763_10137645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1266 | Open in IMG/M |
| 3300005712|Ga0070764_10022225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3165 | Open in IMG/M |
| 3300005764|Ga0066903_100053105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4964 | Open in IMG/M |
| 3300005921|Ga0070766_10480001 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 824 | Open in IMG/M |
| 3300006028|Ga0070717_11750552 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300006028|Ga0070717_12061261 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 514 | Open in IMG/M |
| 3300006755|Ga0079222_10500225 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 890 | Open in IMG/M |
| 3300006864|Ga0066797_1001780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 6694 | Open in IMG/M |
| 3300006904|Ga0075424_101264846 | Not Available | 785 | Open in IMG/M |
| 3300007265|Ga0099794_10131190 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1265 | Open in IMG/M |
| 3300007982|Ga0102924_1013572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 6531 | Open in IMG/M |
| 3300009090|Ga0099827_10052066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3083 | Open in IMG/M |
| 3300009545|Ga0105237_11792215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 621 | Open in IMG/M |
| 3300009683|Ga0116224_10410779 | Not Available | 644 | Open in IMG/M |
| 3300009792|Ga0126374_10178377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1320 | Open in IMG/M |
| 3300009792|Ga0126374_10346221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1017 | Open in IMG/M |
| 3300009792|Ga0126374_10706654 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 759 | Open in IMG/M |
| 3300009826|Ga0123355_10028719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 8995 | Open in IMG/M |
| 3300009826|Ga0123355_10269330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2369 | Open in IMG/M |
| 3300009826|Ga0123355_11910263 | Not Available | 555 | Open in IMG/M |
| 3300010047|Ga0126382_10180616 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1481 | Open in IMG/M |
| 3300010048|Ga0126373_10816892 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 995 | Open in IMG/M |
| 3300010048|Ga0126373_10876265 | Not Available | 961 | Open in IMG/M |
| 3300010048|Ga0126373_11354349 | Not Available | 777 | Open in IMG/M |
| 3300010048|Ga0126373_11759198 | Not Available | 684 | Open in IMG/M |
| 3300010048|Ga0126373_12797344 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 545 | Open in IMG/M |
| 3300010049|Ga0123356_11611981 | Not Available | 803 | Open in IMG/M |
| 3300010159|Ga0099796_10515756 | Not Available | 536 | Open in IMG/M |
| 3300010162|Ga0131853_10002187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 35114 | Open in IMG/M |
| 3300010361|Ga0126378_12511121 | Not Available | 588 | Open in IMG/M |
| 3300010366|Ga0126379_13166091 | Not Available | 551 | Open in IMG/M |
| 3300010369|Ga0136643_10712738 | Not Available | 602 | Open in IMG/M |
| 3300010369|Ga0136643_10879307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 513 | Open in IMG/M |
| 3300010373|Ga0134128_10121446 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2963 | Open in IMG/M |
| 3300010373|Ga0134128_10173349 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2435 | Open in IMG/M |
| 3300010376|Ga0126381_100036861 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 5896 | Open in IMG/M |
| 3300010376|Ga0126381_101997127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 836 | Open in IMG/M |
| 3300010379|Ga0136449_103046286 | Not Available | 653 | Open in IMG/M |
| 3300010386|Ga0136806_1362200 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2572 | Open in IMG/M |
| 3300010867|Ga0126347_1206901 | Not Available | 663 | Open in IMG/M |
| 3300010869|Ga0126359_1148734 | Not Available | 590 | Open in IMG/M |
| 3300010876|Ga0126361_11241934 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 6888 | Open in IMG/M |
| 3300010880|Ga0126350_10604283 | Not Available | 544 | Open in IMG/M |
| 3300010880|Ga0126350_11455714 | Not Available | 617 | Open in IMG/M |
| 3300011269|Ga0137392_11081079 | Not Available | 658 | Open in IMG/M |
| 3300011269|Ga0137392_11421728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Vibrionales → Vibrionaceae → Vibrio → Vibrio harveyi group → Vibrio parahaemolyticus | 553 | Open in IMG/M |
| 3300011418|Ga0153954_1039178 | Not Available | 1223 | Open in IMG/M |
| 3300012210|Ga0137378_10576219 | Not Available | 1035 | Open in IMG/M |
| 3300012210|Ga0137378_11135185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 697 | Open in IMG/M |
| 3300012357|Ga0137384_10676484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 839 | Open in IMG/M |
| 3300012357|Ga0137384_10704498 | Not Available | 820 | Open in IMG/M |
| 3300012363|Ga0137390_10722108 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 958 | Open in IMG/M |
| 3300012930|Ga0137407_10037143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 3858 | Open in IMG/M |
| 3300012942|Ga0164242_10532705 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 836 | Open in IMG/M |
| 3300012948|Ga0126375_11193691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 633 | Open in IMG/M |
| 3300012971|Ga0126369_11067194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 896 | Open in IMG/M |
| 3300014201|Ga0181537_10549921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 789 | Open in IMG/M |
| 3300014495|Ga0182015_10970557 | Not Available | 529 | Open in IMG/M |
| 3300014501|Ga0182024_10187759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 2845 | Open in IMG/M |
| 3300015242|Ga0137412_11028437 | Not Available | 588 | Open in IMG/M |
| 3300015245|Ga0137409_10036197 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4759 | Open in IMG/M |
| 3300016371|Ga0182034_10108921 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2004 | Open in IMG/M |
| 3300017821|Ga0187812_1000073 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 35660 | Open in IMG/M |
| 3300017821|Ga0187812_1003053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 5785 | Open in IMG/M |
| 3300017821|Ga0187812_1308381 | Not Available | 503 | Open in IMG/M |
| 3300017932|Ga0187814_10000987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 10549 | Open in IMG/M |
| 3300017932|Ga0187814_10177098 | Not Available | 798 | Open in IMG/M |
| 3300017942|Ga0187808_10000932 | Not Available | 9799 | Open in IMG/M |
| 3300017943|Ga0187819_10477587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 712 | Open in IMG/M |
| 3300017948|Ga0187847_10190455 | Not Available | 1118 | Open in IMG/M |
| 3300017948|Ga0187847_10908394 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 501 | Open in IMG/M |
| 3300017959|Ga0187779_10374944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 923 | Open in IMG/M |
| 3300017972|Ga0187781_10036786 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3373 | Open in IMG/M |
| 3300018001|Ga0187815_10321428 | Not Available | 657 | Open in IMG/M |
| 3300018018|Ga0187886_1382936 | Not Available | 515 | Open in IMG/M |
| 3300018044|Ga0187890_10318132 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 874 | Open in IMG/M |
| 3300018044|Ga0187890_10612764 | Not Available | 614 | Open in IMG/M |
| 3300018086|Ga0187769_10409782 | Not Available | 1019 | Open in IMG/M |
| 3300020069|Ga0197907_10377095 | Not Available | 968 | Open in IMG/M |
| 3300020069|Ga0197907_10643634 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1261 | Open in IMG/M |
| 3300020070|Ga0206356_10354850 | Not Available | 616 | Open in IMG/M |
| 3300020140|Ga0179590_1165466 | Not Available | 606 | Open in IMG/M |
| 3300020582|Ga0210395_10059335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2806 | Open in IMG/M |
| 3300020582|Ga0210395_10227653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1400 | Open in IMG/M |
| 3300020582|Ga0210395_10291744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1227 | Open in IMG/M |
| 3300020582|Ga0210395_10322933 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1161 | Open in IMG/M |
| 3300020582|Ga0210395_11020909 | Not Available | 612 | Open in IMG/M |
| 3300020582|Ga0210395_11070246 | Not Available | 596 | Open in IMG/M |
| 3300020583|Ga0210401_10333888 | Not Available | 1377 | Open in IMG/M |
| 3300020583|Ga0210401_10733310 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 849 | Open in IMG/M |
| 3300021170|Ga0210400_10973134 | Not Available | 691 | Open in IMG/M |
| 3300021180|Ga0210396_10093951 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2715 | Open in IMG/M |
| 3300021180|Ga0210396_10227297 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1662 | Open in IMG/M |
| 3300021180|Ga0210396_11643715 | Not Available | 523 | Open in IMG/M |
| 3300021181|Ga0210388_10102109 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2456 | Open in IMG/M |
| 3300021374|Ga0213881_10347384 | Not Available | 665 | Open in IMG/M |
| 3300021401|Ga0210393_10315091 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 1272 | Open in IMG/M |
| 3300021402|Ga0210385_10001309 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 15605 | Open in IMG/M |
| 3300021402|Ga0210385_10814032 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 716 | Open in IMG/M |
| 3300021402|Ga0210385_10870080 | Not Available | 692 | Open in IMG/M |
| 3300021402|Ga0210385_10871328 | Not Available | 691 | Open in IMG/M |
| 3300021403|Ga0210397_11474195 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
| 3300021404|Ga0210389_10006176 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 9294 | Open in IMG/M |
| 3300021406|Ga0210386_10055140 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3165 | Open in IMG/M |
| 3300021406|Ga0210386_10176192 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1801 | Open in IMG/M |
| 3300021406|Ga0210386_10753811 | Not Available | 838 | Open in IMG/M |
| 3300021406|Ga0210386_11154497 | Not Available | 656 | Open in IMG/M |
| 3300021407|Ga0210383_11252776 | Not Available | 622 | Open in IMG/M |
| 3300021420|Ga0210394_11295264 | Not Available | 623 | Open in IMG/M |
| 3300021474|Ga0210390_11636243 | Not Available | 506 | Open in IMG/M |
| 3300021559|Ga0210409_10191158 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1867 | Open in IMG/M |
| 3300021560|Ga0126371_10086412 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 3091 | Open in IMG/M |
| 3300021560|Ga0126371_11725940 | Not Available | 749 | Open in IMG/M |
| 3300021560|Ga0126371_12209553 | Not Available | 664 | Open in IMG/M |
| 3300022557|Ga0212123_10041609 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura viridilutea | 4409 | Open in IMG/M |
| 3300024288|Ga0179589_10010255 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 2764 | Open in IMG/M |
| 3300025898|Ga0207692_10197106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1182 | Open in IMG/M |
| 3300025905|Ga0207685_10566242 | Not Available | 606 | Open in IMG/M |
| 3300025919|Ga0207657_10032945 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4674 | Open in IMG/M |
| 3300025920|Ga0207649_10751236 | Not Available | 759 | Open in IMG/M |
| 3300025928|Ga0207700_10547858 | Not Available | 1027 | Open in IMG/M |
| 3300025929|Ga0207664_11616681 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 570 | Open in IMG/M |
| 3300026273|Ga0209881_1000119 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 22213 | Open in IMG/M |
| 3300026489|Ga0257160_1043867 | Not Available | 763 | Open in IMG/M |
| 3300027029|Ga0208731_1025985 | Not Available | 636 | Open in IMG/M |
| 3300027066|Ga0208236_1011669 | Not Available | 610 | Open in IMG/M |
| 3300027505|Ga0209218_1121293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae | 550 | Open in IMG/M |
| 3300027528|Ga0208985_1115054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 513 | Open in IMG/M |
| 3300027676|Ga0209333_1050272 | Not Available | 1151 | Open in IMG/M |
| 3300027817|Ga0209112_10099278 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 939 | Open in IMG/M |
| 3300027857|Ga0209166_10280434 | Not Available | 879 | Open in IMG/M |
| 3300027867|Ga0209167_10176852 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1130 | Open in IMG/M |
| 3300027882|Ga0209590_10169111 | Not Available | 1366 | Open in IMG/M |
| 3300027884|Ga0209275_10166058 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1177 | Open in IMG/M |
| 3300027889|Ga0209380_10256756 | Not Available | 1026 | Open in IMG/M |
| 3300027908|Ga0209006_10188684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1795 | Open in IMG/M |
| 3300027908|Ga0209006_10287597 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 1406 | Open in IMG/M |
| 3300027908|Ga0209006_10434340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1102 | Open in IMG/M |
| 3300028556|Ga0265337_1000387 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 23723 | Open in IMG/M |
| 3300028789|Ga0302232_10406234 | Not Available | 670 | Open in IMG/M |
| 3300028789|Ga0302232_10666380 | Not Available | 511 | Open in IMG/M |
| 3300028800|Ga0265338_10017995 | Not Available | 7586 | Open in IMG/M |
| 3300028800|Ga0265338_10070307 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3001 | Open in IMG/M |
| 3300028877|Ga0302235_10043672 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2200 | Open in IMG/M |
| 3300029999|Ga0311339_10174469 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2479 | Open in IMG/M |
| 3300029999|Ga0311339_11781690 | Not Available | 536 | Open in IMG/M |
| 3300030007|Ga0311338_11628087 | Not Available | 589 | Open in IMG/M |
| 3300030013|Ga0302178_10541108 | Not Available | 504 | Open in IMG/M |
| 3300030490|Ga0302184_10354729 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 578 | Open in IMG/M |
| 3300030520|Ga0311372_11564005 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 807 | Open in IMG/M |
| 3300030763|Ga0265763_1000348 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2662 | Open in IMG/M |
| 3300031231|Ga0170824_111343114 | Not Available | 922 | Open in IMG/M |
| 3300031525|Ga0302326_12663675 | Not Available | 622 | Open in IMG/M |
| 3300031543|Ga0318516_10005077 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 5937 | Open in IMG/M |
| 3300031544|Ga0318534_10882312 | Not Available | 501 | Open in IMG/M |
| 3300031564|Ga0318573_10068564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1768 | Open in IMG/M |
| 3300031572|Ga0318515_10562001 | Not Available | 607 | Open in IMG/M |
| 3300031680|Ga0318574_10017223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 3449 | Open in IMG/M |
| 3300031708|Ga0310686_119637922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
| 3300031713|Ga0318496_10567231 | Not Available | 627 | Open in IMG/M |
| 3300031747|Ga0318502_10012012 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 3956 | Open in IMG/M |
| 3300031765|Ga0318554_10520147 | Not Available | 673 | Open in IMG/M |
| 3300031780|Ga0318508_1160719 | Not Available | 639 | Open in IMG/M |
| 3300031793|Ga0318548_10070080 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1639 | Open in IMG/M |
| 3300031823|Ga0307478_11029308 | Not Available | 688 | Open in IMG/M |
| 3300031833|Ga0310917_11092278 | Not Available | 533 | Open in IMG/M |
| 3300032010|Ga0318569_10115187 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1222 | Open in IMG/M |
| 3300032261|Ga0306920_102469746 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 716 | Open in IMG/M |
| 3300032515|Ga0348332_12851357 | Not Available | 1054 | Open in IMG/M |
| 3300032770|Ga0335085_10141276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3036 | Open in IMG/M |
| 3300032782|Ga0335082_10240282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1697 | Open in IMG/M |
| 3300032805|Ga0335078_10002063 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 30447 | Open in IMG/M |
| 3300032893|Ga0335069_10669785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1183 | Open in IMG/M |
| 3300032895|Ga0335074_10008518 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 14256 | Open in IMG/M |
| 3300032895|Ga0335074_10018655 | Not Available | 9791 | Open in IMG/M |
| 3300032895|Ga0335074_10049987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5758 | Open in IMG/M |
| 3300032895|Ga0335074_10083949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4252 | Open in IMG/M |
| 3300032895|Ga0335074_10138034 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3116 | Open in IMG/M |
| 3300032895|Ga0335074_10297433 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1847 | Open in IMG/M |
| 3300032895|Ga0335074_10310027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1794 | Open in IMG/M |
| 3300032896|Ga0335075_10000072 | All Organisms → cellular organisms → Bacteria | 206766 | Open in IMG/M |
| 3300032896|Ga0335075_10000753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 54836 | Open in IMG/M |
| 3300032896|Ga0335075_10005029 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 20572 | Open in IMG/M |
| 3300032896|Ga0335075_10151288 | Not Available | 2893 | Open in IMG/M |
| 3300032898|Ga0335072_10191829 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2436 | Open in IMG/M |
| 3300032898|Ga0335072_10582221 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → unclassified Nocardioidaceae → Nocardioidaceae bacterium | 1131 | Open in IMG/M |
| 3300032954|Ga0335083_11198476 | Not Available | 589 | Open in IMG/M |
| 3300033134|Ga0335073_10021355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura | 9009 | Open in IMG/M |
| 3300033289|Ga0310914_10074110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 2873 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 21.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 9.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.00% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 8.00% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.00% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.50% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 3.50% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.50% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.00% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.50% |
| Sediment | Environmental → Aquatic → Freshwater → Groundwater → Mine Drainage → Sediment | 0.50% |
| Compost | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Compost | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.50% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.50% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.50% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.50% |
| Exposed Rock | Environmental → Terrestrial → Rock-Dwelling (Subaerial Biofilms) → Unclassified → Unclassified → Exposed Rock | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005533 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 | Environmental | Open in IMG/M |
| 3300005537 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300007982 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPM 11 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Host-Associated | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Host-Associated | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010162 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 2) | Host-Associated | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010369 | Labiotermes labralis P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P1 (version 3) | Host-Associated | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010386 | Acid mine drainage microbial communities from Malanjkhand copper mine, India - M8 kmer 63 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010869 | Boreal forest soil eukaryotic communities from Alaska, USA - W4-4 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011418 | Attine ant fungus gardens microbial communities from Florida, USA - TSFL038 MetaG | Host-Associated | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012942 | Miracle-Growth compost microbial communities from Emeryville, California, USA - Original compost - Miracle growth compost (MG) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014201 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaG | Environmental | Open in IMG/M |
| 3300014495 | Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017932 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_4 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018018 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_150 | Environmental | Open in IMG/M |
| 3300018044 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10 | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021374 | Barbacenia macrantha exposed rock microbial communities from rupestrian grasslands, the National Park of Serra do Cipo, Brazil - ER_R08 | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300024288 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026273 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300027029 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF045 (SPAdes) | Environmental | Open in IMG/M |
| 3300027066 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF005 (SPAdes) | Environmental | Open in IMG/M |
| 3300027505 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027528 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027676 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027857 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Host-Associated | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Host-Associated | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300030520 | III_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031765 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22 | Environmental | Open in IMG/M |
| 3300031780 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f21 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033289 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGIcombinedJ26739_1005446373 | 3300002245 | Forest Soil | VNGMLSAVIMXLAYAVVAVAAGYAAVXVIRGGPHDG* |
| Ga0066388_1060070292 | 3300005332 | Tropical Forest Soil | LGSRAVHGMLSAVIMIGAYAVVAIAAGYVAVKVIRGGPHDSR* |
| Ga0066388_1063692902 | 3300005332 | Tropical Forest Soil | LGSRAVHGMLSAVIMIGAYAVVAIAAGYVAVKVIRGGPHDGR* |
| Ga0070660_1004499382 | 3300005339 | Corn Rhizosphere | AAPRLHPMHGMLSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG* |
| Ga0070734_105848802 | 3300005533 | Surface Soil | MHGMLSAAVIILAYVVVAVAAGYTAVKVFRGGPHDG* |
| Ga0070730_105416682 | 3300005537 | Surface Soil | MHGMLSATILIIAYAVVAIAVAYAAVKVIRGGPHDG* |
| Ga0070731_110332212 | 3300005538 | Surface Soil | MHGMLSAAVIVLAYAVVAVAAGYTAVKVFRGGPHGG* |
| Ga0070665_1004224952 | 3300005548 | Switchgrass Rhizosphere | MHGMLSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG* |
| Ga0068857_1001066054 | 3300005577 | Corn Rhizosphere | MHGMLSAAVIILGYVAVAIAAGYAAIKVIRGGPHDG* |
| Ga0070762_103472462 | 3300005602 | Soil | MHGMLSATIIILAYVAVAVAAGYTAIKVIRGGPHDG* |
| Ga0070763_100165274 | 3300005610 | Soil | MHGMLSAGVIILAYAVVAIAAGYTAVKVIRGGPHD* |
| Ga0070763_101376452 | 3300005610 | Soil | MHGMLSATILIIAYAVVAIAVGYAAVKVIRGGPHDG* |
| Ga0070764_100222254 | 3300005712 | Soil | VNGMLSAVIMILAYAVVAVAAGYAAVKVIRGGPHDG* |
| Ga0066903_1000531052 | 3300005764 | Tropical Forest Soil | VHGMLSAVIMIGAYAVVAIAAGYAAVKVIRGGPHDGR* |
| Ga0070766_104800012 | 3300005921 | Soil | MHGMLSATVIILAYAVVAIAAGYTAVKVIRGGPHDG* |
| Ga0070717_117505522 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSATVIILAYVAVAIAAGYTAIKVIRGGPHDG* |
| Ga0070717_120612612 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSAAVIILAYAVFAAAAGYTAVKVFRGGPHDG* |
| Ga0079222_105002252 | 3300006755 | Agricultural Soil | MHGMLSASIIILAYAVVAIAAGYTAVKVIRGGPHDG* |
| Ga0066797_10017804 | 3300006864 | Soil | MHGILSAAIMILAYAVVAIAAGYAAVKVIRGGPHD* |
| Ga0075424_1012648462 | 3300006904 | Populus Rhizosphere | LHPMHGMLSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG* |
| Ga0099794_101311901 | 3300007265 | Vadose Zone Soil | APRLHPMHGMLSATVIILAYAVVAIAAGYTAVKVIKGGPHDG* |
| Ga0102924_10135724 | 3300007982 | Iron-Sulfur Acid Spring | MHGTLSAAVIILAYAVVAIAAGYTAVKVFRGGPHDG* |
| Ga0099827_100520662 | 3300009090 | Vadose Zone Soil | MAMHGMLSAAVMIGAYALVAVAAAYTAVKVIRGGPHEP* |
| Ga0105237_117922152 | 3300009545 | Corn Rhizosphere | MHGMLSAAILVLAYALVAIAAGYTAVKVIRGGPHDG* |
| Ga0116224_104107791 | 3300009683 | Peatlands Soil | MHGMLSAAVIILAYAVVAFAAGYTAVKVIRGGPHD* |
| Ga0126374_101783772 | 3300009792 | Tropical Forest Soil | MLSAVIMIGAYAVVAIAAGYVAVKVIRGGPHDSR* |
| Ga0126374_103462212 | 3300009792 | Tropical Forest Soil | MHGMLSAAVMISAYALVAVAAAYTAIKVIRGGPHDS* |
| Ga0126374_107066542 | 3300009792 | Tropical Forest Soil | MLSAAIMIGAYAVVAIAAGYAAVKVIRGGPHDSR* |
| Ga0123355_100287193 | 3300009826 | Termite Gut | MHGMLSGAIMILACALVAIAAGYVAVKVIRGGPHDG* |
| Ga0123355_102693301 | 3300009826 | Termite Gut | MHGMLSATVIILAYVAVAVAAGYAAIKVFRGGPHDG* |
| Ga0123355_119102631 | 3300009826 | Termite Gut | HGMLSAVIMILAYAMIAAAAGYVAVKVIRGGPHDG* |
| Ga0126382_101806163 | 3300010047 | Tropical Forest Soil | MLSAVIMIGAYAVVAIAAGYAAVKVIRGGPHDSR* |
| Ga0126373_108168922 | 3300010048 | Tropical Forest Soil | MLSAVIMIGAYAVVAIAAGYAVVKVIRGGPHDRR* |
| Ga0126373_108762651 | 3300010048 | Tropical Forest Soil | MVSAVIMILAYAVVAIAAGYAAVKVIRGGPHDSR* |
| Ga0126373_113543492 | 3300010048 | Tropical Forest Soil | MHGMLSAAIMIGGYLTVAVIAAYTAVKVIRGGPHDG* |
| Ga0126373_117591981 | 3300010048 | Tropical Forest Soil | ARLAGVHGMLSAALMIGAYAVVAVVAAYTAVKVIRGGPHDG* |
| Ga0126373_127973442 | 3300010048 | Tropical Forest Soil | MLSAGIMIFAYAVIAVAAGYTAVKVIRGGPHGGR* |
| Ga0123356_116119813 | 3300010049 | Termite Gut | MHGMVSAAILILAYAVVAAAAGYTALKVYRGGPHDG* |
| Ga0099796_105157561 | 3300010159 | Vadose Zone Soil | MHGTLSAAIIILAYAVVAIAAGYTAVKVIRGGPHGG* |
| Ga0131853_1000218729 | 3300010162 | Termite Gut | MHGMLSASILILAYAVVAAVGGYTAFKVFRGGPHDG* |
| Ga0126378_125111212 | 3300010361 | Tropical Forest Soil | GILSAAVMILAYAVIAVVAGYTAVKVIRGGPHDG* |
| Ga0126379_131660911 | 3300010366 | Tropical Forest Soil | MLSAVIMIGAYAVVAIAAGYAAVKVIRGGPHDGR* |
| Ga0136643_107127382 | 3300010369 | Termite Gut | MHGMLSAVVIILAYVAVAVGAGYTALKVIRGGPHDG* |
| Ga0136643_108793072 | 3300010369 | Termite Gut | MHGMLSATVIILAYVAVAVAAGYAVIKVIRGGPHDG* |
| Ga0134128_101214464 | 3300010373 | Terrestrial Soil | MHGMLSAAIIFLAYAVVAIAAGYTAVKVIRGGPHDG* |
| Ga0134128_101733492 | 3300010373 | Terrestrial Soil | MHGMLSAAVMIGAYALVAVAAAYTAVKVIRGGPHDT* |
| Ga0126381_1000368612 | 3300010376 | Tropical Forest Soil | MLSARIMIFAYAVIAVAAGYTAVKVIRGGPHGGR* |
| Ga0126381_1019971272 | 3300010376 | Tropical Forest Soil | VDTLAVVHGILSAAIMMGAYALVAVVAAYTAVKVIRGGPHDG* |
| Ga0136449_1030462862 | 3300010379 | Peatlands Soil | MHGMLSATIMILAYAVVAIAAGYTAVKVIRGGPHDG* |
| Ga0136806_13622002 | 3300010386 | Sediment | MHGMLSAVVIILAYAVVAIAAGYTAVKVIRGGPHDG* |
| Ga0126347_12069012 | 3300010867 | Boreal Forest Soil | MHGMVSATIMILAYAVVAIAAGYAAVKVIRGGPHDG* |
| Ga0126359_11487342 | 3300010869 | Boreal Forest Soil | MHGMLSAAVIILAFAVVAIAAGYTAVKVIRGGPHDG* |
| Ga0126361_112419343 | 3300010876 | Boreal Forest Soil | MHGMLSAAVIILAYAVIAIAAGYTAVKVIKGGPHGG* |
| Ga0126350_106042831 | 3300010880 | Boreal Forest Soil | MHGMLSAAVMILAYAAVALAAGYTAVKVIRGGPHGG* |
| Ga0126350_114557142 | 3300010880 | Boreal Forest Soil | MHGMLSATIMIIAYAVVAIAVGYAAVKVIRGGPHDG* |
| Ga0137392_110810792 | 3300011269 | Vadose Zone Soil | MHGMLSATVIILAYAVVAIAAGYTAVKVIKGCPHDG* |
| Ga0137392_114217282 | 3300011269 | Vadose Zone Soil | MHGTLSATIMIIAYAVVAIAVGYAAVKVIRGGPHDG* |
| Ga0153954_10391782 | 3300011418 | Attine Ant Fungus Gardens | MHGTLSAAVIVIAFLAVAVAAGYTAVKVIRGGPHGG* |
| Ga0137378_105762191 | 3300012210 | Vadose Zone Soil | MHGMLSAAVMIGAYALVAVAAAYTAVKVIRGGPHDS* |
| Ga0137378_111351851 | 3300012210 | Vadose Zone Soil | GSRAMHGMLSAVIIVLAYAVVAIAAGYTAVKVIRGGPHDG* |
| Ga0137384_106764842 | 3300012357 | Vadose Zone Soil | MHGTLSVAVIILAYAVVAIAAGYTAVKVIKGGPHDG* |
| Ga0137384_107044982 | 3300012357 | Vadose Zone Soil | MAMHGMLSAAVMIGAYALVAVAAAYTAVKVIRGGPHGG* |
| Ga0137390_107221082 | 3300012363 | Vadose Zone Soil | MHGMLSATVIILAYAVVAIAAGYTAVKVIKGGPHDG* |
| Ga0137407_100371432 | 3300012930 | Vadose Zone Soil | MHGMLSAAVMIAAYALVAVAAAYTAVKVIRGGPHDA* |
| Ga0164242_105327052 | 3300012942 | Compost | MHGMLSAVVIVIAFAAVAVAAGWTAVKVIRGGPHGE* |
| Ga0126375_111936912 | 3300012948 | Tropical Forest Soil | MLSAVIMIGAYAVVAIAAGYAAVKVIWGGPHDSR* |
| Ga0126369_110671941 | 3300012971 | Tropical Forest Soil | MLSAVIMIGAYAVVAIAAGYAAAKVIRGGPHDRR* |
| Ga0181537_105499212 | 3300014201 | Bog | MHGMLSATIMILAYAVVAIAAGYAAVKVFRGGPHDG* |
| Ga0182015_109705572 | 3300014495 | Palsa | MHGMLSAAIMILAYAVVAIAAGYAAVKVIRGGPHDG* |
| Ga0182024_101877593 | 3300014501 | Permafrost | MHGMLSAAIMILAYAVVAIAAGYTAVKVIRGGPHD* |
| Ga0137412_110284372 | 3300015242 | Vadose Zone Soil | LMHGTLSAAIIILAYAVVAIAAGYTAVKVIRGGPHGG* |
| Ga0137409_100361979 | 3300015245 | Vadose Zone Soil | MHGTLSAAVIILAYAVVAIAAGYTAVKVIRGGPHGG* |
| Ga0182034_101089214 | 3300016371 | Soil | RAVHGMLSAVIMIGAYAVVAIAAGYAAVKVIRGGPHDRR |
| Ga0187812_10000736 | 3300017821 | Freshwater Sediment | VHGTLSAVIMILAYAVVAIAAGYAAVKVIRGGPHG |
| Ga0187812_10030533 | 3300017821 | Freshwater Sediment | VHGMLSAVIMILAYAVVAIAAGYTAVKVFRGGPHDSR |
| Ga0187812_13083812 | 3300017821 | Freshwater Sediment | MHGMLSAAIMILAYALVAIAAGYVAVKVIRGGPHDG |
| Ga0187814_1000098710 | 3300017932 | Freshwater Sediment | VHGTLSAVIMILAYAVVAIAAAYTAVKVIRGGPHDG |
| Ga0187814_101770982 | 3300017932 | Freshwater Sediment | MHGMLSAAVIVLAYAMVAVAAGYTAVKVFRGGPHDG |
| Ga0187808_100009325 | 3300017942 | Freshwater Sediment | VHGMLSAAIMILVYALVAIAAGYTAVKVMRGGPHDGH |
| Ga0187819_104775872 | 3300017943 | Freshwater Sediment | MHGMLSAAIMILAYAVVAIAAGYTAVKVIRGGPHDRR |
| Ga0187847_101904552 | 3300017948 | Peatland | MHGMLSASIMILAYAVVAIAAGYAAVKVIRGGPHDG |
| Ga0187847_109083942 | 3300017948 | Peatland | MHGMLSATIMIIAYAVVAIAVGYAAVKVIRGGPHDG |
| Ga0187779_103749442 | 3300017959 | Tropical Peatland | MHGMASAAIMILAFAVIAAMACYVVIEVIRGGPHDG |
| Ga0187781_100367867 | 3300017972 | Tropical Peatland | MHGMASAAIMILAFAVVAAMACYVVIKVIRGGPHDG |
| Ga0187815_103214281 | 3300018001 | Freshwater Sediment | MHGMLSAAILILAYAVVAAVGGYTALKVLRGGPHDG |
| Ga0187886_13829362 | 3300018018 | Peatland | MHGMLSATIMILAYAVVAIAAGYVAVKVIRGGPHDG |
| Ga0187890_103181322 | 3300018044 | Peatland | MHGMLSATIMILAYAVVAIAAGYAAVKVIRGGPHDG |
| Ga0187890_106127641 | 3300018044 | Peatland | MHGMVSAAILILAYALVAIAAGYAAVKVIRGGPHD |
| Ga0187769_104097822 | 3300018086 | Tropical Peatland | MHGMASAAIMILVFAVIAAIACYVVIEVIRGGPHDG |
| Ga0197907_103770952 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | HGMLSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0197907_106436343 | 3300020069 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSAAVIILGYVAVAIAAGYAAIKVIRGGPHDG |
| Ga0206356_103548502 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0179590_11654662 | 3300020140 | Vadose Zone Soil | MHGTLSAAVIILAYAVVAIAAGYTAVKVIRGGPHGE |
| Ga0210395_100593354 | 3300020582 | Soil | VHGTLSAAIMILAYAVVAIAAGYAAVKAIRGGPHG |
| Ga0210395_102276532 | 3300020582 | Soil | MHGMLSATILIIAYAVVAIAVGYAAVKVIRGGPHDG |
| Ga0210395_102917442 | 3300020582 | Soil | MHGMVSAAVIILAYAVVAIAAGYAAVKVIRGGPHDG |
| Ga0210395_103229332 | 3300020582 | Soil | MHGTLSAAVIILAYAVVAIAAGYTAVKVIRGGPHD |
| Ga0210395_110209092 | 3300020582 | Soil | MHGMLSAAVIILAYAVVAIAAGYTAVKVIRGGPHGG |
| Ga0210395_110702462 | 3300020582 | Soil | MHGMLSATIIILAYVAVAVAAGYTAIKVIRGGPHDG |
| Ga0210401_103338883 | 3300020583 | Soil | MHGTLSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0210401_107333102 | 3300020583 | Soil | MHGMLSATIMIIAYAVVAIAAGYAAVKVIRGGPHDG |
| Ga0210400_109731341 | 3300021170 | Soil | MHGMLSAGVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0210396_100939513 | 3300021180 | Soil | VHGMLSAAIMILAYALVAIAAGYTAVKVMRGGPHDGQ |
| Ga0210396_102272971 | 3300021180 | Soil | MHGMFSATILVIAYAVVAIAVGYAAVKVIRGGPHDG |
| Ga0210396_116437152 | 3300021180 | Soil | MHGMLSATVIILAYAVVAIAAGYTAVKVIRGGPHD |
| Ga0210388_101021092 | 3300021181 | Soil | MHGMLSATVIILAYAVVAIAAGYTAVKVIRGGPHGG |
| Ga0213881_103473841 | 3300021374 | Exposed Rock | MHGMLSAAVMIFAYAVIAVVACYAVVKVISGGPHGG |
| Ga0210393_103150912 | 3300021401 | Soil | MHGMLSAAVIVLAYAVAAVAAGYTAVKVFRGGPHGG |
| Ga0210385_1000130913 | 3300021402 | Soil | VHGTLSAIIMILAYAVVAIAVGYAAVKVVRGGPHDG |
| Ga0210385_108140322 | 3300021402 | Soil | MHGMLSATVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0210385_108700802 | 3300021402 | Soil | RAMHGMLSATILIIAYAVVAIAVGYAAVKVIRGGPHDG |
| Ga0210385_108713281 | 3300021402 | Soil | PPMHGMLSATVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0210397_114741952 | 3300021403 | Soil | VASRLTDVHGMLSAAIMIGGYALVAIAAAYTAVKVIRGGPHDG |
| Ga0210389_100061767 | 3300021404 | Soil | VHGMLSAAIMIGGYALVAIVAAYTAVKVIRGGPHDG |
| Ga0210386_100551405 | 3300021406 | Soil | VHGMLSAAIMILAYALVAIAAGYTAVKVIRGGPHDNH |
| Ga0210386_101761923 | 3300021406 | Soil | MHGMLSATVIILAYVAVAIAAGYTAIKVIRGGPHDG |
| Ga0210386_107538112 | 3300021406 | Soil | MHGMLSAGVIILAYAVVAIAAGYTAVKVIRGGPHD |
| Ga0210386_111544972 | 3300021406 | Soil | MHGMLSAMVIILAYVAVAIAAGYTAIKVIKGGPHDG |
| Ga0210383_112527761 | 3300021407 | Soil | MHGMLSAAVIILAYAVVAIAAGYTAVKVIRRGPHGGS |
| Ga0210394_112952641 | 3300021420 | Soil | MHGMLSATIMIIADAVVAIAVGYAAVKVIRGGPHDG |
| Ga0210390_116362432 | 3300021474 | Soil | MHGMLSAMVIILAYVAVAIAAGYTAIKVIRGGPHDG |
| Ga0210409_101911582 | 3300021559 | Soil | MHGMLSAAVIVLAYVVAAVAAGYTAVKVFRGGPHDG |
| Ga0126371_100864123 | 3300021560 | Tropical Forest Soil | VHGTVSAVIMILAYAVVAIAAGYAAVKVIRGGPHDSR |
| Ga0126371_117259402 | 3300021560 | Tropical Forest Soil | VNGMLSAVIMILAYAVVAVAAGYVAVKVIRGGPHDG |
| Ga0126371_122095532 | 3300021560 | Tropical Forest Soil | AVHGMLSAVIMIGAYAVVAIAAGYAAVKVIRGGPHDRR |
| Ga0212123_100416094 | 3300022557 | Iron-Sulfur Acid Spring | MHGTLSAAVIILAYAVVAIAAGYTAVKVFRGGPHDG |
| Ga0179589_100102552 | 3300024288 | Vadose Zone Soil | MHGTLSAAVIILAYAVVAIAAGYAAVKVIRGGPHGE |
| Ga0207692_101971062 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MHGMLSAAVIILAFAVVAIAAGYTAVKVIRGGPHDG |
| Ga0207685_105662421 | 3300025905 | Corn, Switchgrass And Miscanthus Rhizosphere | TRLACVNGMLSAVIMILAYAVVAVAAGYAAVKVIRGGPHDG |
| Ga0207657_100329451 | 3300025919 | Corn Rhizosphere | DAAPRLHPMHGMLSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0207649_107512362 | 3300025920 | Corn Rhizosphere | APKLHPMHGMVSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0207700_105478581 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | GMHGMLSAAVIILAYAVFAAAAGYTAVKVFRGGPHDG |
| Ga0207664_116166812 | 3300025929 | Agricultural Soil | LHPMHGMLSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0209881_100011924 | 3300026273 | Soil | MHGILSAAIMILAYAVVAIAAGYAAVKVIRGGPHD |
| Ga0257160_10438672 | 3300026489 | Soil | MHGMLSATVIILAYAVVAIAAGYTAVKVIKGGPHDG |
| Ga0208731_10259851 | 3300027029 | Forest Soil | LACVNGMLSAVIMILAYAVVAVAAGYAAVKVIRGGPHDG |
| Ga0208236_10116692 | 3300027066 | Forest Soil | HRGLRSRAMHGMLSATILIIAYAVVAIAVGYAAVKVIRGGPHDG |
| Ga0209218_11212931 | 3300027505 | Forest Soil | SRAMHGMLSATILIIAYAVVAIAVGYAAVKVIRGGPHDG |
| Ga0208985_11150542 | 3300027528 | Forest Soil | MHGMLSAAVIVLAYAVVAVAAGYTAVKVFRGGPHDG |
| Ga0209333_10502721 | 3300027676 | Forest Soil | RTRLACVNGMLSAVIMILAYAVVAVVAGYTAVKVFRGGPHDG |
| Ga0209112_100992782 | 3300027817 | Forest Soil | MHGMLSAVLIVIAYAAVAIVGGYTAVKVIRGGPHDR |
| Ga0209166_102804343 | 3300027857 | Surface Soil | MHGMLSATILIIAYAVVAIAVAYAAVKVIRGGPHDG |
| Ga0209167_101768522 | 3300027867 | Surface Soil | MHGMLSAAVIILAYVVVAVAAGYTAVKVFRGGPHDG |
| Ga0209590_101691113 | 3300027882 | Vadose Zone Soil | MAMHGMLSAAVMIGAYALVAVAAAYTAVKVIRGGPHEP |
| Ga0209275_101660583 | 3300027884 | Soil | MHGMLSVAVFILAYVVVALAAGYTAVKVFRGGPHDG |
| Ga0209380_102567562 | 3300027889 | Soil | MHGMLSATIMILAYALVAIAAGYAAVKVIRGGPHDG |
| Ga0209006_101886842 | 3300027908 | Forest Soil | MHGMLSAAVIVLAYALVAVAAGYTAVKVFRGGPHGG |
| Ga0209006_102875973 | 3300027908 | Forest Soil | MHGMLSAAIIVLAYLALAVAAGYTAIKVIRGGPHDG |
| Ga0209006_104343403 | 3300027908 | Forest Soil | MHGMLSAAVIVLAYAVVALAAGYTAVKVFRGGPHDG |
| Ga0265337_100038723 | 3300028556 | Rhizosphere | MHGMLSAAVIILAYAVVAVAAGYTAVKVFRGGPHDG |
| Ga0302232_104062342 | 3300028789 | Palsa | MHGTLSAAIIMLAYIAIAVAAGYTAVKVFRGGPHGG |
| Ga0302232_106663802 | 3300028789 | Palsa | MHGMLSATIIIIAYAVVAIAVGYAAVKVIRGGPHDG |
| Ga0265338_100179954 | 3300028800 | Rhizosphere | MHGMLSAVILILAYAAVAVAAGYTAVKVIRGGPHDG |
| Ga0265338_100703072 | 3300028800 | Rhizosphere | MVPGMHGMLSAVILILAYAVVAVAAGYTAVKVIKGGPHDG |
| Ga0302235_100436722 | 3300028877 | Palsa | MHGMLSAAIMILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0311339_101744694 | 3300029999 | Palsa | MHGMLSATIMILAYAVVAVAAAYAAVKVFRGGPHDG |
| Ga0311339_117816902 | 3300029999 | Palsa | MHGMLSATIIIIAYAVVAIAVGYAAVKVIRGGPHD |
| Ga0311338_116280872 | 3300030007 | Palsa | HERLRSRAMHGMLSATIMILAYAVVAIAAGYAAVKVIRGGPHDG |
| Ga0302178_105411081 | 3300030013 | Palsa | MHGMLSATIMILAYAVVAIAAGYAAVKVIRGGPHD |
| Ga0302184_103547292 | 3300030490 | Palsa | MHGMLSAVVIVLAYVAVALAAGYTAVKVIRGGPHGG |
| Ga0311372_115640052 | 3300030520 | Palsa | MHGMLSAAIMILAYAVVAIAAGYAAVKVIRGGPHDG |
| Ga0265763_10003484 | 3300030763 | Soil | VNGMLSAVIMIIAYAVVAVAAGYAAVKVIRGGPHDG |
| Ga0170824_1113431141 | 3300031231 | Forest Soil | HGTLSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0302326_126636752 | 3300031525 | Palsa | MHGMLSAVIMVTAYAAVAVAAGYTAVKVIRGGPHDG |
| Ga0318516_100050775 | 3300031543 | Soil | VHGMLSAVIMILAYAVVAIAAGYAAVKVIRGGPHDSR |
| Ga0318534_108823122 | 3300031544 | Soil | VQGTVSAVIMILAYAVVAIAAGYAAVKVIRGGPHDSR |
| Ga0318573_100685641 | 3300031564 | Soil | SRAVHGMLSAVIMIGAYAVVAIAAGYAAIKVIRGGPHDSR |
| Ga0318515_105620012 | 3300031572 | Soil | GMLSAVIMILAYAVVAIAAGYAAVKVIRGGPHDSR |
| Ga0318574_100172232 | 3300031680 | Soil | VHGMMSAVIMILAYAVVAIAAGYAAVKVIRGGPHDSR |
| Ga0310686_1196379222 | 3300031708 | Soil | MHGTLSVAVIILAYAVVAIAAGYTAVKVIKGGPHDG |
| Ga0318496_105672311 | 3300031713 | Soil | SRTVQGTVSAVIMILAYAVVAIAAGYAAVKVIRGGPHDSR |
| Ga0318502_100120124 | 3300031747 | Soil | VHGMLSAVIMIGAYAVVAIAAGYAAIKVIRGGPHDSR |
| Ga0318554_105201472 | 3300031765 | Soil | LLAVHGMLSAMIMILAYAAVAIAAGFTAVKVIRGGPHDG |
| Ga0318508_11607192 | 3300031780 | Soil | SRAVHGMLSAVIMILAYAVVAIAAGYAAVKVIRGGPHDSR |
| Ga0318548_100700804 | 3300031793 | Soil | LGSRAVHGMLSAVIMIGAYAVVAIAAGYAAVKVIRGGPHDRR |
| Ga0307478_110293082 | 3300031823 | Hardwood Forest Soil | HRRLRSRAMHGMLSATILIIAYAVVAIAVGYAAVKVIRGGPHDG |
| Ga0310917_110922782 | 3300031833 | Soil | VHGMVSAVIMILAYAVVAIAAGYAVVKVIRGGPHDSR |
| Ga0318569_101151873 | 3300032010 | Soil | TVQGTVSAVIMILAYAVVAIAAGYAAVKVIRGGPHDSR |
| Ga0306920_1024697462 | 3300032261 | Soil | MHGMLSAAVIVLAYAVVAVAAGYTAVKVFRGGPHGG |
| Ga0348332_128513571 | 3300032515 | Plant Litter | HGMLSATIIILAYVAVAVAAGYTAIKVIRGGPHDG |
| Ga0335085_101412763 | 3300032770 | Soil | MHGMLSAAIIAAAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0335082_102402823 | 3300032782 | Soil | MHGMLSAAIIAAAYAVVAVAAGYTAVKVIRGGPHDG |
| Ga0335078_1000206315 | 3300032805 | Soil | MHGMLSATVIILAFAVAAVAAGYTAVKVFRGGPHDG |
| Ga0335069_106697853 | 3300032893 | Soil | MHGMLSAAILILGFAIVAIAAGYTAIKVIKGGPHDG |
| Ga0335074_100085182 | 3300032895 | Soil | VNGMLSAVIMILAFAAVAVAAGYVAVKVVRGGPHDG |
| Ga0335074_100186556 | 3300032895 | Soil | MHGMLSATILIIAYAVVAIAVGYTAVKVIRGGPHDG |
| Ga0335074_100499877 | 3300032895 | Soil | VHGMLSAVIMILAYAAVAVAAGYAAVKVIRGGPHG |
| Ga0335074_100839492 | 3300032895 | Soil | VNGMLSAAIMILAYAVVAIAAGYVAVKVIRGGPHGG |
| Ga0335074_101380342 | 3300032895 | Soil | VDGMLSAAIIILAYAVVAVVAGYVAVKVIRGGPHGG |
| Ga0335074_102974331 | 3300032895 | Soil | VNGMLSAAIMILAYAVVAVAAGYVAVKVIRGGPHGG |
| Ga0335074_103100272 | 3300032895 | Soil | MHGMLSAAIMILAYALVAVAAGYVAAKVIRGGPHDG |
| Ga0335075_10000072115 | 3300032896 | Soil | VHGMLSAAIMVVAYAVVAVVAAYTAVKVIRGGPHGG |
| Ga0335075_1000075353 | 3300032896 | Soil | MHGMLSAAIMILAYAVIAVAAGYAAVKVIRGGPHDG |
| Ga0335075_100050298 | 3300032896 | Soil | MHGMLSAVVIILGYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0335075_101512884 | 3300032896 | Soil | VDGMLSAVIMILAYAVVALAAGYAAVKVVRGGPHDG |
| Ga0335072_101918292 | 3300032898 | Soil | VNGMLSAVILILAYGAVAVAAGYVAVKVIRGGPHDG |
| Ga0335072_105822212 | 3300032898 | Soil | MHGMLSAAVIILGYAVVAVAAGYTAVKVFRGGPHDG |
| Ga0335083_111984761 | 3300032954 | Soil | SSAMHGMLSAAVIILAYAVVAIAAGYTAVKVIRGGPHDG |
| Ga0335073_100213557 | 3300033134 | Soil | MHGMLSAAMIILAYAVVAVAAGYTAVKVFRGGPHDG |
| Ga0310914_100741104 | 3300033289 | Soil | VHGMLSAVIMIGAYAVVAIAAGYAAVKVIRGGPHDSR |
| ⦗Top⦘ |