| Basic Information | |
|---|---|
| Family ID | F025708 |
| Family Type | Metagenome |
| Number of Sequences | 200 |
| Average Sequence Length | 37 residues |
| Representative Sequence | MDKGIGLWLNIGSLILVAALVIDFVWVIKTALNAH |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 87.50 % |
| % of genes near scaffold ends (potentially truncated) | 15.50 % |
| % of genes from short scaffolds (< 2000 bps) | 79.00 % |
| Associated GOLD sequencing projects | 130 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.55 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (98.000 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.500 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 50.79% β-sheet: 0.00% Coil/Unstructured: 49.21% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 32.00 |
| PF13561 | adh_short_C2 | 15.00 |
| PF13594 | Obsolete Pfam Family | 8.50 |
| PF01979 | Amidohydro_1 | 6.50 |
| PF01230 | HIT | 5.50 |
| PF00583 | Acetyltransf_1 | 3.00 |
| PF02812 | ELFV_dehydrog_N | 2.00 |
| PF13147 | Obsolete Pfam Family | 1.50 |
| PF00449 | Urease_alpha | 1.50 |
| PF05193 | Peptidase_M16_C | 1.50 |
| PF13365 | Trypsin_2 | 1.00 |
| PF13628 | DUF4142 | 1.00 |
| PF00857 | Isochorismatase | 0.50 |
| PF07969 | Amidohydro_3 | 0.50 |
| PF09844 | DUF2071 | 0.50 |
| PF01728 | FtsJ | 0.50 |
| PF00795 | CN_hydrolase | 0.50 |
| PF11969 | DcpS_C | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0334 | Glutamate dehydrogenase/leucine dehydrogenase | Amino acid transport and metabolism [E] | 2.00 |
| COG0804 | Urease alpha subunit | Amino acid transport and metabolism [E] | 1.50 |
| COG0293 | 23S rRNA U2552 (ribose-2'-O)-methylase RlmE/FtsJ | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1189 | Predicted rRNA methylase YqxC, contains S4 and FtsJ domains | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1335 | Nicotinamidase-related amidase | Coenzyme transport and metabolism [H] | 0.50 |
| COG1535 | Isochorismate hydrolase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 98.00 % |
| Unclassified | root | N/A | 2.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000033|ICChiseqgaiiDRAFT_c2043913 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300000033|ICChiseqgaiiDRAFT_c2229922 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 823 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_101914123 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1491 | Open in IMG/M |
| 3300000443|F12B_10698614 | All Organisms → cellular organisms → Bacteria | 783 | Open in IMG/M |
| 3300000559|F14TC_100179469 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 758 | Open in IMG/M |
| 3300000559|F14TC_102352531 | All Organisms → cellular organisms → Bacteria | 577 | Open in IMG/M |
| 3300001661|JGI12053J15887_10149781 | All Organisms → cellular organisms → Bacteria | 1226 | Open in IMG/M |
| 3300005332|Ga0066388_101493071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1181 | Open in IMG/M |
| 3300005332|Ga0066388_102081490 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
| 3300005356|Ga0070674_102150658 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300005540|Ga0066697_10105331 | All Organisms → cellular organisms → Bacteria | 1646 | Open in IMG/M |
| 3300005540|Ga0066697_10118946 | All Organisms → cellular organisms → Bacteria | 1548 | Open in IMG/M |
| 3300005540|Ga0066697_10120516 | All Organisms → cellular organisms → Bacteria | 1538 | Open in IMG/M |
| 3300005540|Ga0066697_10260058 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300005540|Ga0066697_10582266 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300005552|Ga0066701_10039941 | All Organisms → cellular organisms → Bacteria | 2510 | Open in IMG/M |
| 3300005552|Ga0066701_10083470 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300005552|Ga0066701_10517617 | All Organisms → cellular organisms → Bacteria | 737 | Open in IMG/M |
| 3300005553|Ga0066695_10022883 | All Organisms → cellular organisms → Bacteria | 3521 | Open in IMG/M |
| 3300005555|Ga0066692_10103674 | All Organisms → cellular organisms → Bacteria | 1690 | Open in IMG/M |
| 3300005555|Ga0066692_10538785 | All Organisms → cellular organisms → Bacteria | 740 | Open in IMG/M |
| 3300005555|Ga0066692_11014592 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005556|Ga0066707_10062322 | All Organisms → cellular organisms → Bacteria | 2199 | Open in IMG/M |
| 3300005557|Ga0066704_10801291 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 586 | Open in IMG/M |
| 3300005558|Ga0066698_10070541 | All Organisms → cellular organisms → Bacteria | 2253 | Open in IMG/M |
| 3300005558|Ga0066698_10122558 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300005713|Ga0066905_100043267 | All Organisms → cellular organisms → Bacteria | 2690 | Open in IMG/M |
| 3300005713|Ga0066905_100124457 | All Organisms → cellular organisms → Bacteria | 1806 | Open in IMG/M |
| 3300005713|Ga0066905_100184614 | Not Available | 1542 | Open in IMG/M |
| 3300005713|Ga0066905_100264900 | All Organisms → cellular organisms → Bacteria | 1329 | Open in IMG/M |
| 3300005713|Ga0066905_100619524 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 918 | Open in IMG/M |
| 3300005713|Ga0066905_100954768 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 753 | Open in IMG/M |
| 3300005713|Ga0066905_101191517 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005713|Ga0066905_102075162 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
| 3300005713|Ga0066905_102083653 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300005718|Ga0068866_11062001 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300005719|Ga0068861_101168360 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300005764|Ga0066903_100228369 | All Organisms → cellular organisms → Bacteria | 2834 | Open in IMG/M |
| 3300005764|Ga0066903_100242977 | All Organisms → cellular organisms → Bacteria | 2765 | Open in IMG/M |
| 3300005764|Ga0066903_100403176 | All Organisms → cellular organisms → Bacteria | 2251 | Open in IMG/M |
| 3300005764|Ga0066903_101233486 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
| 3300005764|Ga0066903_109094944 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300005843|Ga0068860_101438597 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300005937|Ga0081455_10689608 | All Organisms → cellular organisms → Bacteria | 652 | Open in IMG/M |
| 3300006034|Ga0066656_10000006 | All Organisms → cellular organisms → Bacteria | 55742 | Open in IMG/M |
| 3300006046|Ga0066652_100069691 | All Organisms → cellular organisms → Bacteria | 2733 | Open in IMG/M |
| 3300006755|Ga0079222_11956552 | All Organisms → cellular organisms → Bacteria | 574 | Open in IMG/M |
| 3300006844|Ga0075428_101581147 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 686 | Open in IMG/M |
| 3300006852|Ga0075433_10046972 | All Organisms → cellular organisms → Bacteria | 3755 | Open in IMG/M |
| 3300006854|Ga0075425_100654491 | All Organisms → cellular organisms → Bacteria | 1207 | Open in IMG/M |
| 3300006854|Ga0075425_101096835 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 906 | Open in IMG/M |
| 3300007255|Ga0099791_10009515 | All Organisms → cellular organisms → Bacteria | 4043 | Open in IMG/M |
| 3300007255|Ga0099791_10382773 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 676 | Open in IMG/M |
| 3300007258|Ga0099793_10145647 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300007258|Ga0099793_10562609 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300009012|Ga0066710_103418779 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
| 3300009038|Ga0099829_10700482 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 841 | Open in IMG/M |
| 3300009094|Ga0111539_10004379 | All Organisms → cellular organisms → Bacteria | 18476 | Open in IMG/M |
| 3300009137|Ga0066709_101068565 | All Organisms → cellular organisms → Bacteria | 1185 | Open in IMG/M |
| 3300009143|Ga0099792_10477246 | All Organisms → cellular organisms → Bacteria | 777 | Open in IMG/M |
| 3300009147|Ga0114129_11929065 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 716 | Open in IMG/M |
| 3300009157|Ga0105092_10485870 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 707 | Open in IMG/M |
| 3300009162|Ga0075423_10024351 | All Organisms → cellular organisms → Bacteria | 6044 | Open in IMG/M |
| 3300009162|Ga0075423_10694358 | All Organisms → cellular organisms → Bacteria | 1074 | Open in IMG/M |
| 3300009792|Ga0126374_11244068 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300009808|Ga0105071_1011994 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
| 3300009810|Ga0105088_1088939 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 561 | Open in IMG/M |
| 3300009812|Ga0105067_1003288 | All Organisms → cellular organisms → Bacteria | 1847 | Open in IMG/M |
| 3300009813|Ga0105057_1047514 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300009816|Ga0105076_1118284 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300009818|Ga0105072_1072231 | All Organisms → cellular organisms → Bacteria | 672 | Open in IMG/M |
| 3300009837|Ga0105058_1102313 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 673 | Open in IMG/M |
| 3300009837|Ga0105058_1160381 | All Organisms → cellular organisms → Bacteria | 550 | Open in IMG/M |
| 3300010043|Ga0126380_10324163 | All Organisms → cellular organisms → Bacteria | 1108 | Open in IMG/M |
| 3300010043|Ga0126380_10782401 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 778 | Open in IMG/M |
| 3300010047|Ga0126382_10184449 | All Organisms → cellular organisms → Bacteria | 1468 | Open in IMG/M |
| 3300010047|Ga0126382_10204842 | All Organisms → cellular organisms → Bacteria | 1407 | Open in IMG/M |
| 3300010304|Ga0134088_10279388 | All Organisms → cellular organisms → Bacteria | 805 | Open in IMG/M |
| 3300010329|Ga0134111_10520731 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 524 | Open in IMG/M |
| 3300010336|Ga0134071_10000266 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 16785 | Open in IMG/M |
| 3300010336|Ga0134071_10468469 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300010358|Ga0126370_10239414 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300010358|Ga0126370_12033150 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300010359|Ga0126376_10556548 | All Organisms → cellular organisms → Bacteria | 1075 | Open in IMG/M |
| 3300010359|Ga0126376_11842876 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300010359|Ga0126376_11914974 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 633 | Open in IMG/M |
| 3300010362|Ga0126377_10353529 | All Organisms → cellular organisms → Bacteria | 1467 | Open in IMG/M |
| 3300010397|Ga0134124_10028720 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4593 | Open in IMG/M |
| 3300010398|Ga0126383_10049496 | All Organisms → cellular organisms → Bacteria | 3489 | Open in IMG/M |
| 3300010400|Ga0134122_11057559 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 800 | Open in IMG/M |
| 3300011269|Ga0137392_10408970 | All Organisms → cellular organisms → Bacteria | 1126 | Open in IMG/M |
| 3300011271|Ga0137393_10732966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 846 | Open in IMG/M |
| 3300012096|Ga0137389_10309763 | All Organisms → cellular organisms → Bacteria | 1338 | Open in IMG/M |
| 3300012202|Ga0137363_11536507 | All Organisms → cellular organisms → Bacteria | 557 | Open in IMG/M |
| 3300012203|Ga0137399_10155466 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 1831 | Open in IMG/M |
| 3300012203|Ga0137399_10865800 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
| 3300012210|Ga0137378_11509896 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 583 | Open in IMG/M |
| 3300012355|Ga0137369_10421612 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 958 | Open in IMG/M |
| 3300012509|Ga0157334_1015028 | All Organisms → cellular organisms → Bacteria | 788 | Open in IMG/M |
| 3300012685|Ga0137397_10485957 | All Organisms → cellular organisms → Bacteria | 920 | Open in IMG/M |
| 3300012918|Ga0137396_10487284 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 914 | Open in IMG/M |
| 3300012922|Ga0137394_10401870 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1168 | Open in IMG/M |
| 3300012922|Ga0137394_10918286 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 730 | Open in IMG/M |
| 3300012925|Ga0137419_10679817 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 833 | Open in IMG/M |
| 3300012929|Ga0137404_10002474 | All Organisms → cellular organisms → Bacteria | 12220 | Open in IMG/M |
| 3300012930|Ga0137407_10286039 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1504 | Open in IMG/M |
| 3300012948|Ga0126375_10022499 | All Organisms → cellular organisms → Bacteria | 2970 | Open in IMG/M |
| 3300012971|Ga0126369_10264178 | All Organisms → cellular organisms → Bacteria | 1701 | Open in IMG/M |
| 3300012972|Ga0134077_10050818 | All Organisms → cellular organisms → Bacteria | 1529 | Open in IMG/M |
| 3300012972|Ga0134077_10143320 | All Organisms → cellular organisms → Bacteria | 950 | Open in IMG/M |
| 3300012975|Ga0134110_10576470 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300014326|Ga0157380_12343743 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300015053|Ga0137405_1284504 | All Organisms → cellular organisms → Bacteria | 1974 | Open in IMG/M |
| 3300015170|Ga0120098_1008389 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1083 | Open in IMG/M |
| 3300017656|Ga0134112_10083278 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1190 | Open in IMG/M |
| 3300017656|Ga0134112_10300445 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300017792|Ga0163161_11777493 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300017939|Ga0187775_10060805 | All Organisms → cellular organisms → Bacteria | 1181 | Open in IMG/M |
| 3300017997|Ga0184610_1099623 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 920 | Open in IMG/M |
| 3300018064|Ga0187773_10084573 | All Organisms → cellular organisms → Bacteria | 1533 | Open in IMG/M |
| 3300018075|Ga0184632_10069615 | All Organisms → cellular organisms → Bacteria | 1531 | Open in IMG/M |
| 3300018076|Ga0184609_10343331 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium CSP1-6 | 697 | Open in IMG/M |
| 3300018431|Ga0066655_10035448 | All Organisms → cellular organisms → Bacteria | 2470 | Open in IMG/M |
| 3300018431|Ga0066655_10202288 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
| 3300018433|Ga0066667_10117319 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300018433|Ga0066667_11317441 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300018468|Ga0066662_10145013 | All Organisms → cellular organisms → Bacteria | 1784 | Open in IMG/M |
| 3300018468|Ga0066662_10384314 | All Organisms → cellular organisms → Bacteria | 1225 | Open in IMG/M |
| 3300018468|Ga0066662_10556594 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1061 | Open in IMG/M |
| 3300018468|Ga0066662_10933289 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 855 | Open in IMG/M |
| 3300019789|Ga0137408_1081607 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300019789|Ga0137408_1122212 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300020170|Ga0179594_10030840 | Not Available | 1710 | Open in IMG/M |
| 3300020170|Ga0179594_10051869 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1386 | Open in IMG/M |
| 3300020170|Ga0179594_10072456 | All Organisms → cellular organisms → Bacteria | 1203 | Open in IMG/M |
| 3300021073|Ga0210378_10282416 | All Organisms → cellular organisms → Bacteria | 625 | Open in IMG/M |
| 3300021560|Ga0126371_12659163 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300025885|Ga0207653_10283960 | All Organisms → cellular organisms → Bacteria | 639 | Open in IMG/M |
| 3300026285|Ga0209438_1196554 | All Organisms → cellular organisms → Bacteria | 537 | Open in IMG/M |
| 3300026297|Ga0209237_1030369 | All Organisms → cellular organisms → Bacteria | 2957 | Open in IMG/M |
| 3300026309|Ga0209055_1005176 | All Organisms → cellular organisms → Bacteria | 7563 | Open in IMG/M |
| 3300026313|Ga0209761_1150349 | All Organisms → cellular organisms → Bacteria | 1098 | Open in IMG/M |
| 3300026328|Ga0209802_1027281 | All Organisms → cellular organisms → Bacteria | 3044 | Open in IMG/M |
| 3300026329|Ga0209375_1090529 | All Organisms → cellular organisms → Bacteria | 1395 | Open in IMG/M |
| 3300026333|Ga0209158_1007291 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5721 | Open in IMG/M |
| 3300026536|Ga0209058_1031466 | All Organisms → cellular organisms → Bacteria | 3268 | Open in IMG/M |
| 3300026537|Ga0209157_1336979 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 544 | Open in IMG/M |
| 3300026538|Ga0209056_10120615 | All Organisms → cellular organisms → Bacteria | 2083 | Open in IMG/M |
| 3300026540|Ga0209376_1018188 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4769 | Open in IMG/M |
| 3300027068|Ga0209898_1037023 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300027068|Ga0209898_1059376 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300027169|Ga0209897_1007751 | All Organisms → cellular organisms → Bacteria | 1415 | Open in IMG/M |
| 3300027187|Ga0209869_1006888 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300027324|Ga0209845_1010078 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1596 | Open in IMG/M |
| 3300027511|Ga0209843_1010478 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 1965 | Open in IMG/M |
| 3300027527|Ga0209684_1015104 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 1206 | Open in IMG/M |
| 3300027561|Ga0209887_1026372 | All Organisms → cellular organisms → Bacteria | 1360 | Open in IMG/M |
| 3300027646|Ga0209466_1021439 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1342 | Open in IMG/M |
| 3300027654|Ga0209799_1096246 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 671 | Open in IMG/M |
| 3300027655|Ga0209388_1061310 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300027873|Ga0209814_10003132 | All Organisms → cellular organisms → Bacteria | 6129 | Open in IMG/M |
| 3300027873|Ga0209814_10015286 | All Organisms → cellular organisms → Bacteria | 3068 | Open in IMG/M |
| 3300027874|Ga0209465_10041499 | All Organisms → cellular organisms → Bacteria | 2188 | Open in IMG/M |
| 3300027882|Ga0209590_10180983 | All Organisms → cellular organisms → Bacteria | 1324 | Open in IMG/M |
| 3300027903|Ga0209488_10099705 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes | 2176 | Open in IMG/M |
| 3300027907|Ga0207428_10000191 | All Organisms → cellular organisms → Bacteria | 85144 | Open in IMG/M |
| 3300027907|Ga0207428_10042583 | All Organisms → cellular organisms → Bacteria | 3671 | Open in IMG/M |
| 3300027909|Ga0209382_10908269 | All Organisms → cellular organisms → Bacteria | 926 | Open in IMG/M |
| 3300028536|Ga0137415_10005949 | All Organisms → cellular organisms → Bacteria | 12069 | Open in IMG/M |
| 3300028792|Ga0307504_10053537 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300028792|Ga0307504_10359345 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 563 | Open in IMG/M |
| (restricted) 3300031150|Ga0255311_1038549 | All Organisms → cellular organisms → Bacteria | 1001 | Open in IMG/M |
| (restricted) 3300031197|Ga0255310_10181406 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300031199|Ga0307495_10129760 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300031455|Ga0307505_10300327 | All Organisms → cellular organisms → Bacteria | 753 | Open in IMG/M |
| 3300031544|Ga0318534_10453321 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 735 | Open in IMG/M |
| 3300031545|Ga0318541_10274781 | All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium | 938 | Open in IMG/M |
| 3300031546|Ga0318538_10421887 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300031564|Ga0318573_10072485 | Not Available | 1724 | Open in IMG/M |
| 3300031681|Ga0318572_10455388 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300031720|Ga0307469_10011106 | All Organisms → cellular organisms → Bacteria | 4425 | Open in IMG/M |
| 3300031720|Ga0307469_10028199 | All Organisms → cellular organisms → Bacteria | 3207 | Open in IMG/M |
| 3300031720|Ga0307469_10144320 | All Organisms → cellular organisms → Bacteria | 1769 | Open in IMG/M |
| 3300031720|Ga0307469_10332943 | All Organisms → cellular organisms → Bacteria | 1266 | Open in IMG/M |
| 3300031720|Ga0307469_11846924 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300031740|Ga0307468_100134636 | All Organisms → cellular organisms → Bacteria | 1552 | Open in IMG/M |
| 3300031740|Ga0307468_100499469 | All Organisms → cellular organisms → Bacteria | 964 | Open in IMG/M |
| 3300031740|Ga0307468_100654377 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 869 | Open in IMG/M |
| 3300031740|Ga0307468_100868770 | All Organisms → cellular organisms → Bacteria | 778 | Open in IMG/M |
| 3300031740|Ga0307468_101896449 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031747|Ga0318502_10022979 | All Organisms → cellular organisms → Bacteria | 3050 | Open in IMG/M |
| 3300031779|Ga0318566_10011409 | All Organisms → cellular organisms → Bacteria | 3694 | Open in IMG/M |
| 3300031820|Ga0307473_10043994 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 2062 | Open in IMG/M |
| 3300031820|Ga0307473_10218129 | All Organisms → cellular organisms → Bacteria | 1146 | Open in IMG/M |
| 3300031879|Ga0306919_10043909 | All Organisms → cellular organisms → Bacteria | 2915 | Open in IMG/M |
| 3300031897|Ga0318520_10089798 | Not Available | 1705 | Open in IMG/M |
| 3300032180|Ga0307471_100058309 | All Organisms → cellular organisms → Bacteria | 3240 | Open in IMG/M |
| 3300032180|Ga0307471_102658518 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300032770|Ga0335085_10230692 | All Organisms → cellular organisms → Bacteria | 2241 | Open in IMG/M |
| 3300034178|Ga0364934_0110862 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 14.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 7.50% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 7.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 7.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 6.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 6.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 1.00% |
| Sandy Soil | Environmental → Terrestrial → Soil → Sand → Unclassified → Sandy Soil | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 0.50% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.50% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.50% |
| Fossill | Environmental → Terrestrial → Soil → Fossil → Unclassified → Fossill | 0.50% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.50% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000559 | Amended soil microbial communities from Kansas Great Prairies, USA - control no BrdU total DNA F1.4 TC clc assemly | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009157 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300009808 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_40_50 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300009812 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 | Environmental | Open in IMG/M |
| 3300009813 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 | Environmental | Open in IMG/M |
| 3300009816 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_0_10 | Environmental | Open in IMG/M |
| 3300009818 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 | Environmental | Open in IMG/M |
| 3300009837 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012509 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.8.old.080610_6 | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015170 | Fossil microbial communities from human bone sample from Teposcolula Yucundaa, Mexico - TP48 | Environmental | Open in IMG/M |
| 3300017656 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_11112015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017939 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MG | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018064 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MG | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
| 3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_b1 redo | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
| 3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
| 3300026537 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_134 (SPAdes) | Environmental | Open in IMG/M |
| 3300027068 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027169 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_10_20 (SPAdes) | Environmental | Open in IMG/M |
| 3300027187 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027324 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_50_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027561 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N1_30_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300027646 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 30 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027654 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300031150 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH4_T0_E4 | Environmental | Open in IMG/M |
| 3300031197 (restricted) | Sandy soil microbial communities from University of British Columbia, Vancouver, Canada - EtOH1_T0_E1 | Environmental | Open in IMG/M |
| 3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031545 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f26 | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
| 3300034178 | Sediment microbial communities from East River floodplain, Colorado, United States - 27_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiDRAFT_20439132 | 3300000033 | Soil | MDKGVGLWLNIGSLILVVALVIDFIWVISTALNTH* |
| ICChiseqgaiiDRAFT_22299222 | 3300000033 | Soil | MDDKGIGLWLNIGTLILVVALVIDFVWVIKTALSAAAH* |
| INPhiseqgaiiFebDRAFT_1019141232 | 3300000364 | Soil | MDDKGLGLWLNIGSLILIAALVVDFYVGINAALHAP* |
| F12B_106986142 | 3300000443 | Soil | MDEKGIGLWLNLGAIILVVALVIDFAWVISTALNAGGH* |
| F14TC_1001794692 | 3300000559 | Soil | MDQKRIGLWLNIGSVILVAALVIDFVWVIKTALNVH* |
| F14TC_1023525311 | 3300000559 | Soil | MDKGVGLWLNIGSLILIAALVVDFYVVINAALHAH* |
| JGI12053J15887_101497813 | 3300001661 | Forest Soil | MDDKGIALWLNIGTLILVAALVVDFAWVISTALNAH* |
| Ga0066388_1014930713 | 3300005332 | Tropical Forest Soil | PRRTTMDEKGIGLWLNLGSVILVVALVIDFVWVISTALNASGH* |
| Ga0066388_1020814901 | 3300005332 | Tropical Forest Soil | MDEKGIGLWLNLGSVILVVALVIDFVWVISTALNAAGTESRLRSL |
| Ga0070674_1021506581 | 3300005356 | Miscanthus Rhizosphere | RREPMDDKGLGLWLNIGSLILIAALVVDFYVVINAALHAH* |
| Ga0066697_101053313 | 3300005540 | Soil | MDKGIGLWLNIGTVILVAALIVDFVWVISTALNAH* |
| Ga0066697_101189462 | 3300005540 | Soil | MDKGVGLWLNIGTVILVAALIVDFVWVISTALNAH* |
| Ga0066697_101205162 | 3300005540 | Soil | MDKGIGLWLNIGSLILVAALVIDFVWVIKTALNAH* |
| Ga0066697_102600582 | 3300005540 | Soil | MNGNGVGLWLNIGSLILVAALVVDFIVVIRTALSVH* |
| Ga0066697_105822661 | 3300005540 | Soil | MDEKGIGLWLSVGSVILVAALVIDFAWVISTALSTH* |
| Ga0066701_100399412 | 3300005552 | Soil | MDEKGIGLWLNIGSLILIVALVIDFVWVIETALSAH* |
| Ga0066701_100834702 | 3300005552 | Soil | MDKGIGLWLNIGTVVLVAALIVDFVWVISTALNAH* |
| Ga0066701_105176172 | 3300005552 | Soil | MDENSIGLWLNIGSVILLAALVIDFVWVIKTAFSVH* |
| Ga0066695_100228832 | 3300005553 | Soil | MDEKGIGLWLSIGSVILVAALVIDFAWVISTALSTH* |
| Ga0066692_101036742 | 3300005555 | Soil | MDKGVGLWLNIGTVILVAALIVDFVWVISTAINAH* |
| Ga0066692_105387851 | 3300005555 | Soil | MNGNGVGLWLNIGSLVLVAALVVDFIVVIRTALSVH* |
| Ga0066692_110145922 | 3300005555 | Soil | MNGNGVGLWLNIGSLILVAALVIDFIVVIRTALSVH* |
| Ga0066707_100623224 | 3300005556 | Soil | MDEHGIGLWLNIGSVILVAALVIDFVWVIRTALSVH* |
| Ga0066704_108012911 | 3300005557 | Soil | SSRRTTMDEKGIGLWLSIGSVILVAALVIDFAWVISTALSTH* |
| Ga0066698_100705413 | 3300005558 | Soil | MDEKSIGLWLNIGSVILFAALVIDFVWVIKTAFSVH* |
| Ga0066698_101225582 | 3300005558 | Soil | MDEKVIGLWLSIGSVILVAALVIDFAWVISTALSTH* |
| Ga0066905_1000432674 | 3300005713 | Tropical Forest Soil | DEKSIGLWLNLGSVILVAALVIDFVWVISTALNASGH* |
| Ga0066905_1001244572 | 3300005713 | Tropical Forest Soil | MDEKSIGLWLNLGSVILVVALVIDFVWVISTALNASGH* |
| Ga0066905_1001846141 | 3300005713 | Tropical Forest Soil | ENSSRRTTMDEKGIGLWLNLGSVILVVALVIDFVWVISTALNASGH* |
| Ga0066905_1002649003 | 3300005713 | Tropical Forest Soil | MDEKSIGLWLNLGSIILVVALVIDFAWVISTAFSAA |
| Ga0066905_1006195241 | 3300005713 | Tropical Forest Soil | MDKGVGLGLNIGSLILVVALVIDFIVVIRTALSAAGH* |
| Ga0066905_1009547682 | 3300005713 | Tropical Forest Soil | RRTTMDEKSIGLWLNLGSIILVVALVIDFAWVISTAFSAAGH* |
| Ga0066905_1011915172 | 3300005713 | Tropical Forest Soil | MDKGIGLWLNIGSLILVAALVIDFIWVIKTALSAAAH* |
| Ga0066905_1020751622 | 3300005713 | Tropical Forest Soil | MDKGIGLWLNIGSLILVVALVIDFIWVIKTALSAAAH* |
| Ga0066905_1020836531 | 3300005713 | Tropical Forest Soil | MDKGIGLWLNIGSLILVAALVVDFIWVIKTALSAAAH* |
| Ga0068866_110620012 | 3300005718 | Miscanthus Rhizosphere | MDDKGLGLWLNIGSLILIAALVVDFYVVINAALHAH* |
| Ga0068861_1011683602 | 3300005719 | Switchgrass Rhizosphere | MDEKSIGLWLNLGSIILVVALVIDFAWVISTAFSAAGH* |
| Ga0066903_1002283693 | 3300005764 | Tropical Forest Soil | MDEKSIGLWLDLGSIILVVALVIDFAWVISTAFSASGH* |
| Ga0066903_1002429774 | 3300005764 | Tropical Forest Soil | MDEKGIGLWLNLGSVILVVALVIDFVWVISTALNASGH* |
| Ga0066903_1004031762 | 3300005764 | Tropical Forest Soil | MDKGVGLGLNIGSLILVVALVIDFIVVIKTALSVAAH* |
| Ga0066903_1012334862 | 3300005764 | Tropical Forest Soil | MDNKGPGLWLNIGSLILIAALVVDFYVVINAALHAAGE* |
| Ga0066903_1090949442 | 3300005764 | Tropical Forest Soil | MDKGVGLWLNIGSLILVVVLVIDFIVVIRNALSAAGH* |
| Ga0068860_1014385972 | 3300005843 | Switchgrass Rhizosphere | MDKGLGLWLNIGSLILIAALVVDFYVVINTALHASH* |
| Ga0081455_106896082 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MDKGVGLWLNIGTVILVAALVVDFIWVISTALSAH* |
| Ga0066656_1000000631 | 3300006034 | Soil | MDKRIGLWLNIGSAILIAALVIDFIWVITTAVGAAH* |
| Ga0066652_1000696911 | 3300006046 | Soil | MNGNGVGLWLYIGSLILVAALVVDFIVVIRTALSVH* |
| Ga0079222_119565522 | 3300006755 | Agricultural Soil | MDDKGPGLWLNIGSLILIAALVVDFYVVINAALHAAH* |
| Ga0075428_1015811472 | 3300006844 | Populus Rhizosphere | NSSRRTTMDEKGIGLWLNLGSVILVVALVIDFVWVISTALNASGH* |
| Ga0075433_100469722 | 3300006852 | Populus Rhizosphere | MDEKSIGLWLNLGSIILVVALAIDFAWVISTAFSAAGH* |
| Ga0075425_1006544912 | 3300006854 | Populus Rhizosphere | MDDKGVGLWLNIGSLILIAALVVDFYVVINTALHAAH* |
| Ga0075425_1010968351 | 3300006854 | Populus Rhizosphere | MDDKGLGLWLNVGSLILIAALVVDFYVVINAALHAAH* |
| Ga0099791_100095156 | 3300007255 | Vadose Zone Soil | MDEKGIGLWLNIGSVILLAALVIDFVWVIKTAFSVH* |
| Ga0099791_103827732 | 3300007255 | Vadose Zone Soil | MDKGIGLWLNIGSAILIAALVIDFVWVIKTALNTD* |
| Ga0099793_101456474 | 3300007258 | Vadose Zone Soil | MDDKGIALWLNIGSLILVAALVVDFAWVISTALNAH* |
| Ga0099793_105626092 | 3300007258 | Vadose Zone Soil | MNGNGVGLWLNIGSLVLVAALVVDFIVVIRAALSVH* |
| Ga0066710_1034187792 | 3300009012 | Grasslands Soil | MDEHGIGLWLNIGSVILVAALVIDFVWVVRTALSVH |
| Ga0099829_107004822 | 3300009038 | Vadose Zone Soil | MDEKSIGLWLNIGSVILLAALVIDFVWVIKTAFSVH* |
| Ga0111539_1000437915 | 3300009094 | Populus Rhizosphere | MDKGVGLWLNIGSLILVVALVIDFIWVISTALNAH* |
| Ga0066709_1010685651 | 3300009137 | Grasslands Soil | MDEQGIGLWLNIGSVILVAALVIDFVWVIRTALSVH* |
| Ga0099792_104772462 | 3300009143 | Vadose Zone Soil | MDDKGIGLWLNIGSVILVAALVIDFAWVITTALSAH* |
| Ga0114129_119290651 | 3300009147 | Populus Rhizosphere | MDKGVGLWLNIGSLILVVALVIDFIWVISTALSTH* |
| Ga0105092_104858701 | 3300009157 | Freshwater Sediment | MDDKGVGLGLNIGSLILVVARVIDFVWVIKTALSAAAH* |
| Ga0075423_100243512 | 3300009162 | Populus Rhizosphere | MDDKGLGLWLNIGSLILIAALVVDFYVVINTALHAH* |
| Ga0075423_106943582 | 3300009162 | Populus Rhizosphere | MDKGIGLWLNIGSLILIAALVIDFIWVIKTAFNTH* |
| Ga0126374_112440681 | 3300009792 | Tropical Forest Soil | MDKGVGLGLNIGSLILVVALVIDFIVVIKTALSAAAH* |
| Ga0105071_10119942 | 3300009808 | Groundwater Sand | MDEKGLGLWLNIGTVILIAALVVDFVWVIKTALSVH* |
| Ga0105088_10889391 | 3300009810 | Groundwater Sand | MDEKSIGLWLNIGSVVLLAALVIDFVWVIKTAFSVH* |
| Ga0105067_10032882 | 3300009812 | Groundwater Sand | MDEKGLGLWLNIGSVILIAALVIDFVWVIKTALSVH* |
| Ga0105057_10475142 | 3300009813 | Groundwater Sand | MDEKGLGLWLNIGSVILIAALVVDFVWVIKTALSVH* |
| Ga0105076_11182841 | 3300009816 | Groundwater Sand | MDEKGLGLWLNIGSVILIAALVIDFVWVIKTALSV |
| Ga0105072_10722312 | 3300009818 | Groundwater Sand | MDKKGLGLWLNIGSVILIAALVIDFVWVIKTALSVH* |
| Ga0105058_11023131 | 3300009837 | Groundwater Sand | MDKKGLGLWLNIGSVILIAALVIDFVCVIKTALSVH* |
| Ga0105058_11603812 | 3300009837 | Groundwater Sand | MLMDEESIGLWLNIGSVVLLAALVIDFVWVIKTAFSVH* |
| Ga0126380_103241632 | 3300010043 | Tropical Forest Soil | MDKGIGLWLNVGSLILVVALVIDFIWVIKTALSAAAH* |
| Ga0126380_107824012 | 3300010043 | Tropical Forest Soil | MDRGVGLWLNIGSLILVAALVVDFIWVIKTAFSAAAH* |
| Ga0126382_101844493 | 3300010047 | Tropical Forest Soil | MDKGIGLWLNIGSLILVAALVVDFIWVIKTAFSAAAH* |
| Ga0126382_102048422 | 3300010047 | Tropical Forest Soil | MDKGVGLWLNVGSLILVVALVIDFVVVIRTALNAAGH* |
| Ga0134088_102793882 | 3300010304 | Grasslands Soil | MNGNGVGLWLNIGSVILIAALVVDFIVVIKTAFSVH* |
| Ga0134111_105207311 | 3300010329 | Grasslands Soil | ENPSRRMPMDEKSIGLWLNIGSVIRCAALVIDFVWVIKTAFSVH* |
| Ga0134071_100002667 | 3300010336 | Grasslands Soil | MDKRIGLWLNIGSAILIAALVIDFIWVITTAVGAAL* |
| Ga0134071_104684691 | 3300010336 | Grasslands Soil | MDKGIGLWLNIGSLILIAALVIDFIWVIKTAFNAH* |
| Ga0126370_102394142 | 3300010358 | Tropical Forest Soil | MDKGVGLWLNIGSLILIAALVVDFYVVINAALHAAAD* |
| Ga0126370_120331502 | 3300010358 | Tropical Forest Soil | MDKGVGLGLNIGSLILVVVLVINFIVVIRAALSAAGH* |
| Ga0126376_105565482 | 3300010359 | Tropical Forest Soil | MDDKSIGLWLNLGSIILVVALVIDFAWVISTAFSAAGH* |
| Ga0126376_118428762 | 3300010359 | Tropical Forest Soil | MDDKGPGLWLNIGSLILIAALVVDFYVVLNAALHAAAH* |
| Ga0126376_119149741 | 3300010359 | Tropical Forest Soil | NSLRREPMDKGVGLWLNIGSLILVVVLVIDFIVVIRNALSAAGH* |
| Ga0126377_103535292 | 3300010362 | Tropical Forest Soil | MDKGVGVGLNIGSLILVVVLVIDFIVVIRAALSAAGH* |
| Ga0134124_100287208 | 3300010397 | Terrestrial Soil | MDDKGLGLWLNIGSLILIAALVVDFYVVINAALHAAH* |
| Ga0126383_100494962 | 3300010398 | Tropical Forest Soil | MDKGVGLWLNIGSLILVVALVIDFIVVIKTALSAAAH* |
| Ga0134122_110575591 | 3300010400 | Terrestrial Soil | MDKGLGLWLNIGSLILIAALVMDFYVVINTALHASH* |
| Ga0137392_104089702 | 3300011269 | Vadose Zone Soil | MLMDEKGIGLWLNIGSVILLAALVIDFVWVIKTAFSVH* |
| Ga0137393_107329662 | 3300011271 | Vadose Zone Soil | MLMDEKSIGLWLNIGSVILLAALVIDFVWVIKTAFSVH* |
| Ga0137389_103097632 | 3300012096 | Vadose Zone Soil | MDDKGIGLWLNIGSVILVAALVIDFAWVITTALNAH* |
| Ga0137363_115365071 | 3300012202 | Vadose Zone Soil | MDDKGIGLLLNIGTVILLAALVVDFAWVISTALNAH* |
| Ga0137399_101554662 | 3300012203 | Vadose Zone Soil | MNGNGVGLWLNIGSLILVAALVVDFIVVIRAALSVH* |
| Ga0137399_108658002 | 3300012203 | Vadose Zone Soil | MDEQGIGLWLNIGSVILVAALVIDFVWVIKTALSVH* |
| Ga0137378_115098961 | 3300012210 | Vadose Zone Soil | PMDDKGLGLWLNIGSLILIAALVVDFYVVINAALHAH* |
| Ga0137369_104216122 | 3300012355 | Vadose Zone Soil | MLMDDKGVGLWLNIGSVVLLAALVIDFVWVIKTAFSVH* |
| Ga0157334_10150282 | 3300012509 | Soil | MDEKSIGLWLNLGSIILVVTLVIDFAWVISTAFSAAGH* |
| Ga0137397_104859572 | 3300012685 | Vadose Zone Soil | MNGNGVGLWLNIGSLILVAALVVDFIVVIRAAFSVAH* |
| Ga0137396_104872843 | 3300012918 | Vadose Zone Soil | MNGNGVGLWLNIGSLILIAALVVDFIVVIKTALSVH* |
| Ga0137394_104018701 | 3300012922 | Vadose Zone Soil | EPMDKGIGLWLNIGSLILIAALVIDFIWVIKTAFNAH* |
| Ga0137394_109182862 | 3300012922 | Vadose Zone Soil | NEKVIGLWLSIGSVILVAALVIDFAWVISTALSTH* |
| Ga0137419_106798171 | 3300012925 | Vadose Zone Soil | MNGNGVGLWLNIGSLILIAALVVDFIVVIKAALSVH* |
| Ga0137404_100024746 | 3300012929 | Vadose Zone Soil | MDDKGIGLWLNIGTVILLAALVVDFAWVISTALNAH* |
| Ga0137407_102860394 | 3300012930 | Vadose Zone Soil | RMPMDEKSIGLWLNIGSVILLAALVIDFVWVIKTAFSVH* |
| Ga0126375_100224994 | 3300012948 | Tropical Forest Soil | MDKGVGLWLNIGSLILVVALVIDFVVVIRTALNAAGH* |
| Ga0126369_102641782 | 3300012971 | Tropical Forest Soil | MDNKGPGLWLNIGSLILIAALVVDFYVVINAALRAAGE* |
| Ga0134077_100508181 | 3300012972 | Grasslands Soil | MDENSIGLWLNIGSVILLAALVIDFVWVITTAFSVH* |
| Ga0134077_101433201 | 3300012972 | Grasslands Soil | MLMDEKSIGLWLNIGSVILLVALVIDFVWVIKTAFSVH* |
| Ga0134110_105764702 | 3300012975 | Grasslands Soil | MDKGVGLWLNIGTMILVAALIVDFVWVISTALNAH* |
| Ga0157380_123437432 | 3300014326 | Switchgrass Rhizosphere | MDDKGLGLWLNIGSLILIAALVVDFYVVINTALHASH* |
| Ga0137405_12845043 | 3300015053 | Vadose Zone Soil | MDGKGIGLWLNIGTVILIAALVIDFVWVIKTALSAH* |
| Ga0120098_10083891 | 3300015170 | Fossill | MDEKGLGLWLNIGSVILIAALVVDFVRVIKTALSVH* |
| Ga0134112_100832782 | 3300017656 | Grasslands Soil | MDEKVIGLWLSIGSVILVAALVIDFAWVISTALSTH |
| Ga0134112_103004451 | 3300017656 | Grasslands Soil | MDENSIGLWLNIGSVILLAALVIDFVWVIKTAFSVH |
| Ga0163161_117774932 | 3300017792 | Switchgrass Rhizosphere | MDEKSIGLCLNLGSIILVVALVIDFAWVISTAFSAAGH |
| Ga0187775_100608052 | 3300017939 | Tropical Peatland | MDKGLGLWLNIGSLILIAALVVDFCVVITTALHAAGD |
| Ga0184610_10996233 | 3300017997 | Groundwater Sediment | MDEKSIGLWLNIGSVILLAALVIDFVWVIKTAFSVH |
| Ga0187773_100845732 | 3300018064 | Tropical Peatland | MDDKGLGLWLNIGSLILIAALVVDFCVVITTALHAAGD |
| Ga0184632_100696152 | 3300018075 | Groundwater Sediment | MDEKSIGLWLNIGSVILLAALVIDFVWVITTAFSVH |
| Ga0184609_103433311 | 3300018076 | Groundwater Sediment | MDEKSIGLWLNIGSVILLAALVIDFVWVITTAFSVL |
| Ga0066655_100354482 | 3300018431 | Grasslands Soil | MDKRIGLWLNIGSAILIAALVIDFIWVITTAVGAAH |
| Ga0066655_102022882 | 3300018431 | Grasslands Soil | MNGNGVGLWLNIGSLILVAALVVDFIVVIRTALSVH |
| Ga0066667_101173193 | 3300018433 | Grasslands Soil | MDKGIGLWLNIGSLILVAALVIDFVWVIKTALNAH |
| Ga0066667_113174412 | 3300018433 | Grasslands Soil | MDKGIGLWLNIGTVILVAALIVDFVWVISTALNAH |
| Ga0066662_101450133 | 3300018468 | Grasslands Soil | MDEHGIGLWLNIGSVILVAALVIDFVWVIRTALSVH |
| Ga0066662_103843142 | 3300018468 | Grasslands Soil | MDKGVGLWLNIGTVILVAALIVDFVWVISTALNAH |
| Ga0066662_105565941 | 3300018468 | Grasslands Soil | MDEKGIGLWLNIGSLILIVALVIDFVWVIETALSAH |
| Ga0066662_109332892 | 3300018468 | Grasslands Soil | MDENSIGLWLNIGSVILLAALVIDFVWVITTAFSVH |
| Ga0137408_10816072 | 3300019789 | Vadose Zone Soil | MDDKGLGLWLNIGSLILIAALVVDFYVVINAALHAH |
| Ga0137408_11222121 | 3300019789 | Vadose Zone Soil | MDEKGIGLWLSIGSVILVAALVIDFAWVISTALSTH |
| Ga0179594_100308401 | 3300020170 | Vadose Zone Soil | TMDEKGIGLWLSIGSVILVAALVIDFAWVISTALSTH |
| Ga0179594_100518692 | 3300020170 | Vadose Zone Soil | MDDKGIGLWLNIGTVILLAALVVDFAWVISTALNAH |
| Ga0179594_100724561 | 3300020170 | Vadose Zone Soil | MDGKGIGLWLNIGTVILIAALVIDFVWVIKTALSAH |
| Ga0210378_102824161 | 3300021073 | Groundwater Sediment | AENPSRRMPMDEKSIGLWLNVGSVILLAALVIDFVWVITTAFSVH |
| Ga0126371_126591632 | 3300021560 | Tropical Forest Soil | MDNKGPGLWLNIGSLILIAALVVDFYVVINAALHAAGH |
| Ga0207653_102839602 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MDDKGLGLWLNIGSLILIAALVVDFYVVINTALHASH |
| Ga0209438_11965541 | 3300026285 | Grasslands Soil | MDGKGIGLWLNIGTEILIAALVIDFVWVIKTALSAH |
| Ga0209237_10303695 | 3300026297 | Grasslands Soil | MDEKGIGLWLNIGSVILLAALVIDFVWVIKTAFSVH |
| Ga0209055_10051766 | 3300026309 | Soil | MDKGIGLWLNIGTVVLVAALIVDFVWVISTALNAH |
| Ga0209761_11503493 | 3300026313 | Grasslands Soil | THTGRTPMNGNGVGLWLNIGSLVLVAALVVDFIVVIRAALSVH |
| Ga0209802_10272816 | 3300026328 | Soil | MDKGVGLWLNIGTVILVAALIVDFVWVISTAINAH |
| Ga0209375_10905292 | 3300026329 | Soil | MDEKGIGLWLSVGSVILVAALVIDFAWVISTALSTH |
| Ga0209158_10072917 | 3300026333 | Soil | PMNGNGVGLWLNIGSLILVAALVVDFIVVIRTALSVH |
| Ga0209058_10314665 | 3300026536 | Soil | MDEKSIGLWLNIGSVILFAALVIDFVWVIKTAFSVH |
| Ga0209157_13369792 | 3300026537 | Soil | MNGNGVGLWLNLGSVILIAALVVDFIVVIRTALSVH |
| Ga0209056_101206155 | 3300026538 | Soil | MDKGVGLWLNIGTVILVAALIVVFVWVISTALNAH |
| Ga0209376_10181884 | 3300026540 | Soil | MDKGVGLWLNISTVILVAALIVDFVWVISTALNAH |
| Ga0209898_10370232 | 3300027068 | Groundwater Sand | MDEKGLGLWLNIGSVILIAALVVDFVWVIKTALSVH |
| Ga0209898_10593761 | 3300027068 | Groundwater Sand | MDEKSIGLWLNIGSVVLLAALVIDFVWVIKTAFSVH |
| Ga0209897_10077512 | 3300027169 | Groundwater Sand | MDEKSIGLWLNIGSVVLLAALVIDFVWVIKTALSVH |
| Ga0209869_10068882 | 3300027187 | Groundwater Sand | MDEKSIGLWLNIGSVILLAALVIDFVWVIKTALSVH |
| Ga0209845_10100782 | 3300027324 | Groundwater Sand | MDEKGLGLWLNIGSVILIAALVIDFVWVIKTALSVH |
| Ga0209843_10104782 | 3300027511 | Groundwater Sand | MDEKGLGLWLNIGSVILIAALVIDFVWVIKTAFSVH |
| Ga0209684_10151041 | 3300027527 | Tropical Forest Soil | MDKGVGLWLNIGSLILVVVLVIDFIVVIRNALSAAGH |
| Ga0209887_10263722 | 3300027561 | Groundwater Sand | MDKKGLGLWLNIGSVILIAALVIDFVWVIKTALSVH |
| Ga0209466_10214391 | 3300027646 | Tropical Forest Soil | MDKGIGLWLNIGSLILVAALVVDFIWVIKTALSAAAH |
| Ga0209799_10962461 | 3300027654 | Tropical Forest Soil | MDKGIGLWLNIGSLILVVALVIDFIWVIKTALSAAAH |
| Ga0209388_10613102 | 3300027655 | Vadose Zone Soil | MDEKGIGLWLNIGSVILLAALVIDFVWVIKTALNTD |
| Ga0209814_100031326 | 3300027873 | Populus Rhizosphere | MDKGVGLWLNIGTVILVAALVVDFIWVISTALSAH |
| Ga0209814_100152862 | 3300027873 | Populus Rhizosphere | MDKGVGLWLNIGSLILVVALVIDFIWVISTALNTH |
| Ga0209465_100414992 | 3300027874 | Tropical Forest Soil | MDKGVGLGLNIGSLILVVALVIDFIVVIKTALSVAAH |
| Ga0209590_101809833 | 3300027882 | Vadose Zone Soil | SQLSVAGMELWLNVGSVILIAALVFDFAWVIVTALGTH |
| Ga0209488_100997052 | 3300027903 | Vadose Zone Soil | MDDKGIGLWLNIGSVILVAALVIDFAWVITTALNAH |
| Ga0207428_1000019174 | 3300027907 | Populus Rhizosphere | MDKGVGLWLNIGSLILVVALVIDFIWVISTALNAH |
| Ga0207428_100425835 | 3300027907 | Populus Rhizosphere | MDEKSIGLWLNLGSIILVVALVIDFAWVISTAFSAAGH |
| Ga0209382_109082692 | 3300027909 | Populus Rhizosphere | MDDKGIGLWLNIGTLILVVALVIDFVWVIKTALSAAAH |
| Ga0137415_1000594911 | 3300028536 | Vadose Zone Soil | MDDKGIALWLNIGSLILVAALVVDFAWVISTALNAH |
| Ga0307504_100535372 | 3300028792 | Soil | MDDKGIGLWLNIGSVILVAALVIDFAWVITTALIAH |
| Ga0307504_103593452 | 3300028792 | Soil | MNGNGVGFWLNIGSLILVAALVVDFIVVIRAAFSVAH |
| (restricted) Ga0255311_10385492 | 3300031150 | Sandy Soil | MDDKGIGLWLNIGSVILVAALVIDFAWVITTALSAH |
| (restricted) Ga0255310_101814061 | 3300031197 | Sandy Soil | MDDKGIGLWLNIGSVILVAALVIDFAWVITTALIA |
| Ga0307495_101297602 | 3300031199 | Soil | MNGNGVGLWLNIGSLILIAALVIDFIVVIKTALSVH |
| Ga0307505_103003272 | 3300031455 | Soil | MDDKGLGLWLNIGSLILIAALVVDFYVVINAALHAAH |
| Ga0318534_104533212 | 3300031544 | Soil | NKGPGLWLNIGSLILIAALVVDFSVVIRAALHAAGD |
| Ga0318541_102747811 | 3300031545 | Soil | KGPGLWLNIGSLILVAALVVDFYVVIRAALHAAGD |
| Ga0318538_104218872 | 3300031546 | Soil | MDNKGPGLWLNIGSLILVAALVVDFYVVIRAALHAAGD |
| Ga0318573_100724853 | 3300031564 | Soil | EPMDKGVGLWLNIGSLILVVVLVIDFIVVIRNALSAAGH |
| Ga0318572_104553882 | 3300031681 | Soil | MDDKGVGLWLNIGSLILIAALVVDFYVVINAALHAAGE |
| Ga0307469_100111065 | 3300031720 | Hardwood Forest Soil | MDEKGIGLWLNLGSIILVVALVIDFAWVISTALSASGH |
| Ga0307469_100281994 | 3300031720 | Hardwood Forest Soil | MDKGIALWLNIGSAILIAALVIDFVWVIKTALNTH |
| Ga0307469_101443202 | 3300031720 | Hardwood Forest Soil | MDKGIGLWLNIGSLILIAALVIDFIWVIKTAFNAH |
| Ga0307469_103329432 | 3300031720 | Hardwood Forest Soil | MDKGIGLWLNIGSVILIAALVIDFIWVIKTAFNAH |
| Ga0307469_118469241 | 3300031720 | Hardwood Forest Soil | MDNKGLGLWLNIGSLILIAALVVDFYVVINAALHAAH |
| Ga0307468_1001346362 | 3300031740 | Hardwood Forest Soil | MDDKGLGLWLNIGSLILIAALVVDFYVVFNAALHAH |
| Ga0307468_1004994692 | 3300031740 | Hardwood Forest Soil | MDEKGIGLWLNLGSIILVVALVIDFAWVISTALNAGGH |
| Ga0307468_1006543772 | 3300031740 | Hardwood Forest Soil | MDEKGIGLWLNLGSIILVVALVIDFVWVISTALNAGGH |
| Ga0307468_1008687702 | 3300031740 | Hardwood Forest Soil | MDEKGIGLWLNIGSVILVAALVIDFAWVISTAFSAH |
| Ga0307468_1018964491 | 3300031740 | Hardwood Forest Soil | MDDKGLGLWLNIGSLILIAALVVDFYVVINTALHAH |
| Ga0318502_100229791 | 3300031747 | Soil | REPMDKGVGLWLNIGSLILVVVLVIDFIVVIRNALSAAGH |
| Ga0318566_100114091 | 3300031779 | Soil | AESSLRREPMDKGVGLWLNIGSLILVVVLVIDFIVVIRNALSAAGH |
| Ga0307473_100439944 | 3300031820 | Hardwood Forest Soil | MDKGIGLWLNIGSLILVAALVIDFIWVIKTALSAAAH |
| Ga0307473_102181292 | 3300031820 | Hardwood Forest Soil | MDKGIGLWLNIGSLILIAALVLDFIWVIKTAFNAH |
| Ga0306919_100439091 | 3300031879 | Soil | GRAESSLRREPMDKGVGLWLNIGSLILVVVLVIDFIVVIRNALSAAGH |
| Ga0318520_100897981 | 3300031897 | Soil | LRRESMDKGVGLWLNIGSLILVVVLVIDFIVVIRNALSAAGH |
| Ga0307471_1000583095 | 3300032180 | Hardwood Forest Soil | MDKGIGLWLNIGSLILIAALVVDFIWVIKTAFSAAAH |
| Ga0307471_1026585182 | 3300032180 | Hardwood Forest Soil | MDEKGIGLWLNLGSVILVVALVIDFVWVISTALNASAH |
| Ga0335085_102306924 | 3300032770 | Soil | MDDKGLGLWLNIGSLILIAALVVDFYVVINTALHAAH |
| Ga0364934_0110862_780_890 | 3300034178 | Sediment | MDEKSNGLWLNIGSVILLAALVIDFVWVIKTAFSVH |
| ⦗Top⦘ |