| Basic Information | |
|---|---|
| Family ID | F025701 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 200 |
| Average Sequence Length | 47 residues |
| Representative Sequence | RLRSEHYGVPVVYLHSPYATSKTLGKWNPGSVMYDLFFDQLASGK |
| Number of Associated Samples | 160 |
| Number of Associated Scaffolds | 200 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.50 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 87.00 % |
| Associated GOLD sequencing projects | 151 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.23 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.500 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.500 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (41.500 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 26.03% β-sheet: 0.00% Coil/Unstructured: 73.97% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.23 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 200 Family Scaffolds |
|---|---|---|
| PF00528 | BPD_transp_1 | 55.50 |
| PF12911 | OppC_N | 3.50 |
| PF00005 | ABC_tran | 3.00 |
| PF00496 | SBP_bac_5 | 1.00 |
| PF08352 | oligo_HPY | 1.00 |
| PF03401 | TctC | 0.50 |
| PF07796 | DUF1638 | 0.50 |
| PF07690 | MFS_1 | 0.50 |
| PF00135 | COesterase | 0.50 |
| PF12695 | Abhydrolase_5 | 0.50 |
| PF00198 | 2-oxoacid_dh | 0.50 |
| PF01872 | RibD_C | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 200 Family Scaffolds |
|---|---|---|---|
| COG0262 | Dihydrofolate reductase | Coenzyme transport and metabolism [H] | 0.50 |
| COG0508 | Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component | Energy production and conversion [C] | 0.50 |
| COG1985 | Pyrimidine reductase, riboflavin biosynthesis | Coenzyme transport and metabolism [H] | 0.50 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 0.50 |
| COG3181 | Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctC | Energy production and conversion [C] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.50 % |
| Unclassified | root | N/A | 26.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104713825 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 565 | Open in IMG/M |
| 3300000443|F12B_10888777 | Not Available | 921 | Open in IMG/M |
| 3300000955|JGI1027J12803_104142806 | All Organisms → cellular organisms → Bacteria | 553 | Open in IMG/M |
| 3300002561|JGI25384J37096_10181201 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300002912|JGI25386J43895_10137439 | All Organisms → cellular organisms → Bacteria | 606 | Open in IMG/M |
| 3300003502|JGI26143J51219_1005172 | All Organisms → cellular organisms → Bacteria | 643 | Open in IMG/M |
| 3300004157|Ga0062590_100119997 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1722 | Open in IMG/M |
| 3300004643|Ga0062591_101756437 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300005174|Ga0066680_10363800 | Not Available | 921 | Open in IMG/M |
| 3300005174|Ga0066680_10679825 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005175|Ga0066673_10733139 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → unclassified Chloroflexia → Chloroflexia bacterium | 568 | Open in IMG/M |
| 3300005177|Ga0066690_10400536 | Not Available | 931 | Open in IMG/M |
| 3300005181|Ga0066678_11061407 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300005183|Ga0068993_10274586 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 603 | Open in IMG/M |
| 3300005184|Ga0066671_10679588 | All Organisms → cellular organisms → Bacteria | 667 | Open in IMG/M |
| 3300005328|Ga0070676_10057160 | All Organisms → cellular organisms → Bacteria | 2308 | Open in IMG/M |
| 3300005343|Ga0070687_100755095 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300005439|Ga0070711_101269825 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005440|Ga0070705_100182812 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1422 | Open in IMG/M |
| 3300005446|Ga0066686_10174256 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 1432 | Open in IMG/M |
| 3300005451|Ga0066681_10006465 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 5481 | Open in IMG/M |
| 3300005458|Ga0070681_10556202 | Not Available | 1061 | Open in IMG/M |
| 3300005458|Ga0070681_10980537 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300005468|Ga0070707_100477765 | All Organisms → cellular organisms → Bacteria | 1208 | Open in IMG/M |
| 3300005468|Ga0070707_101523548 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300005468|Ga0070707_101847563 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300005536|Ga0070697_100177551 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium | 1804 | Open in IMG/M |
| 3300005536|Ga0070697_100998779 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300005543|Ga0070672_100474982 | Not Available | 1079 | Open in IMG/M |
| 3300005549|Ga0070704_101105998 | All Organisms → cellular organisms → Bacteria | 720 | Open in IMG/M |
| 3300005553|Ga0066695_10005329 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 6158 | Open in IMG/M |
| 3300005569|Ga0066705_10447215 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 810 | Open in IMG/M |
| 3300005577|Ga0068857_102019355 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 565 | Open in IMG/M |
| 3300005713|Ga0066905_101700676 | Not Available | 580 | Open in IMG/M |
| 3300005718|Ga0068866_10497425 | Not Available | 806 | Open in IMG/M |
| 3300005718|Ga0068866_10770113 | All Organisms → cellular organisms → Bacteria | 666 | Open in IMG/M |
| 3300005764|Ga0066903_100958557 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1557 | Open in IMG/M |
| 3300005764|Ga0066903_101573574 | Not Available | 1245 | Open in IMG/M |
| 3300006034|Ga0066656_10054224 | All Organisms → cellular organisms → Bacteria | 2322 | Open in IMG/M |
| 3300006034|Ga0066656_10849575 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| 3300006791|Ga0066653_10222474 | Not Available | 960 | Open in IMG/M |
| 3300006845|Ga0075421_100102458 | All Organisms → cellular organisms → Bacteria | 3602 | Open in IMG/M |
| 3300006845|Ga0075421_101322959 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 797 | Open in IMG/M |
| 3300006845|Ga0075421_102290619 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300006845|Ga0075421_102757110 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 507 | Open in IMG/M |
| 3300006846|Ga0075430_101795738 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300006853|Ga0075420_100264795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1493 | Open in IMG/M |
| 3300006853|Ga0075420_100756655 | Not Available | 837 | Open in IMG/M |
| 3300006880|Ga0075429_100305193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1394 | Open in IMG/M |
| 3300006880|Ga0075429_101657636 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 556 | Open in IMG/M |
| 3300009012|Ga0066710_100711043 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1533 | Open in IMG/M |
| 3300009038|Ga0099829_10338401 | Not Available | 1238 | Open in IMG/M |
| 3300009092|Ga0105250_10397700 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 610 | Open in IMG/M |
| 3300009093|Ga0105240_12481946 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
| 3300009094|Ga0111539_13470935 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 506 | Open in IMG/M |
| 3300009100|Ga0075418_10934176 | Not Available | 938 | Open in IMG/M |
| 3300009137|Ga0066709_101773097 | All Organisms → cellular organisms → Bacteria | 869 | Open in IMG/M |
| 3300009147|Ga0114129_10262767 | All Organisms → cellular organisms → Bacteria | 2312 | Open in IMG/M |
| 3300009162|Ga0075423_11033856 | Not Available | 873 | Open in IMG/M |
| 3300009177|Ga0105248_10119620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2971 | Open in IMG/M |
| 3300009553|Ga0105249_10201336 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1949 | Open in IMG/M |
| 3300009553|Ga0105249_10383828 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1431 | Open in IMG/M |
| 3300009804|Ga0105063_1025959 | Not Available | 727 | Open in IMG/M |
| 3300009810|Ga0105088_1044021 | All Organisms → cellular organisms → Bacteria | 744 | Open in IMG/M |
| 3300010043|Ga0126380_10589648 | Not Available | 873 | Open in IMG/M |
| 3300010043|Ga0126380_12259960 | Not Available | 504 | Open in IMG/M |
| 3300010304|Ga0134088_10388744 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300010335|Ga0134063_10473432 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300010336|Ga0134071_10411831 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300010358|Ga0126370_10705417 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 887 | Open in IMG/M |
| 3300010358|Ga0126370_11186787 | All Organisms → cellular organisms → Bacteria | 709 | Open in IMG/M |
| 3300010358|Ga0126370_11667980 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 612 | Open in IMG/M |
| 3300010359|Ga0126376_11198801 | All Organisms → cellular organisms → Bacteria | 774 | Open in IMG/M |
| 3300010361|Ga0126378_12448329 | Not Available | 596 | Open in IMG/M |
| 3300010366|Ga0126379_11908908 | All Organisms → cellular organisms → Bacteria | 697 | Open in IMG/M |
| 3300010401|Ga0134121_10080412 | All Organisms → cellular organisms → Bacteria | 2709 | Open in IMG/M |
| 3300011271|Ga0137393_10094080 | All Organisms → cellular organisms → Bacteria | 2434 | Open in IMG/M |
| 3300011271|Ga0137393_10595056 | Not Available | 949 | Open in IMG/M |
| 3300012198|Ga0137364_10902550 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 669 | Open in IMG/M |
| 3300012204|Ga0137374_10346132 | Not Available | 1200 | Open in IMG/M |
| 3300012205|Ga0137362_10048383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3454 | Open in IMG/M |
| 3300012207|Ga0137381_10109754 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2347 | Open in IMG/M |
| 3300012207|Ga0137381_10562153 | Not Available | 994 | Open in IMG/M |
| 3300012209|Ga0137379_10316059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1473 | Open in IMG/M |
| 3300012211|Ga0137377_11737192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
| 3300012349|Ga0137387_11171934 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300012350|Ga0137372_10059251 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3342 | Open in IMG/M |
| 3300012351|Ga0137386_10077980 | All Organisms → cellular organisms → Bacteria | 2319 | Open in IMG/M |
| 3300012355|Ga0137369_10047572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 3777 | Open in IMG/M |
| 3300012356|Ga0137371_10962122 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300012358|Ga0137368_10924504 | All Organisms → cellular organisms → Bacteria | 529 | Open in IMG/M |
| 3300012360|Ga0137375_10137738 | All Organisms → cellular organisms → Bacteria | 2406 | Open in IMG/M |
| 3300012360|Ga0137375_10140497 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2376 | Open in IMG/M |
| 3300012361|Ga0137360_10272404 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1398 | Open in IMG/M |
| 3300012362|Ga0137361_10751085 | Not Available | 889 | Open in IMG/M |
| 3300012519|Ga0157352_1098337 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 516 | Open in IMG/M |
| 3300012582|Ga0137358_10324198 | Not Available | 1045 | Open in IMG/M |
| 3300012582|Ga0137358_10789301 | All Organisms → cellular organisms → Bacteria | 631 | Open in IMG/M |
| 3300012685|Ga0137397_10260246 | Not Available | 1293 | Open in IMG/M |
| 3300012912|Ga0157306_10301640 | Not Available | 588 | Open in IMG/M |
| 3300012922|Ga0137394_10026833 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 4655 | Open in IMG/M |
| 3300012922|Ga0137394_10361889 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1238 | Open in IMG/M |
| 3300012929|Ga0137404_10544022 | Not Available | 1040 | Open in IMG/M |
| 3300012944|Ga0137410_11285606 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300012971|Ga0126369_11574384 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300012971|Ga0126369_11896710 | Not Available | 684 | Open in IMG/M |
| 3300012971|Ga0126369_12086299 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 655 | Open in IMG/M |
| 3300012972|Ga0134077_10367757 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
| 3300012972|Ga0134077_10386372 | All Organisms → cellular organisms → Bacteria | 602 | Open in IMG/M |
| 3300012975|Ga0134110_10024576 | All Organisms → cellular organisms → Bacteria | 2338 | Open in IMG/M |
| 3300012984|Ga0164309_10720019 | All Organisms → cellular organisms → Bacteria | 794 | Open in IMG/M |
| 3300013297|Ga0157378_12782372 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300014299|Ga0075303_1134428 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300014877|Ga0180074_1016254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1414 | Open in IMG/M |
| 3300015358|Ga0134089_10391498 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
| 3300015371|Ga0132258_12720648 | Not Available | 1234 | Open in IMG/M |
| 3300018028|Ga0184608_10468175 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 541 | Open in IMG/M |
| 3300018056|Ga0184623_10218213 | Not Available | 875 | Open in IMG/M |
| 3300018076|Ga0184609_10177746 | Not Available | 987 | Open in IMG/M |
| 3300018084|Ga0184629_10257446 | Not Available | 913 | Open in IMG/M |
| 3300018422|Ga0190265_10176367 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
| 3300019212|Ga0180106_1294022 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 612 | Open in IMG/M |
| 3300019377|Ga0190264_11157844 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
| 3300019377|Ga0190264_11613496 | All Organisms → cellular organisms → Bacteria | 572 | Open in IMG/M |
| 3300019883|Ga0193725_1007952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3030 | Open in IMG/M |
| 3300020170|Ga0179594_10048724 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1423 | Open in IMG/M |
| 3300020215|Ga0196963_10223067 | All Organisms → cellular organisms → Bacteria | 819 | Open in IMG/M |
| 3300021078|Ga0210381_10004172 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales | 3110 | Open in IMG/M |
| 3300022756|Ga0222622_10491869 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300025910|Ga0207684_10456789 | Not Available | 1096 | Open in IMG/M |
| 3300025910|Ga0207684_10782600 | Not Available | 807 | Open in IMG/M |
| 3300025916|Ga0207663_10784588 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300025940|Ga0207691_10449362 | Not Available | 1097 | Open in IMG/M |
| 3300026035|Ga0207703_10725356 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 946 | Open in IMG/M |
| 3300026075|Ga0207708_11507545 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 591 | Open in IMG/M |
| 3300026116|Ga0207674_10306844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1536 | Open in IMG/M |
| 3300026298|Ga0209236_1107578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1246 | Open in IMG/M |
| 3300026300|Ga0209027_1163354 | Not Available | 745 | Open in IMG/M |
| 3300026324|Ga0209470_1097667 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1323 | Open in IMG/M |
| 3300026324|Ga0209470_1296340 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 603 | Open in IMG/M |
| 3300026333|Ga0209158_1082262 | Not Available | 1253 | Open in IMG/M |
| 3300026334|Ga0209377_1093826 | Not Available | 1257 | Open in IMG/M |
| 3300026335|Ga0209804_1139742 | Not Available | 1090 | Open in IMG/M |
| 3300026343|Ga0209159_1223776 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300026377|Ga0257171_1002021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2902 | Open in IMG/M |
| 3300026527|Ga0209059_1031016 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2417 | Open in IMG/M |
| 3300026528|Ga0209378_1038831 | All Organisms → cellular organisms → Bacteria | 2422 | Open in IMG/M |
| 3300026530|Ga0209807_1229027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 633 | Open in IMG/M |
| 3300026538|Ga0209056_10421164 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300027643|Ga0209076_1028883 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1538 | Open in IMG/M |
| 3300027787|Ga0209074_10003433 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3463 | Open in IMG/M |
| 3300027882|Ga0209590_10851320 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
| 3300027894|Ga0209068_10026715 | All Organisms → cellular organisms → Bacteria | 2837 | Open in IMG/M |
| 3300027907|Ga0207428_10686106 | All Organisms → cellular organisms → Bacteria | 733 | Open in IMG/M |
| 3300027909|Ga0209382_10272363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → unclassified Rhodospirillales → Rhodospirillales bacterium URHD0017 | 1916 | Open in IMG/M |
| 3300027909|Ga0209382_12170966 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 526 | Open in IMG/M |
| 3300028380|Ga0268265_11713504 | Not Available | 634 | Open in IMG/M |
| 3300028380|Ga0268265_11963775 | Not Available | 592 | Open in IMG/M |
| 3300028589|Ga0247818_11233149 | All Organisms → cellular organisms → Bacteria | 535 | Open in IMG/M |
| 3300028592|Ga0247822_11292962 | All Organisms → cellular organisms → Bacteria | 611 | Open in IMG/M |
| 3300028608|Ga0247819_10645110 | All Organisms → cellular organisms → Bacteria | 642 | Open in IMG/M |
| 3300028715|Ga0307313_10034307 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1445 | Open in IMG/M |
| 3300028792|Ga0307504_10034508 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1362 | Open in IMG/M |
| 3300028792|Ga0307504_10196048 | All Organisms → cellular organisms → Bacteria | 713 | Open in IMG/M |
| 3300028792|Ga0307504_10299638 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300028803|Ga0307281_10322707 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria | 580 | Open in IMG/M |
| 3300028803|Ga0307281_10337058 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300028807|Ga0307305_10336342 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300028811|Ga0307292_10319127 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300028885|Ga0307304_10189454 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300031170|Ga0307498_10336770 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300031455|Ga0307505_10579730 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300031562|Ga0310886_10223556 | Not Available | 1040 | Open in IMG/M |
| 3300031720|Ga0307469_10425185 | Not Available | 1142 | Open in IMG/M |
| 3300031720|Ga0307469_10641252 | Not Available | 955 | Open in IMG/M |
| 3300031720|Ga0307469_11632394 | Not Available | 620 | Open in IMG/M |
| 3300031720|Ga0307469_12283718 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300031740|Ga0307468_100606463 | Not Available | 895 | Open in IMG/M |
| 3300031740|Ga0307468_100973295 | All Organisms → cellular organisms → Bacteria | 743 | Open in IMG/M |
| 3300031740|Ga0307468_101219103 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300031740|Ga0307468_101369748 | Not Available | 648 | Open in IMG/M |
| 3300031740|Ga0307468_102024495 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300031747|Ga0318502_10087250 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1710 | Open in IMG/M |
| 3300031820|Ga0307473_10291674 | Not Available | 1022 | Open in IMG/M |
| 3300031821|Ga0318567_10210151 | Not Available | 1088 | Open in IMG/M |
| 3300031847|Ga0310907_10426635 | Not Available | 696 | Open in IMG/M |
| 3300031860|Ga0318495_10396202 | All Organisms → cellular organisms → Bacteria | 609 | Open in IMG/M |
| 3300031890|Ga0306925_10721836 | Not Available | 1041 | Open in IMG/M |
| 3300031903|Ga0307407_10432550 | All Organisms → cellular organisms → Bacteria | 951 | Open in IMG/M |
| 3300031910|Ga0306923_12026428 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 583 | Open in IMG/M |
| 3300031949|Ga0214473_11815011 | Not Available | 602 | Open in IMG/M |
| 3300032001|Ga0306922_10458236 | Not Available | 1362 | Open in IMG/M |
| 3300032012|Ga0310902_11134547 | All Organisms → cellular organisms → Bacteria | 548 | Open in IMG/M |
| 3300032066|Ga0318514_10266474 | Not Available | 903 | Open in IMG/M |
| 3300032076|Ga0306924_12629340 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300032180|Ga0307471_101411949 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium | 856 | Open in IMG/M |
| 3300033432|Ga0326729_1014431 | Not Available | 1340 | Open in IMG/M |
| 3300033550|Ga0247829_11555549 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300034354|Ga0364943_0327474 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300034818|Ga0373950_0099423 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 12.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.50% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.50% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 5.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 3.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.50% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.50% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.00% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.50% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.50% |
| Unplanted Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Unplanted Soil | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.50% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Sand → Desert → Soil | 0.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.50% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.50% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000443 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.2B clc assemly | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300002561 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm | Environmental | Open in IMG/M |
| 3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
| 3300003502 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM | Host-Associated | Open in IMG/M |
| 3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005183 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqC_D1 | Environmental | Open in IMG/M |
| 3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
| 3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009804 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 | Environmental | Open in IMG/M |
| 3300009810 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_20_30 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012204 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012350 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012358 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012360 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_113_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012519 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.7.yng.070610 | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012972 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014877 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT366_16_10D | Environmental | Open in IMG/M |
| 3300015358 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
| 3300018084 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300019212 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLIBT25_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
| 3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
| 3300020170 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020215 | Soil microbial communities from Anza Borrego desert, Southern California, United States - S1_5 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026324 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026334 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
| 3300026377 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-B | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
| 3300026530 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028589 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day1 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028608 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Xylose_Day6 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
| 3300028803 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120 | Environmental | Open in IMG/M |
| 3300028807 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_186 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028885 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_185 | Environmental | Open in IMG/M |
| 3300031170 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_S | Environmental | Open in IMG/M |
| 3300031455 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 23_S | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Host-Associated | Open in IMG/M |
| 3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032012 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D3 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033432 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF6AY SIP fraction | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1047138251 | 3300000364 | Soil | DKEKINALMRGVYARLRSEHLGVPVVYLHSPYATSKTLGSWNVGNVMYDLFFDVLASGK* |
| F12B_108887772 | 3300000443 | Soil | TDKEKIGALMRNVYTRLRSESYGVPVVYLHSPYATSKTLGKWNPGSVMYDFFIDELASSKR* |
| JGI1027J12803_1041428062 | 3300000955 | Soil | VVYLHSAYATSKTLGKWNPGTVMYDLFFDQLASSK* |
| JGI25384J37096_101812011 | 3300002561 | Grasslands Soil | YGVPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR* |
| JGI25386J43895_101374392 | 3300002912 | Grasslands Soil | RNIFTRLRSEHHGVPVVYVHSPYATAKTLGKWNPGAVMYDLFLDELARK* |
| JGI26143J51219_10051721 | 3300003502 | Arabidopsis Thaliana Rhizosphere | SEHHGVPVVYLHSPYATSKTLGNWNPGSVMYDLFLDVLASGK* |
| Ga0062590_1001199973 | 3300004157 | Soil | RSEHYGVPVVYLHSPYATSKSLGKWNVGSVMYDLFFDVLASGK* |
| Ga0062591_1017564371 | 3300004643 | Soil | KINTLMRNSFLRIRSEHLGMPIVYLHSPYATSKKLGKWNPGSVMYDLFFDELASGK* |
| Ga0066680_103638001 | 3300005174 | Soil | LMRNVYTRLRSEHYGVPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR* |
| Ga0066680_106798252 | 3300005174 | Soil | QTDREKINALMRNIFTRLRSEHHGVPVVYVHSPYATAKTLGKWNPGAVMYDLFLDELARK |
| Ga0066673_107331391 | 3300005175 | Soil | EKINALMRNIFTRLRSEHHGLPVVYVHSPYATSKTLGKYNPGTVMYDLFIDELARR* |
| Ga0066690_104005362 | 3300005177 | Soil | RLRSEHHGVPVVFVHSPYAASKTLGKWNPGSVMYDLFLDELARK* |
| Ga0066678_110614071 | 3300005181 | Soil | KEKIATLMRNVYTRLRSEHYGVPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR* |
| Ga0068993_102745862 | 3300005183 | Natural And Restored Wetlands | REKINTLLRNVYTRIRSEHAGVPVVYLHSAYATSKTLGKWNAGSVMYDLFFDQLAASK* |
| Ga0066671_106795882 | 3300005184 | Soil | QTDQQKINALMRNIFTRMRSEHYGFPVAYIHSPYASSKALAGWNPGTVMYDFSFDELAATK* |
| Ga0070676_100571604 | 3300005328 | Miscanthus Rhizosphere | NVYTRLRSEHLGVPVVYLHSPYATSKTLAKWNVGSVMYDLFFDQLASGK* |
| Ga0070687_1007550951 | 3300005343 | Switchgrass Rhizosphere | KAGALMRNIYLRIRSEHLGVPVVYLHSAYATSKTLPKWTVGTVMYDLFIDQLAASK* |
| Ga0070711_1012698252 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | NTLMRNIYTRIRSEHAGMPIVYLHSAYATGKKLGKWNTGSVMYDLFFDELASGK* |
| Ga0070705_1001828121 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | RLRSEHHGVPVVFVHSPYAASKTLGKWNPGSVMYDLFLDELARR* |
| Ga0066686_101742563 | 3300005446 | Soil | SEHHGVPVVYVHSPYATSKTLGKYNPGTVMYDLFIDELARR* |
| Ga0066681_100064657 | 3300005451 | Soil | RSEHHGVPVVYVHSPYATSKTLGKYNPGAVMYDLFIDELARK* |
| Ga0070681_105562022 | 3300005458 | Corn Rhizosphere | TDKDKINALMRNIFARLRSEHSGVPLVYLHSPYATSKTLGKWNVGTVMYDLFIDQLASGK |
| Ga0070681_109805372 | 3300005458 | Corn Rhizosphere | SEHVGVPVVYLHSPYATAKTLGKWTPGTVMYDLFLEQLAAGK* |
| Ga0070707_1004777651 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | IRSEHYGVPVVYLHSAYATSKTLGKWNPGTVMYDLFIDHLAAGK* |
| Ga0070707_1015235481 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | LRSEHSGIPVVYLHSPYATSKTLGRWNVGTVMYDLFIDQLAAGK* |
| Ga0070707_1018475631 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | RSEHLGMPIVYLHSAYATGKKLGKWNTGTVMYDLFFDELASSK* |
| Ga0070697_1001775511 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | INTLMRNIYTRIRSEHLGMPIVYLHSAYATGKKLGKWNTGTVMYDLFFDELASSK* |
| Ga0070697_1009987792 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | RSEHYGVPVVYLHSPYATSKSLGKWNPGSVMYDLFFDQLASGK* |
| Ga0070672_1004749822 | 3300005543 | Miscanthus Rhizosphere | HVGVPVVYLHSPYATAKTLGKWTPGTVMYDLFLEQLAAGK* |
| Ga0070704_1011059981 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | LMRNVYTRLRSEHYGLPVVYLHSPYAASKTLGKWNPGTVMYDFFIDELASSKR* |
| Ga0066695_100053291 | 3300005553 | Soil | GVPVVYLHSPYAASKTLGKWNPGSVMYDLFFDELASGKK* |
| Ga0066705_104472151 | 3300005569 | Soil | EKINALMRNIYTRLRSEHHGLPVVYVHSPYAAAKTLGKWNPGTVMYDFFLDELASSKR* |
| Ga0068857_1020193552 | 3300005577 | Corn Rhizosphere | YGVPVVYLHSPYATSKSLGKWNVGSVMYDLFFDVLASGK* |
| Ga0066905_1017006762 | 3300005713 | Tropical Forest Soil | RNVYTRLRSEHYGVPVVYLHSPYAASKTLGKWNPGSVMYDFFLDELASSKR* |
| Ga0068866_104974251 | 3300005718 | Miscanthus Rhizosphere | MRNVYTRLRSEHLGVPVVYLHSPYATSKTLAKWNVGSVMYDLFFDQLASGK* |
| Ga0068866_107701131 | 3300005718 | Miscanthus Rhizosphere | HAGMPIVYLHSAYATGKKLGKWNTGSVMYDLFFDELASGK* |
| Ga0066903_1009585573 | 3300005764 | Tropical Forest Soil | YTRLRTESYGVPVVYLHSPYATSKTLGKWNPGSVMYDFFIDELASSKR* |
| Ga0066903_1015735741 | 3300005764 | Tropical Forest Soil | EKINALMRNIYTRLRSEHHGVPVVYVHSPYAAAKTLGKWNPGTVMYDLFLDELARK* |
| Ga0066656_100542244 | 3300006034 | Soil | MRNIYTRMRSEHHGVPVVYVHSPYATSKTLGKYNPGAVMYDLFIDELARK* |
| Ga0066656_108495752 | 3300006034 | Soil | HGLPVVYVHSPYAAAKTLGKWNPGTVMYDLFLDELARR* |
| Ga0066653_102224742 | 3300006791 | Soil | SEHHGLPVVYVHSPYAAAKTLGKWNPGTVKYDLFLDELARR* |
| Ga0075421_1001024581 | 3300006845 | Populus Rhizosphere | LRSEHYGVPVVYLHSPYAASKSLGKWNPGTVMYDFFLDELASSKR* |
| Ga0075421_1013229591 | 3300006845 | Populus Rhizosphere | MRNIFTRLRSEHLGYPVAYIHSPYASSKALASWNPGTVMYDFFFDELASSK* |
| Ga0075421_1022906191 | 3300006845 | Populus Rhizosphere | QTDREKINALMRNVFLRLRSEHYAVPVVYLHTPYAAAKTLGKWNPGTVMYDLFLDQLASSKP* |
| Ga0075421_1027571101 | 3300006845 | Populus Rhizosphere | NTLMRNIFTRLRSEHSGVPVVYVHSPYAASKTLGKWNPGSVMYDLFLDNLAASK* |
| Ga0075430_1017957381 | 3300006846 | Populus Rhizosphere | KINALMRNIFTRLRSEHYGVPVVNIHSPYATSKTLGKWNPGTVMYDLFIDELARK* |
| Ga0075420_1002647951 | 3300006853 | Populus Rhizosphere | DRDKINALMRNIFTRLRSEHHGLPVVYVHSPYATSKTLGKWNPGSVMYDLFLDELARK* |
| Ga0075420_1007566552 | 3300006853 | Populus Rhizosphere | NIFTRLRSEHSGVPVVYVHSPYAASKTLGKWNPGSVMYDLFLDNLAASK* |
| Ga0075429_1003051931 | 3300006880 | Populus Rhizosphere | IFQRLRSEHYGVPVVYLHSAYATSKTLGKWNPGTVMYDLFVDQLASSK* |
| Ga0075429_1016576362 | 3300006880 | Populus Rhizosphere | LGMPIAYLHSAYATSKTLGKWNPGTVMYDFYLDDLAASK* |
| Ga0066710_1007110431 | 3300009012 | Grasslands Soil | VPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0099829_103384011 | 3300009038 | Vadose Zone Soil | SEHYGVPVVYLHSPYATSKRLGKWNPGSVMYDLYIDELASSK* |
| Ga0105250_103977002 | 3300009092 | Switchgrass Rhizosphere | GALMRNVYTRLRSEHYGLPVVYLHSPYAASKTLGKWNPGTVMYDFFIDELASSKR* |
| Ga0105240_124819461 | 3300009093 | Corn Rhizosphere | HLGMPIVYLHSPYATSKKLGKWNPGSVMYDLFFDQLASSK* |
| Ga0111539_134709352 | 3300009094 | Populus Rhizosphere | RLRSEHLGMPIAYLHSAYATSKTLGKWNPGTVMYDFYLDDLAASK* |
| Ga0075418_109341762 | 3300009100 | Populus Rhizosphere | YLHSSYATGKSLGKWNPGTVMYDFFLDELASSKR* |
| Ga0066709_1017730971 | 3300009137 | Grasslands Soil | SEHYGVPVVYLHSPYATSKTLGKWNPGSVMYDLFFDQLASGK* |
| Ga0114129_102627671 | 3300009147 | Populus Rhizosphere | INALMRNIFTRLRSEHHGLPVVYVHSPYATSKTLGKWNPGSVMYDLFLDELARK* |
| Ga0075423_110338561 | 3300009162 | Populus Rhizosphere | REKINTLMRNVYTRLRSEHAGVPVVYLHSPYATSKTLGKWNPGSVMYDLFLDNLAAGK* |
| Ga0105248_101196203 | 3300009177 | Switchgrass Rhizosphere | VYLHSAYATSKTRPKWTVGTVMYDLFIDQLAASK* |
| Ga0105249_102013363 | 3300009553 | Switchgrass Rhizosphere | GVPVVYLHSPYATSKTLAKWNVGSVMYDLFFDQLASGK* |
| Ga0105249_103838283 | 3300009553 | Switchgrass Rhizosphere | VYLHSPYAASKTLGKWNPGTVMYDFFIDELASSKR* |
| Ga0105063_10259592 | 3300009804 | Groundwater Sand | LMRNIFARLRSEHYGVPVVYLHSPYAASKTLGKWNPGTVMYDLFFDELASGKK* |
| Ga0105088_10440212 | 3300009810 | Groundwater Sand | RSEHYGVPVVYLHSAYATSKTLGKWNPGTVMYDLFFDQLASSK* |
| Ga0126380_105896482 | 3300010043 | Tropical Forest Soil | YGVPVVYLHSPYAASKTLGKWNPGSVMYDFFLDELASSKR* |
| Ga0126380_122599601 | 3300010043 | Tropical Forest Soil | IGALLRNVYTRLRSEHYGVPVVYLHSPYAASKTLGKWNPGSVMYDLFLDELARK* |
| Ga0134088_103887442 | 3300010304 | Grasslands Soil | NIYTRMRSEHLGMPIVYLHSAYATGKKLGKWNTGTVMYDLFFDQLASGK* |
| Ga0134063_104734321 | 3300010335 | Grasslands Soil | RDKINALMRNVYTRLRSEHHGVAVVFVHSPYAASKTLGKWNPGSVMYDLFLDELARK* |
| Ga0134071_104118311 | 3300010336 | Grasslands Soil | EHHGVPVVYVHSPYATSKTLGKYNPGAVMYDLFIDELARR* |
| Ga0126370_107054171 | 3300010358 | Tropical Forest Soil | NVYMRLRSEHHGLPIVFVHSPYAASKTLGKWNPGSVMYDLFLDELARK* |
| Ga0126370_111867871 | 3300010358 | Tropical Forest Soil | DREKINALMRNIYTRLRSEHHGVPVVYVHSPYAAAKTLGKWNPGTVMYDLFLDELARK* |
| Ga0126370_116679802 | 3300010358 | Tropical Forest Soil | MRNVYPRLRSEHYGVPVVYLHSPYAASESLGKWNPGTVMYDFFLDELASSKR* |
| Ga0126376_111988011 | 3300010359 | Tropical Forest Soil | TRLRSEHQGVPVVYVNSPYAAAKTLGKWNPGTVMYDLFLDELARK* |
| Ga0126378_124483291 | 3300010361 | Tropical Forest Soil | LLRNVYTRLRSEHYGVPVVYLHSPYAASKTLGKWNPGSVMYDFFLDELASSKR* |
| Ga0126379_119089081 | 3300010366 | Tropical Forest Soil | QTDREKINALLRNVYARLRSEHLGVPVVYLHSPYATSKTLGKWNPGSVMYDLFFDQLAATK* |
| Ga0134121_100804124 | 3300010401 | Terrestrial Soil | ALMRNVYTRLRSEHLGVPVVYLHSPYATSKTLAKWNVGSVMYDLFFDQLASGK* |
| Ga0137393_100940804 | 3300011271 | Vadose Zone Soil | EKINALVRNVYTRLRSEHYGVPVVYLHSPYATSKTLGKWNMGSVMYDLFFDVLASGK* |
| Ga0137393_105950561 | 3300011271 | Vadose Zone Soil | LRSEHYGVPVVYLHSPYAASKTLGKWNIGSVMYDFFLDELASSK* |
| Ga0137364_109025501 | 3300012198 | Vadose Zone Soil | VLMRNVYTRLRSEHYGVPVVYLHSPYATSKTLGKWNPGSVMYDLFFDHLASGK* |
| Ga0137374_103461323 | 3300012204 | Vadose Zone Soil | IRSEHLGMPIVYLHSAYATGKKLGKWNPGTVMYDLFFDELASGK* |
| Ga0137362_100483831 | 3300012205 | Vadose Zone Soil | LGMPIVYLHSAYATGKKLGKWNTGTVMYDLFFDELASSK* |
| Ga0137381_101097544 | 3300012207 | Vadose Zone Soil | VVYVHSPYAAAKTLGKWNPGTVMYDLFLDELARR* |
| Ga0137381_105621532 | 3300012207 | Vadose Zone Soil | VYLHSAYATGKKLGKWNTGTVMYDLFFDELASSK* |
| Ga0137379_103160591 | 3300012209 | Vadose Zone Soil | RLRSEHYGVPVVYLHSPYATSKTLGKWNPGSVMYDLFFDQLASGK* |
| Ga0137377_117371922 | 3300012211 | Vadose Zone Soil | PVVYLHSPYAASKTLGKWNPGTVMYDFFIDELASSKR* |
| Ga0137387_111719342 | 3300012349 | Vadose Zone Soil | VPVVYVHSPYATSKTLGKWNPGSVMYDLFLDELARK* |
| Ga0137372_100592515 | 3300012350 | Vadose Zone Soil | YTRIRSEHAGMPIVYLHSAYATGKKLGKWNTGSVMYDLFFDELASGK* |
| Ga0137386_100779804 | 3300012351 | Vadose Zone Soil | IYTRMRSEHHGVPVVYVHSPYATSKTLGKYNPGAVMYDLFIDELARK* |
| Ga0137369_100475725 | 3300012355 | Vadose Zone Soil | RSEHYGVPVVYVHSPYATSKTLGKWNPGAVMYDLFIDQLAASK* |
| Ga0137371_109621221 | 3300012356 | Vadose Zone Soil | TDREKINALMRNIFTRLRSEHHGLPVVYVHSPYATSKTLGKYNPGTVMYDLFIDELARR* |
| Ga0137368_109245041 | 3300012358 | Vadose Zone Soil | RSEHLGMPIVYLHSAYATGKKLGKWNPGTVMYDLFFDELASGK* |
| Ga0137375_101377381 | 3300012360 | Vadose Zone Soil | DKEKINALMRNIFTRLRSEHYGMPVVYLHSPYATSRKLGKWNPGSVMYDLFFDELASGK* |
| Ga0137375_101404974 | 3300012360 | Vadose Zone Soil | RNVYTRIRSEHYGVPVVYLHSAYATSKTLGKWNPGTVMYDLFIDQLAAGPAAGK* |
| Ga0137360_102724041 | 3300012361 | Vadose Zone Soil | VVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR* |
| Ga0137361_107510852 | 3300012362 | Vadose Zone Soil | YLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR* |
| Ga0157352_10983371 | 3300012519 | Unplanted Soil | VVYLHSPYAASKTLGKWNPGTVMYDFFIDELSSSKR* |
| Ga0137358_103241981 | 3300012582 | Vadose Zone Soil | TRLRSEHYGVPIVYLHSPYAAAKTLGKWNPGNVMYDFFIDELASSKR* |
| Ga0137358_107893012 | 3300012582 | Vadose Zone Soil | YTRLRSEHYGVPVVYLHSPYATSKTLGKWNVGSVMYDLFFDVLASGK* |
| Ga0137397_102602461 | 3300012685 | Vadose Zone Soil | EKIGALMRNVYTRLRAEHYGVPVVYLHSPYATSKSLGKWNVGSVMYDLFFDQLASGK* |
| Ga0157306_103016401 | 3300012912 | Soil | IYLRIRSEHLGVPVVYLHSAYATSKTLPKWTVGTVMYDLFIDQLAASK* |
| Ga0137394_100268331 | 3300012922 | Vadose Zone Soil | QTDREKINALMRNIYTRMRTEHHGVPVVYVHSPYAASKTLGKWNPGTVMYDLFIDELARK |
| Ga0137394_103618893 | 3300012922 | Vadose Zone Soil | VPVVFVHSPYATSKTLGKWNPGSVMYDLFLDQLAASK* |
| Ga0137404_105440222 | 3300012929 | Vadose Zone Soil | SEHYGVPVVYLHSPYATSKNLGKWNVGSVMYDLFFDQLASGK* |
| Ga0137410_112856061 | 3300012944 | Vadose Zone Soil | DKINALMRNVYTRLRSEHHGVPVVFVHSPYATSKTLGKWNPGSVMYDLFLDELARK* |
| Ga0126369_115743841 | 3300012971 | Tropical Forest Soil | MRNVYMRLRSEHHGLPIVFVHSPYAASKTLGKWNPGSVMYDLFLDELARK* |
| Ga0126369_118967101 | 3300012971 | Tropical Forest Soil | MRNVYMRLRSEHHGLPIVFVHSPYAASKTLGKWNPGSVMYDFFIDELASSKR* |
| Ga0126369_120862991 | 3300012971 | Tropical Forest Soil | TLMRNVYTRLRSEHYGLPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR* |
| Ga0134077_103677572 | 3300012972 | Grasslands Soil | VVYLHSPYATSRKLGKWNPGSVMYDLFFDELASGK* |
| Ga0134077_103863722 | 3300012972 | Grasslands Soil | IRSEHAGMPIVYLHSAYATGKKLGKWNPGSVMYDLFFDELASGK* |
| Ga0134110_100245764 | 3300012975 | Grasslands Soil | NALMRNIYTRMRSEHHGVPVVYVHSPYAASKTLGKWNPGTVMYDLFLDELARK* |
| Ga0164309_107200192 | 3300012984 | Soil | LRSEHYGVPVVYLHSPYATSKALGKWNVGSVMYDLFFDVLASGK* |
| Ga0157378_127823722 | 3300013297 | Miscanthus Rhizosphere | YLRIRSEHLGVPVVYLHSAYATSKTLPKWTVGTVMYDLFIDQLAASK* |
| Ga0075303_11344282 | 3300014299 | Natural And Restored Wetlands | SGMPIVYLHSAYATGKKLGKWSPGSVMYDLFFDELASGK* |
| Ga0180074_10162543 | 3300014877 | Soil | RSEHAGVPVVYVHSPYATSKTLGKWNPGSVMYDLFIDELARK* |
| Ga0134089_103914982 | 3300015358 | Grasslands Soil | VYLHSPYATSRKLGKWNPGSVMYDLFFDELASSK* |
| Ga0132258_127206482 | 3300015371 | Arabidopsis Rhizosphere | TLMRNVYTRIRSEHYGLSVVYLHSPYAASKTLGKWNPGTVMYDFFIDELASSKR* |
| Ga0184608_104681751 | 3300018028 | Groundwater Sediment | KINTLMRNIYTRMRSEHLGMPIVYLHSAYATGKKLGKWSPGTVMYDLFFDELASGK |
| Ga0184623_102182132 | 3300018056 | Groundwater Sediment | YGVPVVYLHSPYATSKTLGKWNPGTVMYDLFIDQLASGK |
| Ga0184609_101777461 | 3300018076 | Groundwater Sediment | SEHYGVPVVYLHSPYATSKTLGKWNPGTVMYDLFIDQLASGK |
| Ga0184629_102574462 | 3300018084 | Groundwater Sediment | RLRSEHYGVPVVYVHSPYATSKTLGKWNPGAVMYDLFIDQLAASK |
| Ga0190265_101763671 | 3300018422 | Soil | RITHIRKPILYLLSPYAASKKLGKWNPGTVMYDLFFDELASGK |
| Ga0180106_12940221 | 3300019212 | Groundwater Sediment | REKINALMRNIYTRIRSEHYGVPVVYLHSAYATSKTLGKWNPGTVMYDLFFDQLASSK |
| Ga0190264_111578441 | 3300019377 | Soil | KINSLMRNIFTRLRSEHYGVPVVYMHSPYAASKKLGKWNPGNVMYDLYIDELASST |
| Ga0190264_116134962 | 3300019377 | Soil | RNIFTRLRSEHYGVPVVYLHSAYATSKTLGKWNPGSVMYDLFFDQLAATK |
| Ga0193725_10079521 | 3300019883 | Soil | FTRLRSEHSGVPVVYLHSPYATSKTLGKWNPGTVMYDLFIDQLASGK |
| Ga0179594_100487243 | 3300020170 | Vadose Zone Soil | VYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0196963_102230672 | 3300020215 | Soil | IVYLHSPYASSKALASWNAGSVMYDFFFDELAATK |
| Ga0210381_100041721 | 3300021078 | Groundwater Sediment | LRSEHVGVPVVYLHSPYATAKTLGKWTPGTVMYDLFLEQLAAGK |
| Ga0222622_104918691 | 3300022756 | Groundwater Sediment | VYTRLRSEHYGVPVVYLHSPYATSKNLGKWNVGSVMYDLFFDQLASGK |
| Ga0207684_104567892 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | EHAGMPIVYLHSAYATGKKLGKWNTGSVMYDLFFDELASGK |
| Ga0207684_107826002 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | YTRLRSEHYGVPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0207663_107845881 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | NTLMRNIYTRIRSEHAGMPIVYLHSAYATGKKLGKWNTGSVMYDLFFDELASGK |
| Ga0207691_104493621 | 3300025940 | Miscanthus Rhizosphere | HVGVPVVYLHSPYATAKTLGKWTPGTVMYDLFLEQLAAGK |
| Ga0207703_107253561 | 3300026035 | Switchgrass Rhizosphere | PVVYLHSAYATSKTLPKWTVGTVMYDLFIDQLAASK |
| Ga0207708_115075451 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | TDKEKIGVLMRNVYTRLRTESYGVPVVYLHSPYATSKTLGKWNPGSVMYDFFIDELASSK |
| Ga0207674_103068443 | 3300026116 | Corn Rhizosphere | DQQKVNTLMRNIYTRLRSEHLGMPIAYLHSAYATSKTLGKWNPGTVMYDFYLDDLAASK |
| Ga0209236_11075783 | 3300026298 | Grasslands Soil | TRLRSEHHGLPVVYVHSPYAAAKTLGKWNPGTVMYDLFLDELARK |
| Ga0209027_11633542 | 3300026300 | Grasslands Soil | TDKEKIGVLMRNVYTRLRSEHYGVPVVYLHSPYAASKKLGKWTIGTVMYDFFIDELASSK |
| Ga0209470_10976671 | 3300026324 | Soil | PVVYLHSPYATSKTLGKWNPGSVMYDLFFDQLASGK |
| Ga0209470_12963401 | 3300026324 | Soil | SEHYGVPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0209158_10822622 | 3300026333 | Soil | GVPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0209377_10938261 | 3300026334 | Soil | NVYTRLRSEHYGVPVVYLHSPYAASKTLGKWNPGTVMYDFFIDELASSKR |
| Ga0209804_11397422 | 3300026335 | Soil | RNIFTRLRSEHYGVPVVYLHSPYATSKTLGKWNPGSVMYDLFFDQLASGK |
| Ga0209159_12237762 | 3300026343 | Soil | LRSEHHGLPVVYVHSPYAAAKTLGKWNPGTVMYDLFLDELARR |
| Ga0257171_10020214 | 3300026377 | Soil | RLRSEHYGVPVVYLHSPYATSKTLGKWNVGSVMYDLFFDVLASGK |
| Ga0209059_10310164 | 3300026527 | Soil | VVYVHSPYATSKTLGKYNPGTVMYDLFIDELAFPG |
| Ga0209378_10388311 | 3300026528 | Soil | QTDREKINALMRNIFTRLRSEHYGVPVVYLHSPYATSKTLGKWNPGSVMYDLFFDQLASG |
| Ga0209807_12290272 | 3300026530 | Soil | RLRSEHYGVPVVYLHSPYATSKSLGKWNVGSVMYDLFFDVLASGK |
| Ga0209056_104211642 | 3300026538 | Soil | IFTRLRSEHHGLPVVYVHSPYATSKTLGKYNPGTVMYDLFIDELARR |
| Ga0209076_10288831 | 3300027643 | Vadose Zone Soil | HGVPVVFVHSPYAASKTLGKWNPGSVMYDLFLDELARK |
| Ga0209074_100034331 | 3300027787 | Agricultural Soil | VYTRLRSEHYGVPVVYLHSPYATSKSLGKWNVGSVMYDLFFDVLASGK |
| Ga0209590_108513202 | 3300027882 | Vadose Zone Soil | INALMRNIFTRLRGEHYGVPVVYLHSPYATSKTLGKWNPGSVMYDLFFDQLASGK |
| Ga0209068_100267154 | 3300027894 | Watersheds | QTDREKINALVRNVYTRLRSEHYGVPVVYLHSPYATSKTLGKWNVGSVMYDLFFDVLASG |
| Ga0207428_106861062 | 3300027907 | Populus Rhizosphere | RSEHLGMPIVYLHSPYAASKKLGKWNPGSVMYDLFFDELASGK |
| Ga0209382_102723633 | 3300027909 | Populus Rhizosphere | IFTRLRSEHHGLPVVYVHSPYATSKTLGKWNPGSVMYDLFLDELARK |
| Ga0209382_121709662 | 3300027909 | Populus Rhizosphere | LRNVYLRLRSEHLGLPVVYLHSPYATSKTLGKWNPGTVMYDFFLDDLASGK |
| Ga0268265_117135042 | 3300028380 | Switchgrass Rhizosphere | YGLPVVYLHSPYAASKTLGKWNPGTVMYDFFIDELASSKR |
| Ga0268265_119637752 | 3300028380 | Switchgrass Rhizosphere | TDKEKIGALMRNVYTRLRSEHYGVPVVYLHSPYAASKSLGKWNPGTVMYDFFLDELASSK |
| Ga0247818_112331491 | 3300028589 | Soil | HSGVPVVYVHSPYAASKTLGKWNPGSVMYDLFLDNLAASK |
| Ga0247822_112929621 | 3300028592 | Soil | LMRNIFTRMRSEHSGVPVVYVHSPYAASKTLGKWNPGSVMYDLFLDNLAASK |
| Ga0247819_106451102 | 3300028608 | Soil | IFTRLRSEHSGVPVVYVHSPYAASKTLGKWNPGSVMYDLFLDNLAASK |
| Ga0307313_100343071 | 3300028715 | Soil | YGVPVVYLHSPYATSKNLGKWNVGSVMYDLFFDQLASGK |
| Ga0307504_100345081 | 3300028792 | Soil | LRSEHYGVPVVYLHSPYATSKTLGKWNVGSVMYDLFFDQLASGK |
| Ga0307504_101960481 | 3300028792 | Soil | SALMRNVYTRLRSEHYGVPVVYLHSPYATSKTLGKWNVGSVMYDLFFDQLAAGK |
| Ga0307504_102996382 | 3300028792 | Soil | YTRIRSEHLGMPIVYLHSAYATGKKLGKWNTGTVMYDLFFDELASGK |
| Ga0307281_103227072 | 3300028803 | Soil | DREKINTLMRNIYTRMRSEHSGMPIVYLHSPYAASKKLGKWNPGSVMYDLFFDELASGK |
| Ga0307281_103370581 | 3300028803 | Soil | QTDRDKINTLMRNIYARLRSEHVGVPVVYLHSPYATSKTLGKWTPGTVMYDLFLEQLAAG |
| Ga0307305_103363422 | 3300028807 | Soil | EHLGMPIVYLHSPYAASKKLGKWNPGSVMYDLFFDELASGK |
| Ga0307292_103191271 | 3300028811 | Soil | NIYTRLRSEHVGVPVVYLHSPYATSKTLGKWTPGTVMYDLFLEQLAAGK |
| Ga0307304_101894541 | 3300028885 | Soil | NALMRGIYTRIRSEHLGMPIVYLHSPYAASKKLGKWNPGSVMYDLFFDELASGK |
| Ga0307498_103367701 | 3300031170 | Soil | LGVPVVYLHSAYATSKTLPKWTVGTVMYDLFLDQLAASK |
| Ga0307505_105797302 | 3300031455 | Soil | YTRLRSEHLGVPVVYLHSPYATSKTLAKWNVGSVMYDLFFDQLASGK |
| Ga0310886_102235561 | 3300031562 | Soil | MRNVYTRLRSEHYGVPVVYLHSPYAASKSLGKWNPGTVMYDFFLDELASSKR |
| Ga0307469_104251852 | 3300031720 | Hardwood Forest Soil | HYGVPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0307469_106412522 | 3300031720 | Hardwood Forest Soil | VPVVYLHSPYAAAKTLGKWNPGNVMYDFFIDELASSKR |
| Ga0307469_116323942 | 3300031720 | Hardwood Forest Soil | LRSEHYGVPVVYLHSPYAASKSLGKWNPGTVMYDFFLDELASSKR |
| Ga0307469_122837181 | 3300031720 | Hardwood Forest Soil | INTLMRNIYTRIRSEHLGMPIVYLHSAYATGKKLGKWNPGSVMYDLFFDELASGK |
| Ga0307468_1006064631 | 3300031740 | Hardwood Forest Soil | LMRNIYTRIRSEHAGMPIVYLHSAYATGKKLGKWNTGSVMYDLFFDELASGK |
| Ga0307468_1009732952 | 3300031740 | Hardwood Forest Soil | RSEHYGVPVVYLHSPYATSKSLAKWNVGSVMYDLFFDQLASGK |
| Ga0307468_1012191031 | 3300031740 | Hardwood Forest Soil | PVVYLHSPYATSKALGKWNVGSVMYDLFFDVLASGK |
| Ga0307468_1013697482 | 3300031740 | Hardwood Forest Soil | KIGTLLRNVYTRLRSEHYGVPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0307468_1020244951 | 3300031740 | Hardwood Forest Soil | LGVPVVYLHSAYATSKTLPKWTVGTVMYDLFIDQLAASK |
| Ga0318502_100872503 | 3300031747 | Soil | ARIRSEHSGMPLVYLHSAYAAGKKLGKWNPSSVMYDLFLDELASGK |
| Ga0307473_102916741 | 3300031820 | Hardwood Forest Soil | RNVYTRLRSEHHGVPVVFVHSPYAASKTLGKWNPGSVMYDLFLDELARR |
| Ga0318567_102101511 | 3300031821 | Soil | IYARIRSEHSGMPLVYLHSAYAAGKKLGKWNPSSVMYDLFLDELASGK |
| Ga0310907_104266352 | 3300031847 | Soil | RSEHYGLPVVYLHSPYAASKTLGKWNPGTVMYDFFIDELASSKR |
| Ga0318495_103962021 | 3300031860 | Soil | HYGLPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0306925_107218361 | 3300031890 | Soil | VVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0307407_104325501 | 3300031903 | Rhizosphere | QTDRDKINTLMRNVYTRLRSEHAGVPVVYLHSPYATSKTVGKWNPGTVMYDLFLDNLAAG |
| Ga0306923_120264281 | 3300031910 | Soil | NVYTRLRSEHYGVPVVCLHSPYAASKTLGKWNPGSVMYDFFLDELASSKR |
| Ga0214473_118150112 | 3300031949 | Soil | GALMRNVYLRLRSEHYGVPVVYLHSAYATSKTLPKWTVGTVMYDLFIDQLAASK |
| Ga0306922_104582363 | 3300032001 | Soil | TLMRNVYTRLRSEHYGLPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0310902_111345471 | 3300032012 | Soil | IGTLMRNVYTRLRSEHYGLPVVYLHSPYAASKTLGKWNPGTVMYDFFIDELASSKR |
| Ga0318514_102664742 | 3300032066 | Soil | PVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0306924_126293402 | 3300032076 | Soil | GLPVVYLHSPYAASKTLGKWNPGTVMYDFFLDELASSKR |
| Ga0307471_1014119492 | 3300032180 | Hardwood Forest Soil | IVYLHSPYAASKKLGKWNPGSVMYDLFFDELASGK |
| Ga0326729_10144313 | 3300033432 | Peat Soil | RNVYTRLRSEHYGVPVVYLHSPYATSKTLGKWNVGSVMYDLFFDVLASGK |
| Ga0247829_115555492 | 3300033550 | Soil | EKIGVLLRNVYTRLRTESYGVPVVYLHSPYATSKTLGKWNPGSVMYDFFIDELASSKR |
| Ga0364943_0327474_451_582 | 3300034354 | Sediment | RSEHYGVPVVYLHSAYATSKTLGKWNPGTVMYDLFFDQLASSK |
| Ga0373950_0099423_3_125 | 3300034818 | Rhizosphere Soil | YGVPVVYLHSPYAASKSLGKWNPGTVMYDFFLDELASSKR |
| ⦗Top⦘ |