| Basic Information | |
|---|---|
| Family ID | F025563 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 201 |
| Average Sequence Length | 45 residues |
| Representative Sequence | VLRQTMLSPGRDRRTIKPTITLATLKPTDNLSTLVARIGAYPKVAAE |
| Number of Associated Samples | 173 |
| Number of Associated Scaffolds | 201 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 3.48 % |
| % of genes near scaffold ends (potentially truncated) | 92.54 % |
| % of genes from short scaffolds (< 2000 bps) | 92.54 % |
| Associated GOLD sequencing projects | 163 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (55.721 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (18.905 % of family members) |
| Environment Ontology (ENVO) | Unclassified (23.881 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (42.786 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.67% β-sheet: 0.00% Coil/Unstructured: 89.33% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 201 Family Scaffolds |
|---|---|---|
| PF01323 | DSBA | 82.09 |
| PF03461 | TRCF | 7.46 |
| PF04955 | HupE_UreJ | 1.99 |
| PF13414 | TPR_11 | 0.50 |
| PF10503 | Esterase_PHB | 0.50 |
| PF05711 | TylF | 0.50 |
| PF00496 | SBP_bac_5 | 0.50 |
| PF13641 | Glyco_tranf_2_3 | 0.50 |
| PF00296 | Bac_luciferase | 0.50 |
| PF02082 | Rrf2 | 0.50 |
| PF01042 | Ribonuc_L-PSP | 0.50 |
| PF01565 | FAD_binding_4 | 0.50 |
| PF06776 | IalB | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 201 Family Scaffolds |
|---|---|---|---|
| COG1197 | Transcription-repair coupling factor (superfamily II helicase) | Transcription [K] | 14.93 |
| COG2370 | Hydrogenase/urease accessory protein HupE | Posttranslational modification, protein turnover, chaperones [O] | 1.99 |
| COG0251 | Enamine deaminase RidA/Endoribonuclease Rid7C, YjgF/YER057c/UK114 family | Defense mechanisms [V] | 0.50 |
| COG0640 | DNA-binding transcriptional regulator, ArsR family | Transcription [K] | 0.50 |
| COG1414 | DNA-binding transcriptional regulator, IclR family | Transcription [K] | 0.50 |
| COG1725 | DNA-binding transcriptional regulator YhcF, GntR family | Transcription [K] | 0.50 |
| COG1959 | DNA-binding transcriptional regulator, IscR family | Transcription [K] | 0.50 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 0.50 |
| COG2186 | DNA-binding transcriptional regulator, FadR family | Transcription [K] | 0.50 |
| COG2188 | DNA-binding transcriptional regulator, GntR family | Transcription [K] | 0.50 |
| COG2378 | Predicted DNA-binding transcriptional regulator YobV, contains HTH and WYL domains | Transcription [K] | 0.50 |
| COG2524 | Predicted transcriptional regulator, contains C-terminal CBS domains | Transcription [K] | 0.50 |
| COG5342 | Invasion protein IalB, involved in pathogenesis | General function prediction only [R] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 55.72 % |
| All Organisms | root | All Organisms | 44.28 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000953|JGI11615J12901_10783441 | Not Available | 576 | Open in IMG/M |
| 3300000956|JGI10216J12902_106928730 | Not Available | 1029 | Open in IMG/M |
| 3300000956|JGI10216J12902_110923582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis | 607 | Open in IMG/M |
| 3300001081|JGI12662J13196_1022826 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 520 | Open in IMG/M |
| 3300001976|JGI24752J21851_1015992 | Not Available | 976 | Open in IMG/M |
| 3300002459|JGI24751J29686_10016879 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1507 | Open in IMG/M |
| 3300002568|C688J35102_119269343 | Not Available | 664 | Open in IMG/M |
| 3300002914|JGI25617J43924_10165318 | Not Available | 748 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10028354 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2021 | Open in IMG/M |
| 3300003505|JGIcombinedJ51221_10442169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 526 | Open in IMG/M |
| 3300003911|JGI25405J52794_10042146 | Not Available | 967 | Open in IMG/M |
| 3300004479|Ga0062595_101478503 | Not Available | 625 | Open in IMG/M |
| 3300004643|Ga0062591_101013227 | Not Available | 791 | Open in IMG/M |
| 3300005093|Ga0062594_100201987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 1387 | Open in IMG/M |
| 3300005093|Ga0062594_100358650 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1150 | Open in IMG/M |
| 3300005093|Ga0062594_102924134 | Not Available | 532 | Open in IMG/M |
| 3300005332|Ga0066388_100886805 | All Organisms → cellular organisms → Bacteria | 1472 | Open in IMG/M |
| 3300005332|Ga0066388_102809766 | Not Available | 889 | Open in IMG/M |
| 3300005332|Ga0066388_102878750 | Not Available | 879 | Open in IMG/M |
| 3300005439|Ga0070711_100114005 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Afipia | 1988 | Open in IMG/M |
| 3300005569|Ga0066705_10347797 | Not Available | 935 | Open in IMG/M |
| 3300005713|Ga0066905_101752996 | Not Available | 572 | Open in IMG/M |
| 3300005764|Ga0066903_100370192 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2333 | Open in IMG/M |
| 3300005764|Ga0066903_100543709 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1988 | Open in IMG/M |
| 3300005842|Ga0068858_101684964 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 626 | Open in IMG/M |
| 3300005937|Ga0081455_10808758 | Not Available | 588 | Open in IMG/M |
| 3300006032|Ga0066696_10329184 | Not Available | 995 | Open in IMG/M |
| 3300006046|Ga0066652_100345020 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1338 | Open in IMG/M |
| 3300006050|Ga0075028_100067763 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1756 | Open in IMG/M |
| 3300006173|Ga0070716_100885494 | Not Available | 698 | Open in IMG/M |
| 3300006177|Ga0075362_10096298 | All Organisms → cellular organisms → Bacteria | 1379 | Open in IMG/M |
| 3300006178|Ga0075367_10255407 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1099 | Open in IMG/M |
| 3300006354|Ga0075021_10792478 | Not Available | 612 | Open in IMG/M |
| 3300006575|Ga0074053_11992535 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1195 | Open in IMG/M |
| 3300006579|Ga0074054_12012902 | Not Available | 772 | Open in IMG/M |
| 3300006791|Ga0066653_10172145 | Not Available | 1077 | Open in IMG/M |
| 3300006796|Ga0066665_11044711 | Not Available | 624 | Open in IMG/M |
| 3300006796|Ga0066665_11215768 | Not Available | 575 | Open in IMG/M |
| 3300006797|Ga0066659_10770838 | Not Available | 793 | Open in IMG/M |
| 3300006797|Ga0066659_11810894 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 517 | Open in IMG/M |
| 3300006844|Ga0075428_102623640 | Not Available | 514 | Open in IMG/M |
| 3300006853|Ga0075420_100287869 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1426 | Open in IMG/M |
| 3300006871|Ga0075434_101869732 | Not Available | 607 | Open in IMG/M |
| 3300007004|Ga0079218_11159254 | Not Available | 796 | Open in IMG/M |
| 3300007788|Ga0099795_10070028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1321 | Open in IMG/M |
| 3300009090|Ga0099827_10403991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1167 | Open in IMG/M |
| 3300009090|Ga0099827_11693649 | Not Available | 551 | Open in IMG/M |
| 3300009098|Ga0105245_11489152 | Not Available | 727 | Open in IMG/M |
| 3300009100|Ga0075418_12864831 | Not Available | 526 | Open in IMG/M |
| 3300009147|Ga0114129_12147101 | Not Available | 673 | Open in IMG/M |
| 3300009162|Ga0075423_11674687 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis | 684 | Open in IMG/M |
| 3300009176|Ga0105242_11774018 | Not Available | 655 | Open in IMG/M |
| 3300009177|Ga0105248_11676954 | Not Available | 720 | Open in IMG/M |
| 3300009553|Ga0105249_12826722 | Not Available | 557 | Open in IMG/M |
| 3300010037|Ga0126304_11255519 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 508 | Open in IMG/M |
| 3300010043|Ga0126380_11432567 | Not Available | 608 | Open in IMG/M |
| 3300010046|Ga0126384_12490993 | Not Available | 502 | Open in IMG/M |
| 3300010047|Ga0126382_10467774 | Not Available | 1004 | Open in IMG/M |
| 3300010048|Ga0126373_10010305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 7525 | Open in IMG/M |
| 3300010048|Ga0126373_10466867 | All Organisms → cellular organisms → Bacteria | 1299 | Open in IMG/M |
| 3300010360|Ga0126372_12944229 | Not Available | 528 | Open in IMG/M |
| 3300010366|Ga0126379_11152390 | Not Available | 881 | Open in IMG/M |
| 3300010376|Ga0126381_101781130 | Not Available | 889 | Open in IMG/M |
| 3300010398|Ga0126383_13163288 | Not Available | 538 | Open in IMG/M |
| 3300010399|Ga0134127_10856003 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
| 3300010403|Ga0134123_10404812 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → unclassified Bradyrhizobiaceae → Bradyrhizobiaceae bacterium | 1252 | Open in IMG/M |
| 3300010403|Ga0134123_13468658 | Not Available | 510 | Open in IMG/M |
| 3300011269|Ga0137392_11298508 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 587 | Open in IMG/M |
| 3300012189|Ga0137388_11492943 | Not Available | 613 | Open in IMG/M |
| 3300012205|Ga0137362_11175448 | Not Available | 651 | Open in IMG/M |
| 3300012205|Ga0137362_11569926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 545 | Open in IMG/M |
| 3300012212|Ga0150985_104483977 | Not Available | 525 | Open in IMG/M |
| 3300012351|Ga0137386_10336095 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300012355|Ga0137369_10926529 | Not Available | 583 | Open in IMG/M |
| 3300012357|Ga0137384_10466998 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1038 | Open in IMG/M |
| 3300012362|Ga0137361_10430870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. | 1211 | Open in IMG/M |
| 3300012362|Ga0137361_11651809 | Not Available | 561 | Open in IMG/M |
| 3300012507|Ga0157342_1013136 | Not Available | 881 | Open in IMG/M |
| 3300012685|Ga0137397_10803217 | Not Available | 698 | Open in IMG/M |
| 3300012685|Ga0137397_10817052 | Not Available | 691 | Open in IMG/M |
| 3300012922|Ga0137394_11058306 | Not Available | 673 | Open in IMG/M |
| 3300012925|Ga0137419_11729336 | Not Available | 534 | Open in IMG/M |
| 3300012930|Ga0137407_11342693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis | 679 | Open in IMG/M |
| 3300012944|Ga0137410_10780239 | Not Available | 801 | Open in IMG/M |
| 3300012951|Ga0164300_10094727 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes | 1297 | Open in IMG/M |
| 3300012955|Ga0164298_10829368 | Not Available | 665 | Open in IMG/M |
| 3300012961|Ga0164302_11904254 | Not Available | 506 | Open in IMG/M |
| 3300012971|Ga0126369_11807923 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300012984|Ga0164309_10008350 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5004 | Open in IMG/M |
| 3300012987|Ga0164307_10809273 | Not Available | 745 | Open in IMG/M |
| 3300012988|Ga0164306_11757487 | Not Available | 539 | Open in IMG/M |
| 3300014265|Ga0075314_1125787 | Not Available | 576 | Open in IMG/M |
| 3300014298|Ga0075341_1060352 | Not Available | 661 | Open in IMG/M |
| 3300014325|Ga0163163_12438058 | Not Available | 581 | Open in IMG/M |
| 3300015241|Ga0137418_10831274 | Not Available | 688 | Open in IMG/M |
| 3300015245|Ga0137409_10930051 | Not Available | 706 | Open in IMG/M |
| 3300015372|Ga0132256_101519117 | Not Available | 780 | Open in IMG/M |
| 3300015374|Ga0132255_103691778 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis | 651 | Open in IMG/M |
| 3300016341|Ga0182035_10159692 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1742 | Open in IMG/M |
| 3300016341|Ga0182035_11719595 | Not Available | 567 | Open in IMG/M |
| 3300016387|Ga0182040_10577145 | Not Available | 908 | Open in IMG/M |
| 3300016404|Ga0182037_11196910 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
| 3300016404|Ga0182037_11774285 | Not Available | 551 | Open in IMG/M |
| 3300017944|Ga0187786_10285297 | Not Available | 670 | Open in IMG/M |
| 3300018031|Ga0184634_10045210 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1802 | Open in IMG/M |
| 3300018072|Ga0184635_10141861 | Not Available | 958 | Open in IMG/M |
| 3300018081|Ga0184625_10438577 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis | 670 | Open in IMG/M |
| 3300018429|Ga0190272_13285975 | Not Available | 504 | Open in IMG/M |
| 3300018465|Ga0190269_10068650 | All Organisms → cellular organisms → Bacteria | 1668 | Open in IMG/M |
| 3300018466|Ga0190268_11400361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 599 | Open in IMG/M |
| 3300018469|Ga0190270_10217970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1630 | Open in IMG/M |
| 3300018481|Ga0190271_12731382 | Not Available | 593 | Open in IMG/M |
| 3300018482|Ga0066669_10629302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 943 | Open in IMG/M |
| 3300019362|Ga0173479_10803253 | Not Available | 521 | Open in IMG/M |
| 3300019767|Ga0190267_10698795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 652 | Open in IMG/M |
| 3300019881|Ga0193707_1197219 | Not Available | 517 | Open in IMG/M |
| 3300019887|Ga0193729_1087402 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1206 | Open in IMG/M |
| 3300020002|Ga0193730_1067464 | Not Available | 1021 | Open in IMG/M |
| 3300020579|Ga0210407_10317689 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1217 | Open in IMG/M |
| 3300020579|Ga0210407_10365999 | Not Available | 1128 | Open in IMG/M |
| 3300021168|Ga0210406_10251664 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 1449 | Open in IMG/M |
| 3300021178|Ga0210408_11437457 | Not Available | 518 | Open in IMG/M |
| 3300021560|Ga0126371_10063936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3558 | Open in IMG/M |
| 3300022533|Ga0242662_10150092 | Not Available | 704 | Open in IMG/M |
| 3300023062|Ga0247791_1057390 | Not Available | 622 | Open in IMG/M |
| 3300025903|Ga0207680_10052644 | Not Available | 2441 | Open in IMG/M |
| 3300025920|Ga0207649_10972973 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis | 667 | Open in IMG/M |
| 3300025924|Ga0207694_10268895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1398 | Open in IMG/M |
| 3300025927|Ga0207687_11104105 | Not Available | 681 | Open in IMG/M |
| 3300025927|Ga0207687_11448129 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis | 590 | Open in IMG/M |
| 3300025934|Ga0207686_10728183 | Not Available | 790 | Open in IMG/M |
| 3300025937|Ga0207669_10369858 | Not Available | 1114 | Open in IMG/M |
| 3300025939|Ga0207665_10652242 | Not Available | 825 | Open in IMG/M |
| 3300025945|Ga0207679_10210321 | Not Available | 1631 | Open in IMG/M |
| 3300025972|Ga0207668_10465664 | Not Available | 1081 | Open in IMG/M |
| 3300026118|Ga0207675_100002572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 17967 | Open in IMG/M |
| 3300026322|Ga0209687_1121590 | Not Available | 841 | Open in IMG/M |
| 3300026340|Ga0257162_1028614 | Not Available | 683 | Open in IMG/M |
| 3300026550|Ga0209474_10320890 | Not Available | 893 | Open in IMG/M |
| 3300026557|Ga0179587_11078376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi | 529 | Open in IMG/M |
| 3300027024|Ga0207819_1044075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. | 539 | Open in IMG/M |
| 3300027383|Ga0209213_1037534 | Not Available | 915 | Open in IMG/M |
| 3300027511|Ga0209843_1055352 | All Organisms → cellular organisms → Bacteria | 696 | Open in IMG/M |
| 3300027616|Ga0209106_1001262 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4310 | Open in IMG/M |
| 3300027846|Ga0209180_10118255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1520 | Open in IMG/M |
| 3300027874|Ga0209465_10206419 | Not Available | 981 | Open in IMG/M |
| 3300027886|Ga0209486_10316226 | Not Available | 923 | Open in IMG/M |
| 3300027907|Ga0207428_11223901 | Not Available | 522 | Open in IMG/M |
| 3300027908|Ga0209006_10481497 | Not Available | 1036 | Open in IMG/M |
| 3300028714|Ga0307309_10151290 | Not Available | 587 | Open in IMG/M |
| 3300028715|Ga0307313_10076316 | Not Available | 1005 | Open in IMG/M |
| 3300028716|Ga0307311_10056145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1053 | Open in IMG/M |
| 3300028889|Ga0247827_10890692 | Not Available | 597 | Open in IMG/M |
| 3300028906|Ga0308309_11635040 | Not Available | 548 | Open in IMG/M |
| 3300031546|Ga0318538_10270187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 914 | Open in IMG/M |
| 3300031547|Ga0310887_10693538 | Not Available | 632 | Open in IMG/M |
| 3300031549|Ga0318571_10051532 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1228 | Open in IMG/M |
| 3300031561|Ga0318528_10184224 | Not Available | 1116 | Open in IMG/M |
| 3300031713|Ga0318496_10352263 | Not Available | 813 | Open in IMG/M |
| 3300031716|Ga0310813_10066218 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2714 | Open in IMG/M |
| 3300031719|Ga0306917_10456161 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1001 | Open in IMG/M |
| 3300031719|Ga0306917_11412695 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 537 | Open in IMG/M |
| 3300031720|Ga0307469_10898672 | Not Available | 820 | Open in IMG/M |
| 3300031747|Ga0318502_10891408 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 541 | Open in IMG/M |
| 3300031751|Ga0318494_10325155 | Not Available | 888 | Open in IMG/M |
| 3300031778|Ga0318498_10082657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1450 | Open in IMG/M |
| 3300031779|Ga0318566_10017004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3161 | Open in IMG/M |
| 3300031779|Ga0318566_10227979 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 924 | Open in IMG/M |
| 3300031781|Ga0318547_10342412 | Not Available | 912 | Open in IMG/M |
| 3300031782|Ga0318552_10093145 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1480 | Open in IMG/M |
| 3300031793|Ga0318548_10424278 | Not Available | 652 | Open in IMG/M |
| 3300031805|Ga0318497_10659141 | Not Available | 587 | Open in IMG/M |
| 3300031831|Ga0318564_10122458 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1158 | Open in IMG/M |
| 3300031831|Ga0318564_10146094 | Not Available | 1054 | Open in IMG/M |
| 3300031833|Ga0310917_10312656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1063 | Open in IMG/M |
| 3300031835|Ga0318517_10503487 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 546 | Open in IMG/M |
| 3300031845|Ga0318511_10250798 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 794 | Open in IMG/M |
| 3300031847|Ga0310907_10151523 | Not Available | 1065 | Open in IMG/M |
| 3300031879|Ga0306919_10497210 | Not Available | 940 | Open in IMG/M |
| 3300031893|Ga0318536_10017414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3207 | Open in IMG/M |
| 3300031893|Ga0318536_10321094 | Not Available | 785 | Open in IMG/M |
| 3300031896|Ga0318551_10208679 | Not Available | 1082 | Open in IMG/M |
| 3300031897|Ga0318520_10917980 | Not Available | 552 | Open in IMG/M |
| 3300031940|Ga0310901_10196746 | Not Available | 801 | Open in IMG/M |
| 3300031942|Ga0310916_11062075 | Not Available | 674 | Open in IMG/M |
| 3300031943|Ga0310885_10169659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1058 | Open in IMG/M |
| 3300031959|Ga0318530_10022342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2187 | Open in IMG/M |
| 3300032001|Ga0306922_10320981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1662 | Open in IMG/M |
| 3300032039|Ga0318559_10203104 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 911 | Open in IMG/M |
| 3300032041|Ga0318549_10018295 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2606 | Open in IMG/M |
| 3300032041|Ga0318549_10145426 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1053 | Open in IMG/M |
| 3300032064|Ga0318510_10068477 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1296 | Open in IMG/M |
| 3300032064|Ga0318510_10078852 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1221 | Open in IMG/M |
| 3300032064|Ga0318510_10144834 | Not Available | 935 | Open in IMG/M |
| 3300032065|Ga0318513_10055384 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1785 | Open in IMG/M |
| 3300032066|Ga0318514_10033994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 2408 | Open in IMG/M |
| 3300032174|Ga0307470_11327166 | Not Available | 590 | Open in IMG/M |
| 3300032261|Ga0306920_100046544 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → unclassified Rhodoplanes → Rhodoplanes sp. Z2-YC6860 | 6289 | Open in IMG/M |
| 3300032261|Ga0306920_100839863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1346 | Open in IMG/M |
| 3300032261|Ga0306920_104112995 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 526 | Open in IMG/M |
| 3300033550|Ga0247829_11121506 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Rhodopseudomonas → Rhodopseudomonas faecalis | 653 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 18.91% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 10.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 5.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 5.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 3.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.49% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.49% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.50% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.50% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.50% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.00% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
| Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000953 | Soil microbial communities from Great Prairies - Kansas Corn soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001081 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 | Environmental | Open in IMG/M |
| 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Host-Associated | Open in IMG/M |
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300002914 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006177 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Host-Associated | Open in IMG/M |
| 3300006178 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Host-Associated | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006575 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009100 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2 | Host-Associated | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010037 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot25 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012355 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_113_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012507 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
| 3300014298 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushMan_ThreeSqB_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300018031 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_200_b1 | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300019881 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c2 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022533 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-7-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026340 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-A | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027383 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027511 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_20_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300027616 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028714 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196 | Environmental | Open in IMG/M |
| 3300028715 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_203 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
| 3300031779 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
| 3300031833 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178 | Environmental | Open in IMG/M |
| 3300031835 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f21 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031879 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 (v2) | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
| 3300032041 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22 | Environmental | Open in IMG/M |
| 3300032064 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17 | Environmental | Open in IMG/M |
| 3300032065 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI11615J12901_107834412 | 3300000953 | Soil | NTIRPTITLAALKPTDNLSTLVARIGASSQVAAE* |
| JGI10216J12902_1069287301 | 3300000956 | Soil | ARRIASVLMRTMVSSDRGRHAIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| JGI10216J12902_1109235821 | 3300000956 | Soil | ERNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE* |
| JGI12662J13196_10228261 | 3300001081 | Forest Soil | TLKQTMLSPGRDRRTIRPSITLATFKPTDNLSTLVARVGAYPKANIAH* |
| JGI24752J21851_10159922 | 3300001976 | Corn, Switchgrass And Miscanthus Rhizosphere | HVVARRIASVLMRTMVSSDRSRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| JGI24751J29686_100168793 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | ARRIASVLMRTMVSSDRSRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| C688J35102_1192693431 | 3300002568 | Soil | IASVLRHTMVSPGSDRRTIRPTITLATLKASDNLSTLVARVGAYPKVAVTRQ* |
| JGI25617J43924_101653182 | 3300002914 | Grasslands Soil | ARQMASVLRRTMLSPGRDRRAIKPTITLAALKPSDDLSTLVARLGAPVKVAAE* |
| JGIcombinedJ51221_100283543 | 3300003505 | Forest Soil | SPGRDRRSIRPTITLATFKPTDNVSTLVARVGAYPKVAVACPSRGLAG* |
| JGIcombinedJ51221_104421691 | 3300003505 | Forest Soil | SPGRDRRSIRPTITLATFKPTDNVSTLVARVGAYPKVAAARPSRGLAG* |
| JGI25405J52794_100421461 | 3300003911 | Tabebuia Heterophylla Rhizosphere | MLSPDGDRRTIRPTITLAALRPRDDLGTLVARIGAYPRVAAE* |
| Ga0062595_1014785031 | 3300004479 | Soil | RIGGVLRQTMLSPGGDRRAIKPTITLAALKPRDDLGTLVARLGAHTKVAAE* |
| Ga0062591_1010132272 | 3300004643 | Soil | MLAPNRDRRTIKPMITLATLKSTDNLSTLVARVGTYPKVAAE* |
| Ga0062594_1002019873 | 3300005093 | Soil | KTDLRSAHLLARRIGGGLRQTMLSPGGDRRAIKPTITLAALKPRDDLGTLVARLGAHTKVAAE* |
| Ga0062594_1003586501 | 3300005093 | Soil | VLKHTMLAPNRDRRTIKPMITLATLKSTDNLSTLVARVGTYPKVAAE* |
| Ga0062594_1029241341 | 3300005093 | Soil | DRGEIRPTVTLATLKANDNLNSLVARVGSRPQVAGMSQEA* |
| Ga0066388_1008868051 | 3300005332 | Tropical Forest Soil | GSVLRSTMLSPGRDRRAIQPTITLAALKRSDDLGTLVARLGSQAVVAAE* |
| Ga0066388_1028097661 | 3300005332 | Tropical Forest Soil | RTMLSPGHDRRAIRPTITLAALKPSDDLSTLVARLGAPVKVAAE* |
| Ga0066388_1028787501 | 3300005332 | Tropical Forest Soil | VLRSTMLSPGRDRRAIQPTITLAALKRSDDLGTLVARLGSQAVVAAE* |
| Ga0070711_1001140053 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | RIGGVLRQTMLSPGGDRRAIKPTITLAALKPRDDLGTLVARLGTHTKVAAE* |
| Ga0066705_103477971 | 3300005569 | Soil | HLLARRIGGVLRLTMLSPGGDRRAIKPTITLAAFKPSDDLSTLVARLGAHAKVAAE* |
| Ga0066905_1017529962 | 3300005713 | Tropical Forest Soil | RRNIRPTITLATLKPTDNLSTLVARVGAYPKVAGE* |
| Ga0066903_1003701924 | 3300005764 | Tropical Forest Soil | IASVLRQTMLSPDRDRRTIKPTVTLATLKTTDNLSTLVARVGAYPKVAAD* |
| Ga0066903_1005437095 | 3300005764 | Tropical Forest Soil | VARRLASVLKHTVLSSEQSLKPTVTLATLKPSDNLSTLVARVGTYPKVAAR* |
| Ga0068858_1016849641 | 3300005842 | Switchgrass Rhizosphere | VARRLASVLKHTMLASEQALKPTVTLATLKPTDNLSTLVARVGTYPKVAVS* |
| Ga0081455_108087582 | 3300005937 | Tabebuia Heterophylla Rhizosphere | DRRAIKPTITLATLKSTDNLSTLVARVGTYPKVAAE* |
| Ga0066696_103291841 | 3300006032 | Soil | RRIAGALRRTMLSPGGDRRTIRPMITLAALRPSDNLATLVARIGSYPRVAAE* |
| Ga0066652_1003450203 | 3300006046 | Soil | DSIKPTVTLATLKPADNLSTLVARVGTYPKVAAG* |
| Ga0075028_1000677631 | 3300006050 | Watersheds | LKHTMLSPDHDRHAIRPTVTLATLKPTDNLSTLVARIGTYPEVAAG* |
| Ga0070716_1008854941 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | QTMLSPGGDRRAIKPTITLAAFKPSDDLGTLVARLGAHAKVAAE* |
| Ga0075362_100962983 | 3300006177 | Populus Endosphere | RNTMMSPDLDRRTIKPTVTLATLKPSDNLSTLVARVGTYPKVAAG* |
| Ga0075367_102554073 | 3300006178 | Populus Endosphere | MRTMVSSDRGRHAIKPMITLAALKPNDNLSTLVARIGASSQVAAE* |
| Ga0075021_107924781 | 3300006354 | Watersheds | RDHRTIKPAITLATLKASDNLSTLVARVGSYPKVAAE* |
| Ga0074053_119925351 | 3300006575 | Soil | RHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| Ga0074054_120129021 | 3300006579 | Soil | SVHVVARRIASVLMRTMVSSDRSRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| Ga0066653_101721453 | 3300006791 | Soil | LKHTMLSPSDDRRVIKPTITLAAVKPADDLSTLVARLGAPVKVAAE* |
| Ga0066665_110447111 | 3300006796 | Soil | SVLRQTMLSPGRDRRMIKPTITLATLKPTDNLSTLVGRVGTYPKVAAG* |
| Ga0066665_112157682 | 3300006796 | Soil | SASGLRRTMLSPGRDRRAIRPTITLAARKPTDDVSRLVARLGAHPKVAAE* |
| Ga0066659_107708382 | 3300006797 | Soil | DRDRASIKPTITLATLKPTDNLSTLVARIGTYPKVAAG* |
| Ga0066659_118108942 | 3300006797 | Soil | VARRLASVLKHTMLASEQALKPTVTLATLKPTDNLSTLVARVGTYPKVAAG* |
| Ga0075428_1026236401 | 3300006844 | Populus Rhizosphere | DRGTIKPTITLATLKSTDNLSTLVARVGTYPKVAAE* |
| Ga0075420_1002878691 | 3300006853 | Populus Rhizosphere | RRTIKPTVTLATLKPTDNLSTLVARVGTYPKLAAG* |
| Ga0075434_1018697322 | 3300006871 | Populus Rhizosphere | LMRTMVSSDRGRHAIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| Ga0079218_111592541 | 3300007004 | Agricultural Soil | RIASVLRDTMVSPGNDRRAIKPTITLATLKPSDNLNTLVARVGSCPKVAVH* |
| Ga0099795_100700281 | 3300007788 | Vadose Zone Soil | RRIGGVLRQTMLSPGGDRRAIKPTITLAAFKPSDDLGTLVARLGAHAKVAAE* |
| Ga0099827_104039911 | 3300009090 | Vadose Zone Soil | LRQTMLSPDHDRRTIKPTITLATLKPTDNMSTLVARVGAYPKVAAE* |
| Ga0099827_116936491 | 3300009090 | Vadose Zone Soil | HTMLAPNRDRRTIKPTITLATLKSTDNLSTLVARVGTYPKVAAE* |
| Ga0105245_114891521 | 3300009098 | Miscanthus Rhizosphere | RHTIKPMITLAALKPSDNLSTLVARIGASFQVAAE* |
| Ga0075418_128648312 | 3300009100 | Populus Rhizosphere | RRLASVLKHTMLASEQALKPTVTLATLKSTDNLSTLVARVGTYPKVAVS* |
| Ga0114129_121471011 | 3300009147 | Populus Rhizosphere | IASVLRRTMLSPDGDRRTIRPTITLAALRRRDDLGTLVARIGAYPRVAAE* |
| Ga0075423_116746872 | 3300009162 | Populus Rhizosphere | SVHVVARRIASALMRTMVSSDRGRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| Ga0105242_117740182 | 3300009176 | Miscanthus Rhizosphere | IASVLMRTMVSSGCERNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE* |
| Ga0105248_116769542 | 3300009177 | Switchgrass Rhizosphere | SPAHDRRSIRPTITLATLKSSDNLSTFVARVGAYPKVAGTRPGA* |
| Ga0105249_128267221 | 3300009553 | Switchgrass Rhizosphere | SVLMRTMVSSGCERNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE* |
| Ga0126304_112555191 | 3300010037 | Serpentine Soil | VHVVARRIASVLMRTMVSSDRGRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| Ga0126380_114325672 | 3300010043 | Tropical Forest Soil | RSAHLFARRVGSVLRSTMLSPGRDRRAIQPTITLAARKRSDDLGTLVARLGSKAVVAAE* |
| Ga0126384_124909932 | 3300010046 | Tropical Forest Soil | MLSPSGDRGTIKPTVTLATLKPTDNLSTLVARVGTYPKVAVTRRQA* |
| Ga0126382_104677741 | 3300010047 | Tropical Forest Soil | VLKRTMLSPGHDRRAIRPTITLAALKPNDDLSTLVARLGAPVKVAAE* |
| Ga0126373_100103054 | 3300010048 | Tropical Forest Soil | MLAPGNEAIKPTVTLATLKPSDDLSSPVVRGGTCPKLAAG* |
| Ga0126373_104668673 | 3300010048 | Tropical Forest Soil | RQTMLSPGGDRRAIKPTITLAAFKPSDDLGTLVARLGTHAKVAAE* |
| Ga0126372_129442291 | 3300010360 | Tropical Forest Soil | TMLAGEQALKPTVALATLKPTDNLSTLVARIGTYPKVAAS* |
| Ga0126379_111523902 | 3300010366 | Tropical Forest Soil | DRDRRTIKPTITLATLKATDNLSTLVARVGSYPKVAAE* |
| Ga0126381_1017811301 | 3300010376 | Tropical Forest Soil | TVLAPGQDRGAIKPTVTLATLKPTDDLGSLAARLGTCPKVAVS* |
| Ga0126383_131632881 | 3300010398 | Tropical Forest Soil | HTVLSSEQSLKPTVTLATLKPSDNLSTLVARVGTYPKVAAR* |
| Ga0134127_108560031 | 3300010399 | Terrestrial Soil | MMSPDLDRRSIKPTVTLATLKPSDNLSTLVARVGTYPKVAAGQGKA* |
| Ga0134123_104048121 | 3300010403 | Terrestrial Soil | RLASVLKHTMLASEQALKPTVTLATLKPTDNLSTLVARVGTYPKVAVS* |
| Ga0134123_134686581 | 3300010403 | Terrestrial Soil | NTMMSPDLDRRTIKPTVTLATLKPTDNLSTLVARVGTYPKVAAGQGKA* |
| Ga0137392_112985081 | 3300011269 | Vadose Zone Soil | VLRQTMLSPGRDRRTIKPTITLATLKPTDNLSTLVARIGAYPKVAAE* |
| Ga0137388_114929431 | 3300012189 | Vadose Zone Soil | RIASVLRHTMISPGRDRRTIRPTITLATFKPTDNLSTLVARVGAYPKAVAAR* |
| Ga0137362_111754481 | 3300012205 | Vadose Zone Soil | RIASVLRRTMLSPGRDRRAIKPTITLAARRATDDVSALVARLGGHPKVAAE* |
| Ga0137362_115699262 | 3300012205 | Vadose Zone Soil | VLRQTMLSPRRDRRTIKPTITLATLKPTDNLSTLVARIGAYPKVAAE* |
| Ga0150985_1044839771 | 3300012212 | Avena Fatua Rhizosphere | MLSSEQTLKPTVTLATLMPTDNLSTLVARVGTYPKVAAS* |
| Ga0137386_103360951 | 3300012351 | Vadose Zone Soil | RVIKPTITLAALKPADDLSTLVARLGAPVKVAAE* |
| Ga0137369_109265291 | 3300012355 | Vadose Zone Soil | RAIRPTITLAARKPTDDVSTLVARLGAHPKVAAE* |
| Ga0137384_104669982 | 3300012357 | Vadose Zone Soil | VLKRTMLSPSHDRRVIKPTITLAALKPTDDLSTLVARLGAPVKVAAE* |
| Ga0137361_104308703 | 3300012362 | Vadose Zone Soil | GRDRRAIRPTITLAARKPTDDVSRLVARLGAHPKVAAE* |
| Ga0137361_116518091 | 3300012362 | Vadose Zone Soil | LASVLKHTMLASEQALKPTVTLATLKPTDNLSTLVARVGTYPKVAAS* |
| Ga0157342_10131362 | 3300012507 | Arabidopsis Rhizosphere | LMRTMVYSDRGRHAIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| Ga0137397_108032171 | 3300012685 | Vadose Zone Soil | RGIKPTITLAALKPTDDLGTLVARLGAHPKIAAE* |
| Ga0137397_108170522 | 3300012685 | Vadose Zone Soil | RQTMLSPDRDRRNIKPTITLATLKPTDNLSTLVARVGSYPKVAAE* |
| Ga0137394_110583062 | 3300012922 | Vadose Zone Soil | KHTMLGPDRDRRDIKPTVTLATLKPADNLSTLAARVGASPKVAAG* |
| Ga0137419_117293361 | 3300012925 | Vadose Zone Soil | RAIKPTITLATLKPTDNLSTLVARVGAYPKVAGE* |
| Ga0137407_113426932 | 3300012930 | Vadose Zone Soil | VLKHTMLSPDREHTVKPTITLATLKSTDNLDTLVARVGTSPTVAAG* |
| Ga0137410_107802392 | 3300012944 | Vadose Zone Soil | DTIKPTVTLATLKPTDNLSSLVARIGTYPTVAAG* |
| Ga0164300_100947271 | 3300012951 | Soil | GGVLRQTMLSPGGDRRAIKPTITLAALKPRDDLGTLVARLGAHTKVAAE* |
| Ga0164298_108293682 | 3300012955 | Soil | VVARRIASVLMRTMVSSDRSRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| Ga0164302_119042542 | 3300012961 | Soil | RQSMFSCGGDRQLIKPTITLATFKPTDNVSTLVARVGAHPKIALSH* |
| Ga0126369_118079232 | 3300012971 | Tropical Forest Soil | GDRGTIRPTITLAALRPRDDLGSLVARIGADPRVAAE* |
| Ga0164309_100083505 | 3300012984 | Soil | VHVVARRIASVLMRTMVSSDRSRHTIKPMITLAALKPSDNLGTLVARIGASSQVAAE* |
| Ga0164307_108092731 | 3300012987 | Soil | MVSSGCERNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE* |
| Ga0164306_117574871 | 3300012988 | Soil | RDRRAIKPTITLTARRATDDVSTLVARLGGHPKVAAE* |
| Ga0075314_11257871 | 3300014265 | Natural And Restored Wetlands | GRDRGTIRPTVTLATLKASDNLSTLVARVGSQPQVAAASQEA* |
| Ga0075341_10603522 | 3300014298 | Natural And Restored Wetlands | RQTMLSPGRDRGTIRPTVTLATLKASDNLSTLVARVGSQPQVAAASQEA* |
| Ga0163163_124380582 | 3300014325 | Switchgrass Rhizosphere | MRTMVSSDRGRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE* |
| Ga0137418_108312741 | 3300015241 | Vadose Zone Soil | SSDRDRDTIKPTVTLATLKPTDNLSSLVARIGTYPTVAAG* |
| Ga0137409_109300512 | 3300015245 | Vadose Zone Soil | DRRAIKPTITLATLKPADNLSTLVARVGAYPKVAAE* |
| Ga0132256_1015191171 | 3300015372 | Arabidopsis Rhizosphere | RNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE* |
| Ga0132255_1036917781 | 3300015374 | Arabidopsis Rhizosphere | RIASVLMRTMVSSDRGRHAIKPMITLAALRPSDDLGTLVARIGASSQVAAE* |
| Ga0182035_101596922 | 3300016341 | Soil | VLRQTMISPGRDRRAISPTVTLASFKPTDNVSTLVARVGAYPKAAAAH |
| Ga0182035_117195951 | 3300016341 | Soil | PGRDRRAIKPTITLAARRATDDVSTLVARLGGHPKVAAE |
| Ga0182040_105771452 | 3300016387 | Soil | RAISPTVTLASFKLTDNVSTLVARVGAYPRAAAAD |
| Ga0182037_111969102 | 3300016404 | Soil | ALKHAMLLPGDRRMIRPTVTLATLKPEDNLSTLVARLGTYPKVAAG |
| Ga0182037_117742852 | 3300016404 | Soil | SVLRHTMVSPGHDRRTIRPTITLATFKPTDNLSTLVARVGAYPKAVAVRS |
| Ga0187786_102852972 | 3300017944 | Tropical Peatland | VLSSEQAFKPTVTLATLKPTDNLSTLVARVGTYPKVAAS |
| Ga0184634_100452104 | 3300018031 | Groundwater Sediment | LMRTMVSSDRGRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0184635_101418612 | 3300018072 | Groundwater Sediment | ARRIASMLMRTMVSSDRGRHAIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0184625_104385771 | 3300018081 | Groundwater Sediment | IASVLMRTMVSSDRGRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0190272_132859752 | 3300018429 | Soil | RRSIKPTVTLATLKPSDNLSTLVARVGTYPKVAAS |
| Ga0190269_100686504 | 3300018465 | Soil | RNTMMSPDLDRRTIKPTVTLATLKPNDNLSSLVARVGTYPKVAAS |
| Ga0190268_114003612 | 3300018466 | Soil | MRTMVSSDRGRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0190270_102179701 | 3300018469 | Soil | SVLMRTMVSSDRGRHTIKPMITLAALKPSDNLSTLVARIGAGSQVAAE |
| Ga0190271_127313821 | 3300018481 | Soil | LAGILRQTMLSPGRDRGTIRPTVTLATLKASDNLSTLVARVGSQPQVAAAPQEA |
| Ga0066669_106293021 | 3300018482 | Grasslands Soil | LVARRIASVLRRTMLSPGRDRRAIRPTITLAARKPTDDVSRLVARLGAHPKVAAE |
| Ga0173479_108032531 | 3300019362 | Soil | RGRHTIKPMITLAALKPSDNLSTLVARIGASFQVAAE |
| Ga0190267_106987951 | 3300019767 | Soil | SSDRGRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0193707_11972191 | 3300019881 | Soil | RDRHTIKPTITLAALKPTDNLNTLMARIGASSQVAAE |
| Ga0193729_10874023 | 3300019887 | Soil | SVLRQTMVSPGRDRRSIRPTITLATFKPTDNVSTLVARVGAFPKVAAARPSRGLAG |
| Ga0193730_10674643 | 3300020002 | Soil | AHVVARRIASALMRTMVSSDRDRHTIKPTITLAAHKPTDNLNTLMARIGASSQVAAE |
| Ga0210407_103176891 | 3300020579 | Soil | LSPGGDRRAIKPTITLAALKPRDDLGTLVARLGAHTKVAAE |
| Ga0210407_103659991 | 3300020579 | Soil | GGVLRQTMLSPGGDRRAIKPTITLAAFKPSDDLGTLVARLGAHAKVAAE |
| Ga0210406_102516641 | 3300021168 | Soil | TMVSPGRDRRSIRPTITLATFKPTDNVSTLVARVGAYPKVAAARPSRGLAG |
| Ga0210408_114374571 | 3300021178 | Soil | GVLRQTMLSPGGDRRAIKPTITLAAFKPSDDLGTLVARLGAHAKVAAE |
| Ga0126371_100639364 | 3300021560 | Tropical Forest Soil | MLAPGNEAIKPTVTLATLKPSDDLSSPVVRGGTCPKLAAG |
| Ga0242662_101500921 | 3300022533 | Soil | GVLRQTMLSPGGDRRAIKPTITLAALKPRDDLGTLVARLGAHTKVAAE |
| Ga0247791_10573901 | 3300023062 | Soil | SVLMRTMVSSGCERNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE |
| Ga0207680_100526441 | 3300025903 | Switchgrass Rhizosphere | SSDRSRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0207649_109729731 | 3300025920 | Corn Rhizosphere | DRGRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0207694_102688951 | 3300025924 | Corn Rhizosphere | VSSDRSRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0207687_111041052 | 3300025927 | Miscanthus Rhizosphere | RHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0207687_114481292 | 3300025927 | Miscanthus Rhizosphere | RHTIKPMITLAALKPSDNLSTLVARIGASFQVAAE |
| Ga0207686_107281832 | 3300025934 | Miscanthus Rhizosphere | RNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE |
| Ga0207669_103698582 | 3300025937 | Miscanthus Rhizosphere | IASVLMRTMASSGCERNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE |
| Ga0207665_106522422 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | QTMLSPGGDRRAIKPTITLAAFKPSDDLGTLVARLGAHAKVAAE |
| Ga0207679_102103211 | 3300025945 | Corn Rhizosphere | MRTIVSSDRSRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0207668_104656641 | 3300025972 | Switchgrass Rhizosphere | VSSDRGRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0207675_1000025721 | 3300026118 | Switchgrass Rhizosphere | RRIASVLMRTMVSSDRSRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0209687_11215902 | 3300026322 | Soil | LLARRIGGVLRLTMLSPGGDRRAIKPTITLAAFKPSDDLSTLVARLGAHAKVAAE |
| Ga0257162_10286142 | 3300026340 | Soil | ASVLRRTMLSPGRDRRAIKPTITLAALKPSDDLSTLVARLGAPVKVAAE |
| Ga0209474_103208902 | 3300026550 | Soil | TMLSPGGDRRAIKPTITLAAFKPSDDLSTLVARLGAHAKVAAE |
| Ga0179587_110783761 | 3300026557 | Vadose Zone Soil | SVLKHTMLSPDHDRQAIRPTVTLATLKPTDNLSTLVARIGTYPEVATG |
| Ga0207819_10440752 | 3300027024 | Tropical Forest Soil | VLRQTMISPGHDRHAIKPTITLASLKPTDNMSSLVARVGAYPKIAAAH |
| Ga0209213_10375341 | 3300027383 | Forest Soil | ASVLMRTMVSSDRDRRTIKPTITLAALKPTDNLSTLVTRIGASSQVAAE |
| Ga0209843_10553521 | 3300027511 | Groundwater Sand | MLLPGSDHGSIKPAITLATLKPTDNLSSLVARIGASPRLAAKSAPA |
| Ga0209106_10012625 | 3300027616 | Forest Soil | RRSIKPTITLATLKPTDNLSTLVARVGSYPKVAAEWRRA |
| Ga0209180_101182552 | 3300027846 | Vadose Zone Soil | PDRDRRTIKPMITLATLKPTDNLSTLVARIGAYPKVAAE |
| Ga0209465_102064191 | 3300027874 | Tropical Forest Soil | EQSLKPTVTLATLKPSDNLSTLVARVGTYPKVAAR |
| Ga0209486_103162262 | 3300027886 | Agricultural Soil | GILRNTMMSPDLDRRSIKPTVTLATLKPTDNLSTLVARVGTYPKLAAG |
| Ga0207428_112239011 | 3300027907 | Populus Rhizosphere | VIARRIASVLMRTMVSSGCERNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE |
| Ga0209006_104814971 | 3300027908 | Forest Soil | DHDRTAIRPTVTLATLKPSDNLSTLVARVGTYPKVAAG |
| Ga0307309_101512901 | 3300028714 | Soil | HVVARRIASVLMRTMVSSDRGRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0307313_100763163 | 3300028715 | Soil | RRIASVLKHTMLAGESDSIKPTVTLATLKPADNLSTLVARVGTYPKVAAG |
| Ga0307311_100561452 | 3300028716 | Soil | VHVVARRIASVLMRTMVSSDRGRHTIKPVITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0247827_108906922 | 3300028889 | Soil | RHTMLAPDSDRRAIKPTVTLATLKPSDNLSTLVARVGTYPKVAAG |
| Ga0308309_116350401 | 3300028906 | Soil | HTMLSPGHDRHAITPTVTLATLKPTDNLSTLVARVGTYPKVAAG |
| Ga0318538_102701872 | 3300031546 | Soil | LSPGRDRRAIMPTITLAARKPTDDISTLVARLGGHPKVAAE |
| Ga0310887_106935381 | 3300031547 | Soil | IASVLMRTMVSSGCERNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE |
| Ga0318571_100515323 | 3300031549 | Soil | MLSPGRDRRGIRPTITLTARRSTDDVSTLVARLGGHPKVAAE |
| Ga0318528_101842243 | 3300031561 | Soil | GHDRRGIKPTVTLATLKPTDDLTSLMARLGTYPKVAVS |
| Ga0318496_103522632 | 3300031713 | Soil | RIASVLRHTMLAPGHDRRSIKPTVTLATLKPTDDLTSLMARLGTYPKVAVS |
| Ga0310813_100662185 | 3300031716 | Soil | MVSSGCERNTIRPTITLAALKPTDNLSTLVARIGASSQVAAE |
| Ga0306917_104561611 | 3300031719 | Soil | SPGRDRRAIMPTITLAARKPTDDISTLVARLGGHPKVAAE |
| Ga0306917_114126952 | 3300031719 | Soil | MLAPGHDRRGIKPTVTLATLKPTDDLTSLMARLGTYPKVAVS |
| Ga0307469_108986721 | 3300031720 | Hardwood Forest Soil | RRAIRPTITLAARKPTDDVSRLVARHGAHPKVAAE |
| Ga0318502_108914082 | 3300031747 | Soil | IASVLRHTMLAPGHDRRSIKPTVTLATLKPTDDLTSLMARLGTYPKVAVS |
| Ga0318494_103251552 | 3300031751 | Soil | LRRTMLSPGRDRRGIRPTITLTARRATDDVGTLVARLGGHPKVAAE |
| Ga0318498_100826573 | 3300031778 | Soil | ASVLRRTMLSPGRDRRAIKPTITLAARRATDDVSTLVARLGGHPKVAAE |
| Ga0318566_100170044 | 3300031779 | Soil | ARRIASVLRQTMISPGHDRHAIRPTITLASLKPTDNMSSLVARVGAYPKVAAAH |
| Ga0318566_102279792 | 3300031779 | Soil | RTMLSPGRDRRAIMPTITLAARKPTDDISTLVARLGGHPKVAAE |
| Ga0318547_103424121 | 3300031781 | Soil | RHTMLAPGHDRRGIKPTVTLATLKPTDDLTSLMARLGTYPKVAVS |
| Ga0318552_100931451 | 3300031782 | Soil | SVLRRTMLSPGRDRRAIMPTITLAARKPTDDISTLVARLGGHPKVAAE |
| Ga0318548_104242781 | 3300031793 | Soil | GHDRRSIKPTVTLATLKPTDDLTSLVARLGTYPKVAVS |
| Ga0318497_106591411 | 3300031805 | Soil | HTMLAPGHDRRSIKPTVTLATLKPTDDLTSLVARLGTYPKVAVS |
| Ga0318564_101224582 | 3300031831 | Soil | MISPGHDRHAIRPTITLASLKPTDNMSSLVARVGAYPKVAAAH |
| Ga0318564_101460941 | 3300031831 | Soil | RDRRAIKPTITLAARRATDDVSTLVARLGGHPKVAAE |
| Ga0310917_103126563 | 3300031833 | Soil | ARRIASVLRRTMLSPGRDRRAIKPTITLAARRATDDVSTLVARLGGHPKVAAE |
| Ga0318517_105034872 | 3300031835 | Soil | RRSIKPTVTLATLKPTDDLTSLMARLGTYPKVAVS |
| Ga0318511_102507981 | 3300031845 | Soil | PGRDRRAIMPTITLAARKPTDDISTLVARLGGHPKVAAE |
| Ga0310907_101515231 | 3300031847 | Soil | GRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0306919_104972101 | 3300031879 | Soil | PGHDRRSIKPTVTLATLKPTDDLTSLMARLGTYPKVAVS |
| Ga0318536_100174141 | 3300031893 | Soil | MLAPGHDRRSIKPTVTLATLKPTDDLTSLMARLGTYPKVAVS |
| Ga0318536_103210942 | 3300031893 | Soil | RHTMVSPGHDRRTIRPTITLATFKPTDNLSTLVARVGAYPKAVAVRS |
| Ga0318551_102086791 | 3300031896 | Soil | IARRIASVLRRTMLSPGRDRRAIMPTITLAARKPTDDISTLVARLGGHPKVAAE |
| Ga0318520_109179802 | 3300031897 | Soil | LSSDRDRRSIKPTITLATLKPSDNLSTLVARVGAYPKVAAE |
| Ga0310901_101967462 | 3300031940 | Soil | SDRSRHTIKPMITLAALKPSDNLSTLVARIGASSQVAAE |
| Ga0310916_110620751 | 3300031942 | Soil | MVSPGHDRRNIRPTITLATFKPTDNLSTLVARVGAYPKAVAVRS |
| Ga0310885_101696591 | 3300031943 | Soil | MMSPDLDRRSIKPTVTLATLKPSDNLSTLVARVGTYPKVAAGQGKA |
| Ga0318530_100223421 | 3300031959 | Soil | SPGRDRRGIRPTITLTARRATDDVSTLVARLGGHPKVAAE |
| Ga0306922_103209813 | 3300032001 | Soil | PGRDRRAIRPTITLAARKPTDDVGTLVARLGAHPKVAAE |
| Ga0318559_102031042 | 3300032039 | Soil | GRDRRAIMPTITLAARKPTDDISTLVARLGGHPKVAAE |
| Ga0318549_100182951 | 3300032041 | Soil | LVARQIASVLRRTMLSPGRDRRAIKPTITLAARRATDDVSTLVARLGGHPKVAAE |
| Ga0318549_101454261 | 3300032041 | Soil | TMLSPGRDRRAIMPTITLAARKPTDDISTLVARLGGHPKVAAE |
| Ga0318510_100684773 | 3300032064 | Soil | ARRIASVLRRTMLSPGRDRRAIRPTITLAARKPTDDVGTLVARLGAHPKVAAE |
| Ga0318510_100788523 | 3300032064 | Soil | HTMLSPGRDRRAIKPTITLAARRATDDVSTLVARLGSHPKVAAE |
| Ga0318510_101448341 | 3300032064 | Soil | SPGRDRRAIQPTITLAALKRSDDLGTLVARLGSQAVVAAE |
| Ga0318513_100553841 | 3300032065 | Soil | TMLSPGRDRRAIKPMITLAARRATDDVSTLVARLGSHPKVAAE |
| Ga0318514_100339943 | 3300032066 | Soil | RAIRPTITLASLKPTDNMSSLVARVGAYPKIAVAR |
| Ga0307470_113271661 | 3300032174 | Hardwood Forest Soil | IASVLRHTMISPERDRRTIRPTITLATLKASDNLSTLVARVGAYPKVAASR |
| Ga0306920_1000465444 | 3300032261 | Soil | MLSPGRDRRAIKPTITLAARRATDDVSTLVARLGGHPKVAAE |
| Ga0306920_1008398631 | 3300032261 | Soil | TMLSPGRDRRTIRPSITLATFKPTDNLTTLVARVGAYPKASLAN |
| Ga0306920_1041129952 | 3300032261 | Soil | RRIASVLRQTMVSPGRDRRTIRPTITLATFKPTDNLSTLVARVGAYPKPIAVRS |
| Ga0247829_111215061 | 3300033550 | Soil | HVVARRMASVLMRTMVSSDRDRHTIKPTITLAALKPTDNLNTLVARIGASSQVAAE |
| ⦗Top⦘ |