NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F025433

Metagenome / Metatranscriptome Family F025433

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025433
Family Type Metagenome / Metatranscriptome
Number of Sequences 201
Average Sequence Length 151 residues
Representative Sequence MKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Number of Associated Samples 137
Number of Associated Scaffolds 201

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 5.00 %
% of genes near scaffold ends (potentially truncated) 67.16 %
% of genes from short scaffolds (< 2000 bps) 99.50 %
Associated GOLD sequencing projects 132
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.502 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine
(36.318 % of family members)
Environment Ontology (ENVO) Unclassified
(84.577 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(80.597 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 39.89%    β-sheet: 3.28%    Coil/Unstructured: 56.83%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.50 %
UnclassifiedrootN/A0.50 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300003683|Ga0008459J53047_1035385All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300008929|Ga0103732_1021711All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium923Open in IMG/M
3300008929|Ga0103732_1050034All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum640Open in IMG/M
3300008930|Ga0103733_1040482All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium737Open in IMG/M
3300008931|Ga0103734_1031448All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum793Open in IMG/M
3300008932|Ga0103735_1012406All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1092Open in IMG/M
3300008933|Ga0103736_1011607All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1049Open in IMG/M
3300008936|Ga0103739_1051929All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300008938|Ga0103741_1102949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum577Open in IMG/M
3300008958|Ga0104259_1025805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300008958|Ga0104259_1029892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum567Open in IMG/M
3300008993|Ga0104258_1075877All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum627Open in IMG/M
3300008993|Ga0104258_1080860All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300008993|Ga0104258_1082802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300008993|Ga0104258_1104359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300008993|Ga0104258_1115138All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300008993|Ga0104258_1115139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300009022|Ga0103706_10196634All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium524Open in IMG/M
3300009025|Ga0103707_10135586All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium565Open in IMG/M
3300009071|Ga0115566_10416334All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum772Open in IMG/M
3300009172|Ga0114995_10215409All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1064Open in IMG/M
3300009172|Ga0114995_10774759All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum525Open in IMG/M
3300009193|Ga0115551_1436869All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum561Open in IMG/M
3300009402|Ga0103742_1039823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum610Open in IMG/M
3300009422|Ga0114998_10263940All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum810Open in IMG/M
3300009433|Ga0115545_1163485All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum772Open in IMG/M
3300009436|Ga0115008_11132964All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300009441|Ga0115007_11176033All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium533Open in IMG/M
3300009445|Ga0115553_1368483All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300009476|Ga0115555_1231073All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum755Open in IMG/M
3300009497|Ga0115569_10462594All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum540Open in IMG/M
3300009498|Ga0115568_10162827All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum1054Open in IMG/M
3300009543|Ga0115099_10546926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum613Open in IMG/M
3300009543|Ga0115099_10595088All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum500Open in IMG/M
3300009592|Ga0115101_1170692All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum642Open in IMG/M
3300009592|Ga0115101_1448440All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300009599|Ga0115103_1695031All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum615Open in IMG/M
3300009677|Ga0115104_10364139All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300009679|Ga0115105_10007166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium526Open in IMG/M
3300010987|Ga0138324_10606195All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum548Open in IMG/M
3300012408|Ga0138265_1032290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum510Open in IMG/M
3300012408|Ga0138265_1115758All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum703Open in IMG/M
3300012408|Ga0138265_1457997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300012413|Ga0138258_1039265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300012413|Ga0138258_1185769All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium518Open in IMG/M
3300012414|Ga0138264_1544007All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300012415|Ga0138263_1508194All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium521Open in IMG/M
3300012416|Ga0138259_1154624All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300012416|Ga0138259_1182127All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300012417|Ga0138262_1465718All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium611Open in IMG/M
3300012417|Ga0138262_1601802All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300012418|Ga0138261_1084990All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300012418|Ga0138261_1179864All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum514Open in IMG/M
3300012418|Ga0138261_1239180All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum635Open in IMG/M
3300012418|Ga0138261_1760341All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum528Open in IMG/M
3300012767|Ga0138267_1059103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum614Open in IMG/M
3300012935|Ga0138257_1351523All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum713Open in IMG/M
3300017740|Ga0181418_1090278All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum745Open in IMG/M
3300017772|Ga0181430_1246993All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300018515|Ga0192960_107801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum504Open in IMG/M
3300018628|Ga0193355_1023780All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum582Open in IMG/M
3300018674|Ga0193166_1026541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum547Open in IMG/M
3300018674|Ga0193166_1028231All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300018674|Ga0193166_1032012All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium514Open in IMG/M
3300018684|Ga0192983_1040892All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300018684|Ga0192983_1042218All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium632Open in IMG/M
3300018684|Ga0192983_1060220All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300018692|Ga0192944_1038430All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum694Open in IMG/M
3300018692|Ga0192944_1039265All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300018692|Ga0192944_1039815All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum681Open in IMG/M
3300018692|Ga0192944_1043303All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300018730|Ga0192967_1062133All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum620Open in IMG/M
3300018745|Ga0193000_1041014All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium698Open in IMG/M
3300018763|Ga0192827_1054312All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium700Open in IMG/M
3300018763|Ga0192827_1063283All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium644Open in IMG/M
3300018779|Ga0193149_1045862All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium622Open in IMG/M
3300018779|Ga0193149_1046944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300018779|Ga0193149_1046946All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium615Open in IMG/M
3300018779|Ga0193149_1057600All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium552Open in IMG/M
3300018780|Ga0193472_1038677All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300018842|Ga0193219_1053190All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum622Open in IMG/M
3300018846|Ga0193253_1094795All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum702Open in IMG/M
3300018860|Ga0193192_1064674All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum509Open in IMG/M
3300018874|Ga0192977_1080849All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300018874|Ga0192977_1098249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium582Open in IMG/M
3300018874|Ga0192977_1105561All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium556Open in IMG/M
3300018893|Ga0193258_1238921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum503Open in IMG/M
3300018948|Ga0192985_1198540All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium623Open in IMG/M
3300018975|Ga0193006_10225113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum545Open in IMG/M
3300018975|Ga0193006_10249205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300018977|Ga0193353_10170345All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium645Open in IMG/M
3300018977|Ga0193353_10216926All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium554Open in IMG/M
3300018977|Ga0193353_10241597All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300018977|Ga0193353_10245313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300018980|Ga0192961_10090053All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum924Open in IMG/M
3300018980|Ga0192961_10159105All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum686Open in IMG/M
3300018980|Ga0192961_10247113All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300018997|Ga0193257_10189454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum604Open in IMG/M
3300019001|Ga0193034_10117387All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium624Open in IMG/M
3300019001|Ga0193034_10143264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium576Open in IMG/M
3300019021|Ga0192982_10268534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium612Open in IMG/M
3300019022|Ga0192951_10185788All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum754Open in IMG/M
3300019022|Ga0192951_10308468All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum598Open in IMG/M
3300019022|Ga0192951_10418721All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum506Open in IMG/M
3300019031|Ga0193516_10202372All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium658Open in IMG/M
3300019031|Ga0193516_10208358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium646Open in IMG/M
3300019031|Ga0193516_10270768All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium549Open in IMG/M
3300019033|Ga0193037_10214944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum658Open in IMG/M
3300019036|Ga0192945_10076896All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium1019Open in IMG/M
3300019036|Ga0192945_10093939All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum937Open in IMG/M
3300019036|Ga0192945_10222506All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum602Open in IMG/M
3300019036|Ga0192945_10251452All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum559Open in IMG/M
3300019045|Ga0193336_10372011All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium655Open in IMG/M
3300019045|Ga0193336_10393439All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300019048|Ga0192981_10313536All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300019084|Ga0193051_110021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum609Open in IMG/M
3300019095|Ga0188866_1022851All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum657Open in IMG/M
3300019095|Ga0188866_1024598All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum632Open in IMG/M
3300019097|Ga0193153_1027134All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum590Open in IMG/M
3300019108|Ga0192972_1073821All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium620Open in IMG/M
3300019108|Ga0192972_1096567All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium500Open in IMG/M
3300019118|Ga0193157_1021261All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium660Open in IMG/M
3300019131|Ga0193249_1134808All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum538Open in IMG/M
3300019133|Ga0193089_1093463All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum712Open in IMG/M
3300019133|Ga0193089_1100327All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum680Open in IMG/M
3300019133|Ga0193089_1129331All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum573Open in IMG/M
3300019149|Ga0188870_10126773All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300019150|Ga0194244_10090622All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum565Open in IMG/M
3300021342|Ga0206691_1873460All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum599Open in IMG/M
3300021345|Ga0206688_10400362All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium609Open in IMG/M
3300021348|Ga0206695_1648310All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium601Open in IMG/M
3300021350|Ga0206692_1717658All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum606Open in IMG/M
3300021353|Ga0206693_1734051All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium637Open in IMG/M
3300021353|Ga0206693_1874888All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium583Open in IMG/M
3300021359|Ga0206689_10891061All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300021872|Ga0063132_105559All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum537Open in IMG/M
3300021872|Ga0063132_106975All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum524Open in IMG/M
3300021875|Ga0063146_103706All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum634Open in IMG/M
3300021875|Ga0063146_114206All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium610Open in IMG/M
3300021887|Ga0063105_1033211All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum511Open in IMG/M
3300021889|Ga0063089_1027407All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum566Open in IMG/M
3300021901|Ga0063119_1019384All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium560Open in IMG/M
3300021921|Ga0063870_1009593All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum568Open in IMG/M
3300021921|Ga0063870_1065474All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum621Open in IMG/M
3300021927|Ga0063103_1030572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum562Open in IMG/M
3300021933|Ga0063756_1020833All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum516Open in IMG/M
3300021950|Ga0063101_1046212All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum619Open in IMG/M
3300021954|Ga0063755_1007358All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum647Open in IMG/M
3300023696|Ga0228687_1045249All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300025816|Ga0209193_1101461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300025869|Ga0209308_10241268All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum780Open in IMG/M
3300025894|Ga0209335_10241921All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum800Open in IMG/M
3300025897|Ga0209425_10321785All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum767Open in IMG/M
3300026461|Ga0247600_1101744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum569Open in IMG/M
3300026495|Ga0247571_1123263All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum607Open in IMG/M
3300026495|Ga0247571_1170027All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum517Open in IMG/M
3300028137|Ga0256412_1340550All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300028282|Ga0256413_1270398All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum601Open in IMG/M
3300028290|Ga0247572_1185455All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum523Open in IMG/M
3300028671|Ga0257132_1088580All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum664Open in IMG/M
3300028671|Ga0257132_1111700All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum581Open in IMG/M
3300030671|Ga0307403_10738171All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300030709|Ga0307400_10696823All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum631Open in IMG/M
3300030709|Ga0307400_10861828All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium557Open in IMG/M
3300030720|Ga0308139_1047454All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium642Open in IMG/M
3300030723|Ga0308129_1030945All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300030724|Ga0308138_1047763All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium602Open in IMG/M
3300030857|Ga0073981_10001419All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium614Open in IMG/M
3300030912|Ga0073987_10003686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum629Open in IMG/M
3300031062|Ga0073989_13577952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum530Open in IMG/M
3300031113|Ga0138347_11068306All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum571Open in IMG/M
3300031540|Ga0308143_126253All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum580Open in IMG/M
3300031621|Ga0302114_10251843All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300031626|Ga0302121_10118461All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum769Open in IMG/M
3300031638|Ga0302125_10158839All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum715Open in IMG/M
3300031702|Ga0307998_1116906All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum971Open in IMG/M
3300031710|Ga0307386_10570172All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium597Open in IMG/M
3300031710|Ga0307386_10716060All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium536Open in IMG/M
3300031710|Ga0307386_10731602All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum531Open in IMG/M
3300031710|Ga0307386_10776805All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium516Open in IMG/M
3300031725|Ga0307381_10348464All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium539Open in IMG/M
3300031738|Ga0307384_10381817All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum654Open in IMG/M
3300031738|Ga0307384_10448154All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium606Open in IMG/M
3300031738|Ga0307384_10467801All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum593Open in IMG/M
3300031743|Ga0307382_10529754All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium541Open in IMG/M
3300032360|Ga0315334_10969386All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium736Open in IMG/M
3300032360|Ga0315334_11576611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium561Open in IMG/M
3300032470|Ga0314670_10485021All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum646Open in IMG/M
3300032481|Ga0314668_10556781All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum583Open in IMG/M
3300032522|Ga0314677_10515197All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum636Open in IMG/M
3300032615|Ga0314674_10545016All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum596Open in IMG/M
3300032617|Ga0314683_10742728All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum595Open in IMG/M
3300032707|Ga0314687_10356919All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium804Open in IMG/M
3300032714|Ga0314686_10534274All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum576Open in IMG/M
3300032725|Ga0314702_1279626All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum638Open in IMG/M
3300032733|Ga0314714_10541606All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum649Open in IMG/M
3300032745|Ga0314704_10596339All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum603Open in IMG/M
3300032747|Ga0314712_10431367All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum625Open in IMG/M
3300032751|Ga0314694_10449313All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium → Strombidium inclinatum551Open in IMG/M
3300033572|Ga0307390_10885976All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Oligotrichia → Strombidiidae → Strombidium564Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine36.32%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine22.39%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine8.46%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater5.97%
Ocean WaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ocean Water4.98%
Ice Edge, Mcmurdo Sound, AntarcticaEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Ice Edge, Mcmurdo Sound, Antarctica4.98%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine4.48%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater3.98%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater3.48%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.49%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.50%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater1.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine1.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300003683Ammonia-oxidizing marine microbial communities from Monterey Bay, California, USA - Metatranscriptome CAN11_54_BLW_10 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300008929Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1AEnvironmentalOpen in IMG/M
3300008930Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1BEnvironmentalOpen in IMG/M
3300008931Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 1CEnvironmentalOpen in IMG/M
3300008932Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2AEnvironmentalOpen in IMG/M
3300008933Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 2BEnvironmentalOpen in IMG/M
3300008936Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 3BEnvironmentalOpen in IMG/M
3300008938Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4AEnvironmentalOpen in IMG/M
3300008958Marine microbial communities from eastern North Pacific Ocean - P1 particle-associatedEnvironmentalOpen in IMG/M
3300008993Marine microbial communities from eastern North Pacific Ocean - P1 free-livingEnvironmentalOpen in IMG/M
3300009022Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S1EnvironmentalOpen in IMG/M
3300009025Eukaryotic communities from seawater of the North Pacific Subtropical Gyre - HoeDylan_S2EnvironmentalOpen in IMG/M
3300009071Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405EnvironmentalOpen in IMG/M
3300009172Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_154EnvironmentalOpen in IMG/M
3300009193Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321EnvironmentalOpen in IMG/M
3300009402Eukaryotic and microbial communities from ice edge, McMurdo Sound, Antarctica - 4BEnvironmentalOpen in IMG/M
3300009422Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_138EnvironmentalOpen in IMG/M
3300009433Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330EnvironmentalOpen in IMG/M
3300009436Marine eukaryotic phytoplankton communities from Arctic Ocean - Fram Strait ARC3M MetagenomeEnvironmentalOpen in IMG/M
3300009441Marine eukaryotic phytoplankton communities from Arctic Ocean - Arctic Ocean ARC135M MetagenomeEnvironmentalOpen in IMG/M
3300009445Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331EnvironmentalOpen in IMG/M
3300009476Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407EnvironmentalOpen in IMG/M
3300009497Pelagic marine microbial communities from North Sea - COGITO_mtgs_120503EnvironmentalOpen in IMG/M
3300009498Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426EnvironmentalOpen in IMG/M
3300009543Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M2_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009592Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_20Mar14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009599Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - MBTS_5May14_M1_3um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009677Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_70_C50_10m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009679Marine eukaryotic communities from Pacific Ocean to study complex ecological interactions - CN13ID_155_C17_100m_0.8um Metatranscriptome (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012408Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 192hr light incubation - RNA23.A_192.20151118 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012414Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA16.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012415Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA15.ICE_1m.20151115 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012416Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA9.A_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012417Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA13.B_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012418Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 72hr light incubation - RNA12.A_72.20151113 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017772Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10EnvironmentalOpen in IMG/M
3300018515Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782216-ERR1712231)EnvironmentalOpen in IMG/M
3300018628Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001820 (ERX1782125-ERR1711885)EnvironmentalOpen in IMG/M
3300018674Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_026 - TARA_E400007200 (ERX1782187-ERR1712006)EnvironmentalOpen in IMG/M
3300018684Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782225-ERR1712160)EnvironmentalOpen in IMG/M
3300018692Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782155-ERR1712153)EnvironmentalOpen in IMG/M
3300018730Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_084 - TARA_N000001438 (ERX1782285-ERR1712028)EnvironmentalOpen in IMG/M
3300018745Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001746 (ERX1782385-ERR1712134)EnvironmentalOpen in IMG/M
3300018763Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000064 (ERX1782288-ERR1711868)EnvironmentalOpen in IMG/M
3300018779Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_022 - TARA_A100000698 (ERX1789670-ERR1719303)EnvironmentalOpen in IMG/M
3300018780Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_135 - TARA_N000002187 (ERX1789624-ERR1719497)EnvironmentalOpen in IMG/M
3300018842Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_046 - TARA_N000000267 (ERX1789679-ERR1719218)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018860Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_039 - TARA_N000000007 (ERX1782399-ERR1711861)EnvironmentalOpen in IMG/M
3300018874Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001024 (ERX1809749-ERR1740115)EnvironmentalOpen in IMG/M
3300018893Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001305 (ERX1789445-ERR1719354)EnvironmentalOpen in IMG/M
3300018948Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001040 (ERX1809757-ERR1740124)EnvironmentalOpen in IMG/M
3300018975Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_131 - TARA_N000002350 (ERX1782140-ERR1711881)EnvironmentalOpen in IMG/M
3300018977Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_111 - TARA_N000001816 (ERX1782322-ERR1711977)EnvironmentalOpen in IMG/M
3300018980Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001372 (ERX1782312-ERR1712127)EnvironmentalOpen in IMG/M
3300018997Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001303 (ERX1789387-ERR1719468)EnvironmentalOpen in IMG/M
3300019001Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_009 - TARA_X000001043 (ERX1782383-ERR1712007)EnvironmentalOpen in IMG/M
3300019021Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001034 (ERX1782268-ERR1711957)EnvironmentalOpen in IMG/M
3300019022Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001390 (ERX1782474-ERR1712194)EnvironmentalOpen in IMG/M
3300019031Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_142 - TARA_N000003104 (ERX1782386-ERR1711939)EnvironmentalOpen in IMG/M
3300019033Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_040 - TARA_N000000067 (ERX1782334-ERR1712080)EnvironmentalOpen in IMG/M
3300019036Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_082 - TARA_N000001382 (ERX1782404-ERR1712086)EnvironmentalOpen in IMG/M
3300019045Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_110 - TARA_N000001752 (ERX1782348-ERR1712224)EnvironmentalOpen in IMG/M
3300019048Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001030 (ERX1782209-ERR1712166)EnvironmentalOpen in IMG/M
3300019084Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001374 (ERX1809751-ERR1740125)EnvironmentalOpen in IMG/M
3300019095Metatranscriptome of marine microbial communities from Baltic Sea - GS694_3p0_dTEnvironmentalOpen in IMG/M
3300019097Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000393 (ERX1782443-ERR1712022)EnvironmentalOpen in IMG/M
3300019108Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_085 - TARA_N000001017 (ERX1809742-ERR1740135)EnvironmentalOpen in IMG/M
3300019118Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_025 - TARA_A100000396 (ERX1782223-ERR1711898)EnvironmentalOpen in IMG/M
3300019131Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001424 (ERX1809759-ERR1740116)EnvironmentalOpen in IMG/M
3300019133Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_083 - TARA_N000001377 (ERX1782440-ERR1712071)EnvironmentalOpen in IMG/M
3300019149Metatranscriptome of marine microbial communities from Baltic Sea - GS695_3p0_dTEnvironmentalOpen in IMG/M
3300019150Eukaryotic communities of water from different depths collected during the Tara Oceans expedition - TARA_N000000616 (ERX1782105-ERR1711908)EnvironmentalOpen in IMG/M
3300021342Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021345Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021348Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 200m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021350Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 40m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021353Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021359Metatranscriptome of ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 12015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021872Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C27 B21 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021875Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S30 C1 B23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021887Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021889Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-3S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021901Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-12 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021921Metatranscriptome of marine eukaryotic phytoplankton communities from Norwegian Sea - 10m ARK-5M ARK-5-3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021933Marine eukaryotic phytoplankton communities from the Norwegian Sea - 20m ARK-7M Euk - ARK-7-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021954Marine eukaryotic phytoplankton communities from the Norwegian Sea - 10m ARK-5M Euk ARK-5-1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300023696Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 52R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025816Pelagic marine microbial communities from North Sea - COGITO_mtgs_100330 (SPAdes)EnvironmentalOpen in IMG/M
3300025869Pelagic marine microbial communities from North Sea - COGITO_mtgs_120405 (SPAdes)EnvironmentalOpen in IMG/M
3300025894Pelagic Microbial community sample from North Sea - COGITO 998_met_09 (SPAdes)EnvironmentalOpen in IMG/M
3300025897Pelagic Microbial community sample from North Sea - COGITO 998_met_05 (SPAdes)EnvironmentalOpen in IMG/M
3300026461Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 75R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026495Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 24R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028137Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_74 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028282Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028290Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 25R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028671Metatranscriptome of marine microbial communities from Northeast Subartic Pacific Ocean, Canada - LP_J_2015_P26_10m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030720Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_952_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030723Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - AG5_1301_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030724Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB4_949_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030912Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S15_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031113Marine microbial communities from the Southern Atlantic ocean transect - DeepDOM_S7_Trap_metaT (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300031540Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB9_544_20m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031621Marine microbial communities from Western Arctic Ocean, Canada - AG5_SurfaceEnvironmentalOpen in IMG/M
3300031626Marine microbial communities from Western Arctic Ocean, Canada - CB21_surfaceEnvironmentalOpen in IMG/M
3300031638Marine microbial communities from Western Arctic Ocean, Canada - CB4_surfaceEnvironmentalOpen in IMG/M
3300031702Marine microbial communities from David Island wharf, Antarctic Ocean - #37EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031738Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031743Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032360Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 34915EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032481Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb1_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032615Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032725Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032745Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad8_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032747Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032751Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0008459J53047_103538513300003683SeawaterMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP*
Ga0103732_102171113300008929Ice Edge, Mcmurdo Sound, AntarcticaILLNNLQMKYTLAIVAILGMTTQETTAIALRCDGDDDDHSCEVFTPNMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAMAAAAEVLETHKGLTGEAKAAYLATYFPKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP*
Ga0103732_105003413300008929Ice Edge, Mcmurdo Sound, AntarcticaMKYTLAIVAILGMTTQETTAIALRCDGDDDDHSCEVFTPNMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAMAAASEVLETHKGLTGGAKASYLETYFPKAWKHFDVNQGGSIEVIKMPQFMRFICSDQYMSLQP*
Ga0103733_104048213300008930Ice Edge, Mcmurdo Sound, AntarcticaMKYTLAIVAILGMTTQETTAIALRCDGDDDDHSCEVFTPNMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAMAAAAEVLETHKGLTGEAKAAYLATYFPKAWRHFDVNQGGSIEVIKMPQFMRFICSDQYMSLQP*
Ga0103734_103144813300008931Ice Edge, Mcmurdo Sound, AntarcticaALRCDGDDDDHSCEVFTPNMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAMAAAAEVLETHKGLTGEAKAAYLATYFPKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP*
Ga0103734_104385513300008931Ice Edge, Mcmurdo Sound, AntarcticaISFVIVNNFNGILLNNLQMKYTLAIVAILGMTTQETTAIALRCDGDDDDHSCEVFTPNMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAMAAASEVLETHKGLTGGAKASYLETYFPKAWKHFDVNQGGSIEVIKMPQFMRFICSDQYMSLQP*
Ga0103735_101240613300008932Ice Edge, Mcmurdo Sound, AntarcticaMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAKAAAAEVLETHKGLTGGAKAAYLDTYFPKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP*
Ga0103736_101160713300008933Ice Edge, Mcmurdo Sound, AntarcticaMKYTLAIVAILGMTTQETTAIALRCDGDDDDHSCEVFTPNMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAMAAAAEVLETHKGLTGEAKAAYLATYFPKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP*
Ga0103739_105192913300008936Ice Edge, Mcmurdo Sound, AntarcticaALRCDGDDDDHSCEVFTPNMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAKAAAAEVLETHKGLTGGAKASYLETYFPKAWKHFDVNQGGSIEVIKMPQFMRFICSDQYMSLQP*
Ga0103741_110294913300008938Ice Edge, Mcmurdo Sound, AntarcticaALRCDGDDDDHSCEVFTPNMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAMAAASEVLETHKGLTGGAKASYLETYFPKAWKHFDVNQGGSIEVIKMPQFMRFICSDQYMSLQP*
Ga0104259_102580513300008958Ocean WaterMKYTLALVALLGLTNAVALRGGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFAKAWKHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP*
Ga0104259_102989213300008958Ocean WaterKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP*
Ga0104258_107587713300008993Ocean WaterMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGAAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP*
Ga0104258_108086013300008993Ocean WaterYLTTIRMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP*
Ga0104258_108280213300008993Ocean WaterLLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFAKAWKHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP*
Ga0104258_110435913300008993Ocean WaterMKTFALVALLGLASVNAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTARFDGDSDDLFMRSMIKTYANEKKNKDGSPSGAFIMTESAARAASAEVLETHKGLTGGAKEAYLATYFPKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP*
Ga0104258_111513813300008993Ocean WaterMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPGQDGQVDGSYERKPNARFSEDTDDIFMRSMQETYANEKKNKDGSPSGNFIMTEAAARAASSEVLQTHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLLP*
Ga0104258_111513913300008993Ocean WaterMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLLP*
Ga0103706_1019663413300009022Ocean WaterNNLKMKYAVAIAALLATASAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADTDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGAARDSYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMDLGVSG*
Ga0103707_1013558613300009025Ocean WaterNNLKMKYAFAIAALLATTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFNEDSDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGAARDSYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP*
Ga0115566_1041633413300009071Pelagic MarineMKYTLALVALLGLTNAVALRGGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAASEVLETHKGLTGGAKQAYLDSYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP*
Ga0114995_1021540913300009172MarineMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP*
Ga0114995_1077475913300009172MarineMKYTLALVALLGLTNAVALRCDGDDDDHSCEVFTPGQDGQVDGSYERKPNARFSEDTDDIFMRSMQETYANEKKNKDGSPSGNFIMTEAAARAASSEVLQTHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMR
Ga0115551_143686913300009193Pelagic MarineMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERNANPRFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYM
Ga0103742_103982313300009402Ice Edge, Mcmurdo Sound, AntarcticaIVAILGMTTQETTAIALTTRCDGDDDDHSCEVFTPNMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAMAAASEVLETHKGLTGGAKASYLETYFPKAWKHFDVNQGGSIEVIKMPQFMRFICSDQYMSLQP*
Ga0114998_1026394023300009422MarineMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP*
Ga0115545_116348523300009433Pelagic MarineMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPGQDGQVDGSYERKPNARFSEDTDDIFMRSMQETYANEKKNYDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP*
Ga0115008_1113296413300009436MarineLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERNANPRFSEDTDDIFMRSMQETYANEKKNYDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP*
Ga0115007_1117603313300009441MarineMKFTLAIVALLGLTNAVALRGCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQ
Ga0115553_136848313300009445Pelagic MarineMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLNTYFAKAWRHFDVNQGGSIEV
Ga0115555_123107313300009476Pelagic MarineMKVTLAIVALLGLANAVALRCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAASEVLETHKGLTGGAKQAYLDSYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP*
Ga0115569_1046259413300009497Pelagic MarineDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAASEVLETHKGLTGGAKQAYLDSYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP*
Ga0115568_1016282713300009498Pelagic MarineMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLATYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP*
Ga0115099_1054692613300009543MarineDFYLTTIRMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP*
Ga0115099_1059508813300009543MarineMKTFALVALLGLASVNAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTARFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLATYFPKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP*
Ga0115101_117069213300009592MarineLTEFYLTTIRMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP*
Ga0115101_144844013300009592MarineMKTFALVALLGLASVNAVNLRCDGDDDDHSCEVFTPDMDGQVDGSYERVVTARFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLATYFPKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP*
Ga0115103_169503113300009599MarineILTEFYLTTIRMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP*
Ga0115104_1036413913300009677MarineDSDAQNVALRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDTDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEGAARAASAEVLETHKGLAGAAKEAYLATYFPKAWKHFDVNQGGSIEVIKMPQFMRFLSSDQYMSLQP*
Ga0115105_1000716613300009679MarineTSAVRLHDCGGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGAARDGYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMSLQP*
Ga0138324_1060619513300010987MarineNLKMKFVLALFLGLTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGARAAAMEVLETHKGLSGGARDQYMGTYFPKAWRHFDVNVSGSIEVIKMPQFMRFLCSDQYMSLQP*
Ga0138265_103229013300012408Polar MarineMKFTLAIVALVSFTSAIKLQDCDGDADDHSCEVFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLQTHKGLSGGALDAYMQTYFPKAWRHFDVNVTGAIESIKMPQFMRFLSSDQYMTLQP*
Ga0138265_111575823300012408Polar MarineMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLETHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLSSDQYMTLQP*
Ga0138265_145799713300012408Polar MarineILNNLKMKFTLAIAALLGFTSAIKLQDCGGDADDHSCETFTPQQDGMVDDGYKRAVTARFDADSDDIFMRSMIKTYSLEKKNKDGSPSGAFIMTEAGARAAAMEVLQTHKGLSGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLASDQYMTLQP*
Ga0138258_103926513300012413Polar MarineIKMKFTLAIVALLGFTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLQTHKGLSGGALDAYMQTYFPKAWRHFDFNVTGPLSPSRCHNS*
Ga0138258_118576913300012413Polar MarineGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLETHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLSSDQYMTLQP*
Ga0138264_154400713300012414Polar MarineRIILNNLKMKFTLAIAALLGFTSAIKLQDCGGDADDHSCETFTPQQDGMVDDGYKRAVTARFDADSDDIFMRSMIKTYSLEKKNKDGSPSGAFIMTEAGTRAAAMEVLQTHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAVEVIKMPQFMRFLASDQYMTLQP*
Ga0138263_150819413300012415Polar MarineLKMKFTLAIVALVGVTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLQTHKGLSGGALDAYMQTYFPKAWRHFDVNVTGAIESIKMPQFMRFLASDQYMTLQP*
Ga0138259_115462413300012416Polar MarineKMKFTLAIVALLGFTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLQTHKGLSGGALDAYMQTYFPKAWRHFDVNVTGAIESIKMPQFMRFLASDQYMTLQP*
Ga0138259_118212713300012416Polar MarineNNLKMKFTLAIAALLGFTSAIKLQDCGGDADDHSCETFTPQQDGMLDDGYKRAVTARFDADSDDIFMRSMIKTYSLEKKNKDGSPSGAFIMTEAGTRAAAMEVLQTHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAVEVIKMPQFMRFLASDQYMTLQP*
Ga0138262_146571813300012417Polar MarineMKFTLAIAALLGFTSAIKLQDCGGDADDHSCETFTPQQDGMVDDGYKRAVTARFDADSDDIFMRSMIKTYSLEKKNKDGSPSGAFIMTEAGTRAAAMEVLQTHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAVEVIKMPQFMRFLASDQYMTLQP*
Ga0138262_160180213300012417Polar MarineMKFTLAIVALVGVTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDTDSDDIFMRSMIKTYSLEKKNKDGSPSGAFIMTEAGARAAAMEVLQTHKGLSGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLASDQYMTLQP*
Ga0138261_108499013300012418Polar MarineMDGQVDGSYERVVTARFAEGSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTESATRAAASEVLETHKGLSGAAKEAYLNTYFGKAWRHFDVNQGGAVEVIKMPQLMRFLASDQYMSLQP*
Ga0138261_117986413300012418Polar MarineSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLQTHKGLSGGALDAYMQTYFPKAWRHFDVNVTGAIESIKMPQFMRFLASDQYMTLQP*
Ga0138261_123918013300012418Polar MarineMLDDGYKRAVTARFNEDSDDIFMRSMIATYSLEKKNKDGSPAGAFIMTESGARAASMEVLNTHKGLSGDALESYMSTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLASDQYMTLLP*
Ga0138261_176034113300012418Polar MarineAIAAIALVGLTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDTDSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGSRAAAMEVLGTHKGLDGAALASYMESYFPKAWRHFDVNVTGAIEVIKMPQFMRFLASDQYMTLI*
Ga0138267_105910323300012767Polar MarineMLDKGYERAVTARFDADSDDIFMRSMIKPYALEKKNKDGSPSGAFIMNEAGARAAAMEVLETHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLSSDQYMTLQP*
Ga0138257_135152323300012935Polar MarineMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEVAAKAAAAEVLETHKGLTGGAKAAYLDTYFPKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP*
Ga0181418_109027813300017740SeawaterMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSVAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP
Ga0181430_124699313300017772SeawaterMKTTHTIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDTDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEGAARAASAEVLETHKGLTGAAKEAYLATYFPKAWKHFDVNQGGSIEV
Ga0192960_10780113300018515MarineTPNMDGQVDGSYERVVTARFDGDGDDIFMKSMIKTYANEKKNKDGSPSGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLSTYFPKAWKHFDVNQGGSIEVIKMPQFMRFLSSDQYMSLQP
Ga0193355_102378013300018628MarineGCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGTFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0193166_102654113300018674MarineDHSCEVFSPQQDGMLDKGYERAVTARFNEDSDDIFMRSMIKTYALEKKNKDGSPSGVFIMNEAGARAAAMEVLETHKGLSGGAREAYMGTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMTLQP
Ga0193166_102823113300018674MarineAPQQDGMLDKGYERAVTPRFDADTDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0193166_103201213300018674MarineAPQQDGMLDKGYERAVTPRFDADTDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGAARDSYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0192983_104089213300018684MarineMKFTLAIVALLGFTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLQTHKGLSGGALDAYMQTYFPKAWRHFDVNVTGAIESIKMPQFMRFLASDQYMTLQP
Ga0192983_104221813300018684MarineMKFTLAIAALLGFTSAIKLQDCGGDADDHSCETFTPQQDGMVDDGYKRAVTARFDADSDDIFMRSMIKTYSLEKKNKDGSPSGAFIMTEAGTRAAAMEVLQTHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLASDQYMTLQP
Ga0192983_106022013300018684MarineCEVYTPNMDGQVDGSYERVVTARFAEGSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTESATRAAASEVLETHKGLSGAAKEAYLNTYFGKAWRHFDVNQGGAVEVIKMPQLMRFLASDQYMSLQP
Ga0192944_103843013300018692MarineMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPAGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLATYFPKAWKHFDVNQGGSIEVIKMPQFMRFLASDQYMSLLP
Ga0192944_103926513300018692MarineMKYTLALVALLGLTNAVALRGGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0192944_103981513300018692MarineMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERNANPRFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0192944_104330313300018692MarineMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPAGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP
Ga0192967_106213313300018730MarineEYVQESSESETESDEDVALRCDGDDDDHSCEVYTPNMDGQVDGSYERVVTARFAEGSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTESATRAAASEVLETHKGLSGAAKEAYLNTYFGKAWRHFDVNQGGAVEVIKMPQLMRFLASDQYMSLQP
Ga0193000_104101413300018745MarineMKFTTAIVALLGVTSAVRLHDCDGDADDHSCEVFAPQQDGMLDKGYERAVTPRFDADTDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLTGGARDQYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0192827_105431213300018763MarineELTELYLTTYKMKFTTAIVALLGVTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADTDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAASMEVLETHKGLTGAARDQYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0192827_106328313300018763MarineHGVIIFNGIILNNLKMKYALAIAALLGYSAAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFNEDSDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGAARDQYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0193149_104586213300018779MarineQLIYIMKLIALALLGLASAVRLHDCDGDADDHSCETFSPQQDGMVDKGYERKVTARFDADSDDIFMRSMIKTYALEKKNYDGSPAGVFVMTESGARAAALEVLQTHKGLTGAARDAYMATYFPKAWRHFDVNVTGGIEVIKMPQFMRFLCSDQYMYLW
Ga0193149_104694413300018779MarineLKMKFIAFALGLAAAVRLHDCDGDADDHSCETFSPQQDGMLDKGYERKVTARFDADSDDIFMRSMIKTYALEKKNYDGSPAGVFVMTESGARAAALEVLQTHKGLTGAARDQYMATYFPKAWRHFDVNVTGGIEVIKMPQFMRFLCSDQYMYLW
Ga0193149_104694613300018779MarineLKMKFIAFALGLAAAVRLHDCDGDADDHSCETFSPQQDGMLDKGYERKVTARFDADSDDIFMRSMIKTYALEKKNYDGSPSGTFVMTESGARAAALEVLETHKGLTGGARDSYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMYLW
Ga0193149_105760013300018779MarineQLIYIMKLIALALLGLASAVRLHDCDGDADDHSCETFSPQQDGMVDKGYERKVTARFDADSDDIFMRSMIKSYALEKKNYDGSPAGAFVMTESGARAAALEVLQTHKGLTGAARDQYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMYLW
Ga0193472_103867713300018780MarineNNLKMKFALVALLGVASAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGARAASMEVLNTHKGLSGGALDQYMATYFPKAWRHFDVNVSGSIEVIKMPQFMRFLCSDQYMALW
Ga0193219_105319013300018842MarineDAQNVALRCDGDDDDHSCEVFTPNMDGQVDGSYERKVTPRFEEDTDDIFMRSMIKTYANEKKNYDGSPSGAFIMTEGAARAAAAEVLETHKGLTGAAKEAYLATYFPKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLGESG
Ga0193253_109479513300018846MarineMKTFALVALLGLASVNAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTARFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLATYFPKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLLP
Ga0193192_106467413300018860MarineVFSPQQDGILDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNYDGSPSGNFIMNEAGARAASMEVLNTHKGLSGGALDQYMATYFPKAWRHFDVNVSGSIEVIKMPQFMRFLCSDQYMALW
Ga0192977_108084923300018874MarineKYAIAAIALVGLTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAIEVLETHKGLTGGAREAYMETYFPKAWRHFDVNVTGAIEVIKMPQFMRFLSSDQYMTLQP
Ga0192977_109824913300018874MarineKYAIAAIALVGLTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLQTHKGLSGGALDAYMQTYFPKAWRHFDVNVTGAIESIKMPQFMRFLASDQYMTLQP
Ga0192977_110556113300018874MarineMKFTLAIVALVGVTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGSRAAAMEVLGTHKGLDGAALASYMESYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMTLQP
Ga0193258_123892113300018893MarineMKTFALVALLGLASVNAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTARFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLATYFPKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0192985_119854023300018948MarineMKFTLAIVALVGVTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLETHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLSSDQYMTLQP
Ga0193006_1022511313300018975MarineMGTELYLTTYKMKFTTAIVALLGVTSAVRLHDCDGDADDHSCEVFTPQQDGMLDKGYERAVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0193006_1024920513300018975MarineDKGYERAVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0193353_1017034513300018977MarineMGIIIFNGIILNNLKMKYALVMLLGLASAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERNVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0193353_1021692613300018977MarineTWGTYKMKFTLAIALLGVTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERNVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGARAASIEVLGTHKGLSGDALSSYMATYFPKAWRHFDVNVTGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0193353_1024159713300018977MarineTPQQDGMLDKGYERAVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGSFIMNEAGARAAAMEVLETHKGLSGAARDSYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0193353_1024531313300018977MarineTPQQDGMLDKGYERAVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0192961_1009005323300018980MarineMDGQGDNSYERVVTARFDGDSDDIFMRSMIKSYANEKKNKDGSPSGKFIMTEAAAMAASSEVLETHKGLTGSTKAEYLESYFPKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0192961_1015910513300018980MarineMKYTLALVALLGLTNAVALRGGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAASEVLETHKGLTGGAKQAYLDSYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0192961_1024711313300018980MarineMKTFALVALLGLASVNAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPAGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLATYFPKAWKHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0193257_1018945413300018997MarineFYLTTIRMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP
Ga0193034_1011738713300019001MarineMKFIAFALGLAAAVRLHDCDGDADDHSCETFSPQQDGMLDKGYERKVTARFDADSDDIFMRSMIKTYALEKKNYDGSPSGTFVMTESGARAAALEVLETHKGLTGGARDSYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMYLW
Ga0193034_1014326413300019001MarineMKFIAFALGLAAAVRLHDCDGDADDHSCETFSPQQDGMVDKGYERKVTARFDADSDDIFMRSMIKSYALEKKNYDGSPAGAFVMTESGARAAALEVLQTHKGLTGAARDQYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMYLW
Ga0192982_1026853413300019021MarineHGELNGIIKMKFTLAIVALLGFTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLQTHKGLSGGALDAYMQTYFPKAWRHFDVNVTGAIESIKMPQFMRFLASDQYMTLQP
Ga0192951_1018578813300019022MarineMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERNANPRFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLGESG
Ga0192951_1030846813300019022MarineHGGGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNSRFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFAKAWKHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0192951_1041872113300019022MarineMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPAGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLATYFPKAWKHFDVNQGGSIEVIKMPQFMRFLASDQYMS
Ga0193516_1020237213300019031MarineHGEFNRIILTTYIMKLFVLALLGASALRLHDCDGDADDHSCEVFTPQQDGMLDKGYERAVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGSFIMNEAGARAAAMEVLETHKGLSGAARDSYMATYFPKAWRHFDVNVSGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0193516_1020835813300019031MarineTWGLNNLKMKYALVMLLGLASAVRLHDCDGDADDHSCEVFTPQQDGMLDKGYERNVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0193516_1027076813300019031MarineDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGARAASMEVLETHKGLTGAARDQYMATYFPNAWRHFDVNVSGSIEVIKMPQFMRFLCSDQYMALW
Ga0193037_1021494413300019033MarineHGVIIFNGIILNNFKMKFVLALFLGLTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADTDDIFMRSMIKTYALEKKNKDGSPSGVFIMNEAGARAASMEVLETHKGLSGGEREAYMGAYFAKAWRHFDVNVTGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0192945_1007689613300019036MarineMDGQVDGSYERNVNARFSEDSDDIFMRSMQKTYANEKKNKDGSPSGAFIMTEAAARAAASEVLETHKGLTGAAKEAYLNTYFAKAWRHFDVNQGGSLEVIKMPQFMRFLASDQYMSLQP
Ga0192945_1009393913300019036MarineMDGQGDNSYERVVTARFDGDSDDIFMRSMIKSYANEKKNKDGSPSGKFIMTEAAAMAASSEVLETHKGLTGSTKADYLESYFPKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0192945_1022250613300019036MarineLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPAGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLATYFPKAWKHFDVNQGGSIEVIKMPQFMRFLASDQYMSLLP
Ga0192945_1025145213300019036MarineALRCDGDDDDHSCEVFTPGQDGQVDGSYERKPNARFSEDTDDIFMRSMQETYANEKKNYDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0193336_1037201113300019045MarineMGTYKMKFTTFVALLGVTAAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTARFDADTDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0193336_1039343913300019045MarineMGTYKMKFTTFVALLGVTAAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTARFDADTDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKARRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0192981_1031353623300019048MarineMLDDGYKRAVTARFNEDSDDIFMRSMIATYSLEKKNKDGSPAGAFIMTEAGARAASMEVLNTHKGLSGDALESYMSTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLASD
Ga0193051_11002113300019084MarineQLIQMKYTLALVALLGLTNAVALRGGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAASEVLETHKGLTGGAKQAYLDSYFAKAWRHFDVNQGGSIEVIKMPQFMRFLSSDQYMSLQP
Ga0188866_102285113300019095Freshwater LakeMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPGQDGQVDGSYERKPNARFSEDTDDIFMRSMQETYANEKKNYDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0188866_102459813300019095Freshwater LakeMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0193153_102713413300019097MarineMKFSLAIVALLGVSAIKLRDCDGDADDHSCEVFSPQQDGMLDKGYERAVTARFNEDSDDIFMRSMIKTYALEKKNKDGSPSGVFIMNEAGARAAAMEVLETHKGLSGGAREAYMGTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMQLGESG
Ga0192972_107382113300019108MarineKFTLAIVALVGVTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLETHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLSSDQYMTLQP
Ga0192972_109656713300019108MarineIALVGLTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLQTHKGLSGGALDAYMQTYFPKAWRHFDVNVTGAIESIKMPQFMRFLASDQYMTLQP
Ga0193157_102126123300019118MarineMKFAVFVALLGVTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGSFIMNEAGARAASMEVLETHKGLTGAARDSYMATYFPKAWRHFDVNVGGSLEVIKMPQFMRFLCSDQYMALW
Ga0193249_113480813300019131MarineCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATRAAASEVLETHKGLAGAAKEAYLNTYFAKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP
Ga0193089_109346313300019133MarineMKTFALVALLGLASVNAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPAGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLATYFPKAWKHFDVNQGGSIEVIKMPQFMRFLASDQYMSLLP
Ga0193089_110032723300019133MarineMGNYFNGIKIKRMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0193089_112933113300019133MarineDSDAANVALRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTARFDGDGDDIFMKSMIKTYANEKKNKDGSPSGAFIMTEGAARAASAEVLETHKGLTGGAKEAYLSTYFPKAWKHFDVNQGGSIEVIKMPQFMRFLSSDQYMSLQP
Ga0188870_1012677313300019149Freshwater LakeKKTKRMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLATYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLGESG
Ga0194244_1009062213300019150MarineAIKLRDCDGDADDHSCEVFSPQQDGMLDKGYERAVTARFNEDSDDIFMRSMIKTYALEKKNKDGSPSGVFIMNEAGARAAAMEVLETHKGLSGGAREAYMGTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMTLQP
Ga0206691_187346013300021342SeawaterTTYIMKLFVLALLGASALRLHDCDGDADDHSCEVFTPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNYDGSPSGSFIMNEAGARAAAMEVLETHKGLSGGARDSYMATYFPKAWRHFDVNVGGSLEVIKMPQFMRFLCSDQYMSLQP
Ga0206688_1040036213300021345SeawaterYKTTYKMKYAIILLLGLTSAVRLHDCDGNPDDHSCEVFGPQQDGMVDKGCERKVNARFDTDSDDIFMRSMQKTYALEKKNFDGSPSGAFIMNEAGARAAAREVLNTHKGLSGAALNDYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFICSDQYMALW
Ga0206695_164831013300021348SeawaterKLFVVALLGLTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADSDDIFMRSMIKTYALEKKSYDGSPSGAFIMNEAGARAAAMEVLETHKGLTGGARDQYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0206692_171765813300021350SeawaterMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFYGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP
Ga0206693_173405113300021353SeawaterITTYIMKLFVLALLGASALRLHDCDGDADDHSCEVFTPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNYDGSPSGSFIMNEAGARAAAMEVLETHKGLSGAARDSYMATYFPKAWRHFDVNVGGSLEVIKMPQFMRFLCSDQYMSLQP
Ga0206693_187488813300021353SeawaterGLASAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERNVTPRFDADSDDIFMRSMIKTYALEKKNYDGSPSGSFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVGGSLEVIKMPQFMRFLCSDQYMTLQP
Ga0206689_1089106113300021359SeawaterMKLIVVALLGLTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGGARDGYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0063132_10555913300021872MarineFYLTTIRMKTTLAIVALLGLATVEAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGNFIITEGAARAAASEVLETHKGLTGGAKEAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP
Ga0063132_10697513300021872MarineGILLNNYKMKTTLALVALLGLSSAVNLRCDGDDDDHSCEVFTPQMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGTRAAASEVLETHKGLTGAAKEAYLGTYFPKAWRHFDVNQGGSVEVIKMPQFMRFLCSDQYMSLQP
Ga0063146_10370613300021875MarineTQQLIQMKYTLALVALLGLTNAVALRKGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFSKAWKHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0063146_11420613300021875MarineLAIVALLGLTNAVALRGCDGDDDDHSCEVFTPNQDGQVDGSYERNANARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGAAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP
Ga0063105_103321113300021887MarineQQLIQMKYTLALVALLGLTNAVALRKGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFSKAWKHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0063089_102740713300021889MarineKRMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLATYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0063119_101938413300021901MarineNNLKMKYALAIAALLGYSAAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADTDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLTGGARDQYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0063870_100959313300021921MarineKTKRMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERKANARFSEDTDDLFMRSMQETYANEKKNYSGAPTGNFIMTEAAARAAASEVLETHKGLKGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0063870_106547413300021921MarineESNRKDGVDRAEGAYTNGNNVYPHPPELKDLQLRCDGDDDDHSCEVFTPNMDGQVDGSYERNVNARFSEDSDDIFMRSMQKTYANEKKNKDGSPSGAFIMTEAAARAAASEVLETHKGLTGGAKEAYLNTYFAKAWRHFDVNQGGSLEVIKMPQFMRFLASDQYMSLQP
Ga0063103_103057213300021927MarineRMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNANARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGAAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP
Ga0063756_102083313300021933MarineKRMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERKANARFSEDTDDLFMRSMQETYANEKKNYSGAPTGNFIMTEAAARAAASEVLETHKGLKGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0063101_104621213300021950MarineQQLIQMKYTLALVALLGLTNAVALRGGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFAKAWKHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0063755_100735813300021954MarineRNFTQQLIQMKYTLALVALLGLTNAVALRKGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFSKAWKHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0228687_104524913300023696SeawaterDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDTDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEGAARAASAEVLETHKGLAGAAKEAYLATYFPKAWKHFDVNQGGSIEVIKMPQFMRFLSSDQYMSLQP
Ga0209193_110146113300025816Pelagic MarineMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPGQDGQVDGSYERKPNARFSEDTDDIFMRSMQETYANEKKNYDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0209308_1024126823300025869Pelagic MarineMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0209335_1024192113300025894Pelagic MarineMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0209425_1032178513300025897Pelagic MarineMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0247600_110174413300026461SeawaterEFYLTTIRMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP
Ga0247571_112326313300026495SeawaterMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP
Ga0247571_117002713300026495SeawaterDHSCEVFTPNMDGQVDGSYERVVTPRFDTNDDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATRAAASEVLETHKGLAGAAKEAYLNTYFAKAWRHFDVNQGGAVEVIKMPQFMRFLASDQYMTLQP
Ga0256412_134055013300028137SeawaterSDEEDVALRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGSFIMTEAATRAAASEVLETHKGLAGAAKEAYLNTYFAKAWRHFDVNQGGAVEVIKMPQFMRFLASDQYMTLQP
Ga0256413_127039813300028282SeawaterLTEFYLTTIRMKTTLAIVALLGLAQINAVNLRCDGDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQWMSLKESG
Ga0247572_118545513300028290SeawaterDDDDHSCEVFTPNMDGQVDGSYERVVTPRFDGDSDDIFMRSMIKTYANEKKNKDGSPSGAFIMTEAATMAAASEVLETHKGLTGGAKQAYLATYFPKAWRHFDVNQGGSVEVIKMPQFMRFLASDQYMSLQP
Ga0257132_108858013300028671MarineTQQLIQMKYTLALVALLGLTNAVALRGGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFAKAWKHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0257132_111170013300028671MarineKTKRMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERNANARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGAAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP
Ga0307403_1073817113300030671MarineIKMKYAIAAIALVGLTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDTDSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGSRAAAMEVLGTHKGLDGAALASYMESYFPKAWRHFDVNVTGAIEVIKMPQFMRFLSSDQYMTLI
Ga0307400_1069682313300030709MarineLLNNLQMKYTLAIVAILGMTTQETTAIALTTRCDGDDDDHSCEVFTPNMDGQVDGAYERNVTPRFDADTDDIFMRSMIKNYANEKKTKDGSPSGAFIMTEGAAMAAASEVLETHKGLTGGAKASYLETYFPKAWKHFDVNQGGSIEVIKMPQFMRFICSDQYMSLQP
Ga0307400_1086182823300030709MarineFTLAIVALLGFTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNKDGSPSGAFIMNEAGARAAAMEVLETHKGLTGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLSSDQYMTLQP
Ga0308139_104745413300030720MarineMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERNANARFSEDTDDIFMRSMQKTYSNEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGAAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP
Ga0308129_103094513300030723MarineFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYSNEKKNKDGSPSGNFIMTEAAARAASSEVLQTHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQ
Ga0308138_104776313300030724MarineLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERNANARFSEDTDDIFMRSMQKTYSNEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGAAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP
Ga0073981_1000141913300030857MarineGIILNNLKMKYAVAIAALLATASAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADTDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGAARDSYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0073987_1000368613300030912MarineGIILNNLKMKYAFAIAALLATTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFNEDSDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0073989_1357795213300031062MarineGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADTDDIFMRSMIKTYALEKKNYDGSPSGVFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVSGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0138347_1106830613300031113MarineLNNLKMKYALAIAALLGYSAAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTPRFDADTDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGGARDQYMGTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0308143_12625313300031540MarineMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERNANARFSEDTDDIFMRSMQETYANEKKNKDGSPSGNFIMTEAAARAAASEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0302114_1025184323300031621MarineMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPGQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLQTHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0302121_1011846113300031626MarineMKYTLALVALLGLTNAVALRGGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFAKAWKHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0302125_1015883913300031638MarineMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPGQDGQVDGSYERKPNARFSEDTDDIFMRSMQETYANEKKNKDGSPSGNFIMTEAAARAASSEVLQTHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0307998_111690613300031702MarineEVFTPNMDGQVDGSYERNVTPRFDADTDDIFMRSMIKTYANEKKTKDGSPSGAFIMTEGAAKAAAAEVLETHKGLTGGAKAAYLDTYFPKAWRHFDVNQGGSIEVIKMPQFMRFIASDQYMSLQP
Ga0307386_1057017213300031710MarineLKMKFVLAVFLGLTSAVRLHDCDGDADDPSCEVFSPQQDGMLDKGYERAVTARFDADTDDIFMRSMIKTYALEKKNYDGSPSGVFIMNESGARAAAMEVLETHKGLAGGANASYMETYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0307386_1071606013300031710MarineELYLTTYKMKFATIVALLGVTSAVRLADCGGDGDDHSCETFSPGQDGMVDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNYDGSPSGAFIMTESGARAASMEVLGTHKGLSGGALDQYMGTYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMSFQ
Ga0307386_1073160223300031710MarineCGGDGDDHSCETFSPHQDGMVDGGYKRNVTPRFDADSDDIFMRSMIATYALEKKNYDGSPSGAFIMTESGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLASDQYMSLQA
Ga0307386_1077680513300031710MarineFTLAIVALLGATNAVRLADCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNYDGSPAGAFIMTESGARAAALEVLETHKGLSGAARAEYMAAYFPKAWRHFDVNVTGDIEVIKMPQFMRFLCSDQYMTLQP
Ga0307381_1034846413300031725MarineELYLTTYKMKFATIAALLGVTSAVRLADCGGDGDDHSCETFSPGQDGMVDKGYERAVTARFDADSDDIFMRSMIKTYALEKKNYDGSPAGAFIMTESGARAASMEVLGTHKGLSGGALDQYMGTYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMYLQP
Ga0307384_1038181713300031738MarineTNKMKFTTFVALIGAASAVRLADCGGDGDDHSCEVLTPQQDGMVDGGYERAVTARFDADSDDIFMRSMIKTYALEKKNYDGSPSGAFIMNEAGARAAAMEVLQTHKGLSGGARDQYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLASDQYMSLQA
Ga0307384_1044815413300031738MarineNNLKMKFVLAVFLGLTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTARFDADTDDIFMRSMIKTYALEKKNYDGSPSGVFIMNESGARAAAMEVLETHKGLAGGANASYMETYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0307384_1046780113300031738MarineMKFTAIVALIGAASAVKLADCGGDGDDHSCETFSPHQDGMVDGGYKRNVTPRFDADSDDIFMRSMIATYALEKKNYDGSPSGAFIMTESGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLASDQYMSLQA
Ga0307382_1052975413300031743MarineILNNLKMKFVLAVFLGLTSAVRLHDCDGDADDHSCEVFSPQQDGMLDKGYERAVTARFDADTDDIFMRSMIKTYALEKKNYDGSPSGVFIMNESGARAAAMEVLETHKGLAGGANASYMETYFPKAWRHFDVNVTGAIEVIKMPQFMRFLCSDQYMSLQP
Ga0315334_1096938613300032360SeawaterMKFIVAALLGLTAAVRLQDCGGDADDHSCEVFSPQQDGMLDKGYERAVTARFDADSDDIFMRSMIKTYALEKKSYDGSPSGAFIMNEAGARAAAMEVLETHKGLSGGARDQYMATYFPKAWRHFDVNVGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0315334_1157661113300032360SeawaterPQNPKTPYKRNSVKLIELQKSTYKKYKIKMKFIAVALIGLTAAIRLQDCDGDGDDHSCEVFTPQQDGMVDKGYERNVTPRFDTDDDDIFMRSMIKAYANEKKNYDGSPSGAFVMTESAARAASMEVLNTHKGLAGGALQSYMDTYFPKAWRHFDVNVTGGLEVIKMPQFMRFLCSDQYMTLQP
Ga0314670_1048502113300032470SeawaterRNKKTKRMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLATYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0314668_1055678113300032481SeawaterMKVTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLATYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0314677_1051519723300032522SeawaterMKVTLAIVALLGLTNAVALRGGCDGDDDDHSFEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAASEVLETHKGLTGGAKQAYLDSYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0314674_1054501613300032615SeawaterKRMRFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLATYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0314683_1074272813300032617SeawaterLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNMDGQVDGSYERNANPRFSEDTDDIFMRSMQKTYANEKKNYDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0314687_1035691913300032707SeawaterMDGQVDGSYERNVNARFSGDSDDIFMRSMQKTYANEKKNKDGSPSGAFIMTEAAARAAASEVLETHKGLTGAAKEAYLNTYFAKAWRHFDVNQGGSLEVIKMPQFMRFLASDQYMSLQP
Ga0314686_1053427413300032714SeawaterFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLATYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLLP
Ga0314702_127962613300032725SeawaterMKYTLALVALLGLTNAVALRGGCDGDDDDHSCEVFTPNMDGQVDGAYERKFNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAATEVLETHKGLTGGAKQAYLDSYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0314714_1054160613300032733SeawaterTQQLIQMKYTLALVALLGLTNAVALRGGCDGDDDDHSCEVFTPNMDGQVDGAYERKVNARFAEDTDDIFMRSMQETYANEKKNYDGTPSGNFIMTESAARAAASEVLETHKGLTGGAKQAYLDSYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0314704_1059633913300032745SeawaterKTKRMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLATYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0314712_1043136713300032747SeawaterKKTKRMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPGQDGQVDGSYERKPNARFSEDTDDIFMRSMQETYANEKKNYDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLGTYFAKAWRHFDVNQGGSIEVIKMPQFMRFLCSDQYMSLQP
Ga0314694_1044931313300032751SeawaterMKFTLAIVALLGLTNAVALRCDGDDDDHSCEVFTPNQDGQVDGSYERNPNARFSEDTDDIFMRSMQKTYANEKKNKDGSPSGNFIMTEAAARAASSEVLETHKGLTGGAKEAYLATYFAKAWRHFDVNQGGSIEVIKMPQFMRFLASDQYMSLQP
Ga0307390_1088597613300033572MarineMKFTLAIVALVGVTSAIKLQDCGGDADDHSCETFSPQQDGMLDKGYERAVTARFDADTDDIFMRSMIKTYALEKKNKDGSPSGAFIMTEAGARAAAMEVLQTHKGLSGGARDAYMQTYFPKAWRHFDVNVTGAIEVIKMPQFMRFLASDQYMTLQP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.