| Basic Information | |
|---|---|
| Family ID | F025419 |
| Family Type | Metagenome |
| Number of Sequences | 201 |
| Average Sequence Length | 44 residues |
| Representative Sequence | KTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Number of Associated Samples | 32 |
| Number of Associated Scaffolds | 201 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 6.47 % |
| % of genes near scaffold ends (potentially truncated) | 69.65 % |
| % of genes from short scaffolds (< 2000 bps) | 90.55 % |
| Associated GOLD sequencing projects | 32 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (76.617 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment (93.532 % of family members) |
| Environment Ontology (ENVO) | Unclassified (95.522 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Unclassified (94.527 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 37.88% β-sheet: 0.00% Coil/Unstructured: 62.12% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 201 Family Scaffolds |
|---|---|---|
| PF13490 | zf-HC2 | 2.49 |
| PF13511 | DUF4124 | 1.99 |
| PF00501 | AMP-binding | 1.49 |
| PF02774 | Semialdhyde_dhC | 1.49 |
| PF00490 | ALAD | 1.49 |
| PF04126 | Cyclophil_like | 1.49 |
| PF01726 | LexA_DNA_bind | 1.49 |
| PF04165 | DUF401 | 1.49 |
| PF14492 | EFG_III | 1.00 |
| PF02775 | TPP_enzyme_C | 1.00 |
| PF01909 | NTP_transf_2 | 1.00 |
| PF09723 | Zn-ribbon_8 | 1.00 |
| PF00441 | Acyl-CoA_dh_1 | 1.00 |
| PF00009 | GTP_EFTU | 1.00 |
| PF02910 | Succ_DH_flav_C | 1.00 |
| PF13377 | Peripla_BP_3 | 1.00 |
| PF02915 | Rubrerythrin | 1.00 |
| PF01934 | HepT-like | 1.00 |
| PF12704 | MacB_PCD | 1.00 |
| PF02954 | HTH_8 | 1.00 |
| PF01597 | GCV_H | 1.00 |
| PF14346 | DUF4398 | 1.00 |
| PF04015 | DUF362 | 1.00 |
| PF13672 | PP2C_2 | 0.50 |
| PF00149 | Metallophos | 0.50 |
| PF14691 | Fer4_20 | 0.50 |
| PF02545 | Maf | 0.50 |
| PF01661 | Macro | 0.50 |
| PF00578 | AhpC-TSA | 0.50 |
| PF01658 | Inos-1-P_synth | 0.50 |
| PF11741 | AMIN | 0.50 |
| PF02870 | Methyltransf_1N | 0.50 |
| PF01406 | tRNA-synt_1e | 0.50 |
| PF13464 | DUF4115 | 0.50 |
| PF12779 | WXXGXW | 0.50 |
| PF01740 | STAS | 0.50 |
| PF02195 | ParBc | 0.50 |
| PF00005 | ABC_tran | 0.50 |
| PF08713 | DNA_alkylation | 0.50 |
| PF12804 | NTP_transf_3 | 0.50 |
| PF04241 | DUF423 | 0.50 |
| PF02310 | B12-binding | 0.50 |
| PF00691 | OmpA | 0.50 |
| PF02518 | HATPase_c | 0.50 |
| PF07355 | GRDB | 0.50 |
| PF04014 | MazE_antitoxin | 0.50 |
| PF13193 | AMP-binding_C | 0.50 |
| PF01950 | FBPase_3 | 0.50 |
| PF03450 | CO_deh_flav_C | 0.50 |
| PF01906 | YbjQ_1 | 0.50 |
| PF02926 | THUMP | 0.50 |
| PF06325 | PrmA | 0.50 |
| PF08281 | Sigma70_r4_2 | 0.50 |
| PF10589 | NADH_4Fe-4S | 0.50 |
| PF04055 | Radical_SAM | 0.50 |
| PF00491 | Arginase | 0.50 |
| PF00174 | Oxidored_molyb | 0.50 |
| PF07238 | PilZ | 0.50 |
| PF00890 | FAD_binding_2 | 0.50 |
| PF01926 | MMR_HSR1 | 0.50 |
| PF01612 | DNA_pol_A_exo1 | 0.50 |
| PF00076 | RRM_1 | 0.50 |
| PF09861 | Lar_N | 0.50 |
| PF00462 | Glutaredoxin | 0.50 |
| PF02075 | RuvC | 0.50 |
| PF01314 | AFOR_C | 0.50 |
| PF06250 | YhcG_C | 0.50 |
| PF07963 | N_methyl | 0.50 |
| PF09285 | Elong-fact-P_C | 0.50 |
| PF07977 | FabA | 0.50 |
| PF00300 | His_Phos_1 | 0.50 |
| PF03205 | MobB | 0.50 |
| PF13727 | CoA_binding_3 | 0.50 |
| PF04255 | DUF433 | 0.50 |
| PF04256 | DUF434 | 0.50 |
| PF00583 | Acetyltransf_1 | 0.50 |
| PF16576 | HlyD_D23 | 0.50 |
| PF16653 | Sacchrp_dh_C | 0.50 |
| PF05168 | HEPN | 0.50 |
| PF00113 | Enolase_C | 0.50 |
| PF00528 | BPD_transp_1 | 0.50 |
| PF00749 | tRNA-synt_1c | 0.50 |
| PF00276 | Ribosomal_L23 | 0.50 |
| PF13649 | Methyltransf_25 | 0.50 |
| PF01862 | PvlArgDC | 0.50 |
| PF02687 | FtsX | 0.50 |
| PF07883 | Cupin_2 | 0.50 |
| PF13343 | SBP_bac_6 | 0.50 |
| PF01476 | LysM | 0.50 |
| PF02219 | MTHFR | 0.50 |
| PF04390 | LptE | 0.50 |
| PF05635 | 23S_rRNA_IVP | 0.50 |
| PF13635 | DUF4143 | 0.50 |
| PF01475 | FUR | 0.50 |
| PF02618 | YceG | 0.50 |
| PF00892 | EamA | 0.50 |
| PF09084 | NMT1 | 0.50 |
| PF02801 | Ketoacyl-synt_C | 0.50 |
| PF13654 | AAA_32 | 0.50 |
| PF01300 | Sua5_yciO_yrdC | 0.50 |
| PF09413 | DUF2007 | 0.50 |
| PF02563 | Poly_export | 0.50 |
| PF16491 | Peptidase_M48_N | 0.50 |
| PF00990 | GGDEF | 0.50 |
| PF12801 | Fer4_5 | 0.50 |
| PF03453 | MoeA_N | 0.50 |
| PF10387 | DUF2442 | 0.50 |
| PF10023 | Aminopep | 0.50 |
| PF03330 | DPBB_1 | 0.50 |
| PF07813 | LTXXQ | 0.50 |
| PF01182 | Glucosamine_iso | 0.50 |
| PF10518 | TAT_signal | 0.50 |
| PF03466 | LysR_substrate | 0.50 |
| PF01170 | UPF0020 | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 201 Family Scaffolds |
|---|---|---|---|
| COG3678 | Periplasmic chaperone Spy, Spy/CpxP family | Posttranslational modification, protein turnover, chaperones [O] | 1.99 |
| COG1906 | Predicted GntP-related membrane permease AF0261, DUF401 family | General function prediction only [R] | 1.49 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 1.49 |
| COG0113 | Delta-aminolevulinic acid dehydratase, porphobilinogen synthase | Coenzyme transport and metabolism [H] | 1.49 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 1.49 |
| COG2361 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 1.00 |
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 1.00 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG2445 | Uncharacterized HEPN domain protein YutE, UPF0331/DUF86 family | General function prediction only [R] | 1.00 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 1.00 |
| COG2006 | Uncharacterized conserved protein, DUF362 family | Function unknown [S] | 1.00 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 1.00 |
| COG2110 | O-acetyl-ADP-ribose deacetylase (regulator of RNase III), contains Macro domain | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.50 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.50 |
| COG2250 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.50 |
| COG2263 | Predicted RNA methylase | General function prediction only [R] | 0.50 |
| COG1980 | Archaeal fructose 1,6-bisphosphatase | Carbohydrate transport and metabolism [G] | 0.50 |
| COG2265 | tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG2442 | Predicted antitoxin component of a toxin-antitoxin system, DUF433 family | Defense mechanisms [V] | 0.50 |
| COG2363 | Uncharacterized membrane protein YgdD, TMEM256/DUF423 family | Function unknown [S] | 0.50 |
| COG2414 | Aldehyde:ferredoxin oxidoreductase | Energy production and conversion [C] | 0.50 |
| COG1895 | HEPN domain protein, predicted toxin of MNT-HEPN system | Defense mechanisms [V] | 0.50 |
| COG2454 | Predicted nuclease, contains PIN domain | General function prediction only [R] | 0.50 |
| COG2813 | 16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG2980 | Outer membrane lipoprotein LptE/RlpB (LPS assembly) | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.50 |
| COG4123 | tRNA1(Val) A37 N6-methylase TrmN6 | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG4521 | ABC-type taurine transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.50 |
| COG4706 | Predicted 3-hydroxylacyl-ACP dehydratase, HotDog domain | Lipid transport and metabolism [I] | 0.50 |
| COG4804 | Predicted nuclease of restriction endonuclease-like (RecB) superfamily, DUF1016 family | General function prediction only [R] | 0.50 |
| COG4912 | 3-methyladenine DNA glycosylase AlkD | Replication, recombination and repair [L] | 0.50 |
| COG0393 | Uncharacterized pentameric protein YbjQ, UPF0145 family | Function unknown [S] | 0.50 |
| COG0008 | Glutamyl- or glutaminyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0010 | Arginase/agmatinase family enzyme | Amino acid transport and metabolism [E] | 0.50 |
| COG0018 | Arginyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0089 | Ribosomal protein L23 | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0116 | 23S rRNA G2445 N2-methylase RlmL | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0143 | Methionyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0148 | Enolase | Carbohydrate transport and metabolism [G] | 0.50 |
| COG0215 | Cysteinyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0286 | Type I restriction-modification system, DNA methylase subunit | Defense mechanisms [V] | 0.50 |
| COG0303 | Molybdopterin Mo-transferase (molybdopterin biosynthesis) | Coenzyme transport and metabolism [H] | 0.50 |
| COG0350 | DNA repair enzyme Ada (O6-methylguanine-DNA--protein-cysteine methyltransferase) | Replication, recombination and repair [L] | 0.50 |
| COG0363 | 6-phosphogluconolactonase/Glucosamine-6-phosphate isomerase/deaminase | Carbohydrate transport and metabolism [G] | 0.50 |
| COG1945 | Pyruvoyl-dependent arginine decarboxylase | Amino acid transport and metabolism [E] | 0.50 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.50 |
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.50 |
| COG0715 | ABC-type nitrate/sulfonate/bicarbonate transport system, periplasmic component | Inorganic ion transport and metabolism [P] | 0.50 |
| COG0735 | Fe2+ or Zn2+ uptake regulation protein Fur/Zur | Inorganic ion transport and metabolism [P] | 0.50 |
| COG0764 | 3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase | Lipid transport and metabolism [I] | 0.50 |
| COG0817 | Holliday junction resolvasome RuvABC endonuclease subunit RuvC | Replication, recombination and repair [L] | 0.50 |
| COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1092 | 23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1260 | Myo-inositol-1-phosphate synthase | Lipid transport and metabolism [I] | 0.50 |
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG1596 | Periplasmic protein Wza involved in polysaccharide export, contains SLBB domain of the beta-grasp fold | Cell wall/membrane/envelope biogenesis [M] | 0.50 |
| COG1763 | Molybdopterin-guanine dinucleotide biosynthesis protein | Coenzyme transport and metabolism [H] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 77.11 % |
| Unclassified | root | N/A | 22.89 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000229|TB_LI09_3DRAFT_1004641 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3700 | Open in IMG/M |
| 3300000229|TB_LI09_3DRAFT_1007767 | All Organisms → cellular organisms → Bacteria | 2903 | Open in IMG/M |
| 3300004481|Ga0069718_14696743 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium | 597 | Open in IMG/M |
| 3300012931|Ga0153915_13364056 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 518 | Open in IMG/M |
| 3300018070|Ga0184631_10089756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1185 | Open in IMG/M |
| 3300027897|Ga0209254_10177475 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1722 | Open in IMG/M |
| 3300027900|Ga0209253_10048363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3533 | Open in IMG/M |
| 3300027900|Ga0209253_10323187 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1192 | Open in IMG/M |
| 3300027900|Ga0209253_10772155 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 686 | Open in IMG/M |
| 3300030613|Ga0299915_10355506 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300030613|Ga0299915_10950111 | Not Available | 525 | Open in IMG/M |
| 3300031707|Ga0315291_10442359 | All Organisms → cellular organisms → Bacteria | 1223 | Open in IMG/M |
| 3300031707|Ga0315291_10452321 | Not Available | 1205 | Open in IMG/M |
| 3300031707|Ga0315291_10598564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1000 | Open in IMG/M |
| 3300031707|Ga0315291_10656870 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 939 | Open in IMG/M |
| 3300031707|Ga0315291_10673652 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 923 | Open in IMG/M |
| 3300031707|Ga0315291_10728952 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 875 | Open in IMG/M |
| 3300031707|Ga0315291_10730116 | Not Available | 874 | Open in IMG/M |
| 3300031707|Ga0315291_10756301 | All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Aminicenantes → unclassified Aminicenantes → Candidatus Aminicenantes bacterium | 853 | Open in IMG/M |
| 3300031707|Ga0315291_10938454 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Oxalobacteraceae → Herbaspirillum → unclassified Herbaspirillum → Herbaspirillum sp. BH-1 | 735 | Open in IMG/M |
| 3300031707|Ga0315291_10970750 | Not Available | 718 | Open in IMG/M |
| 3300031707|Ga0315291_10972658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 717 | Open in IMG/M |
| 3300031707|Ga0315291_11001555 | Not Available | 703 | Open in IMG/M |
| 3300031707|Ga0315291_11057192 | Not Available | 677 | Open in IMG/M |
| 3300031707|Ga0315291_11078475 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300031707|Ga0315291_11096799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 660 | Open in IMG/M |
| 3300031707|Ga0315291_11173192 | Not Available | 630 | Open in IMG/M |
| 3300031707|Ga0315291_11210028 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_50_11 | 617 | Open in IMG/M |
| 3300031707|Ga0315291_11394654 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_47_9 | 558 | Open in IMG/M |
| 3300031707|Ga0315291_11401833 | Not Available | 556 | Open in IMG/M |
| 3300031707|Ga0315291_11501953 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 530 | Open in IMG/M |
| 3300031707|Ga0315291_11564577 | Not Available | 515 | Open in IMG/M |
| 3300031707|Ga0315291_11577814 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 512 | Open in IMG/M |
| 3300031707|Ga0315291_11600356 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300031746|Ga0315293_10046103 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3794 | Open in IMG/M |
| 3300031746|Ga0315293_10319593 | Not Available | 1240 | Open in IMG/M |
| 3300031746|Ga0315293_10539985 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300031746|Ga0315293_10733003 | All Organisms → cellular organisms → Bacteria | 731 | Open in IMG/M |
| 3300031746|Ga0315293_10892045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 643 | Open in IMG/M |
| 3300031772|Ga0315288_10061536 | All Organisms → cellular organisms → Bacteria | 4424 | Open in IMG/M |
| 3300031772|Ga0315288_10116489 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3024 | Open in IMG/M |
| 3300031772|Ga0315288_10175899 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
| 3300031772|Ga0315288_10411818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1365 | Open in IMG/M |
| 3300031772|Ga0315288_10433044 | Not Available | 1320 | Open in IMG/M |
| 3300031772|Ga0315288_10642395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1013 | Open in IMG/M |
| 3300031772|Ga0315288_10819267 | All Organisms → cellular organisms → Bacteria | 856 | Open in IMG/M |
| 3300031772|Ga0315288_10989076 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 750 | Open in IMG/M |
| 3300031772|Ga0315288_11158674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 670 | Open in IMG/M |
| 3300031772|Ga0315288_11564451 | Not Available | 540 | Open in IMG/M |
| 3300031834|Ga0315290_10257338 | Not Available | 1525 | Open in IMG/M |
| 3300031834|Ga0315290_10684564 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 885 | Open in IMG/M |
| 3300031873|Ga0315297_10177344 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae | 1745 | Open in IMG/M |
| 3300031873|Ga0315297_10196475 | All Organisms → cellular organisms → Bacteria | 1659 | Open in IMG/M |
| 3300031873|Ga0315297_10206960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1617 | Open in IMG/M |
| 3300031873|Ga0315297_10288577 | All Organisms → cellular organisms → Bacteria | 1366 | Open in IMG/M |
| 3300031873|Ga0315297_10356607 | Not Available | 1224 | Open in IMG/M |
| 3300031873|Ga0315297_10532817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 987 | Open in IMG/M |
| 3300031873|Ga0315297_10575406 | All Organisms → cellular organisms → Bacteria | 946 | Open in IMG/M |
| 3300031873|Ga0315297_10721927 | Not Available | 833 | Open in IMG/M |
| 3300031873|Ga0315297_11096246 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300031873|Ga0315297_11312228 | All Organisms → cellular organisms → Archaea → Candidatus Thermoplasmatota → Thermoplasmata → Methanomassiliicoccales → unclassified Methanomassiliicoccales → Methanomassiliicoccales archaeon | 590 | Open in IMG/M |
| 3300031873|Ga0315297_11665476 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 511 | Open in IMG/M |
| 3300031885|Ga0315285_10130787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2123 | Open in IMG/M |
| 3300031885|Ga0315285_10137650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2054 | Open in IMG/M |
| 3300031885|Ga0315285_10264851 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1316 | Open in IMG/M |
| 3300031885|Ga0315285_10299114 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1207 | Open in IMG/M |
| 3300031885|Ga0315285_10361610 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1055 | Open in IMG/M |
| 3300031885|Ga0315285_10395349 | Not Available | 990 | Open in IMG/M |
| 3300031885|Ga0315285_10469296 | All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium | 874 | Open in IMG/M |
| 3300031885|Ga0315285_10606746 | Not Available | 724 | Open in IMG/M |
| 3300031885|Ga0315285_10748967 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 621 | Open in IMG/M |
| 3300031949|Ga0214473_10427365 | All Organisms → cellular organisms → Bacteria | 1491 | Open in IMG/M |
| 3300031952|Ga0315294_10049086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 4497 | Open in IMG/M |
| 3300031952|Ga0315294_10219330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1877 | Open in IMG/M |
| 3300031952|Ga0315294_10248688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_47_9 | 1736 | Open in IMG/M |
| 3300031952|Ga0315294_10280627 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1610 | Open in IMG/M |
| 3300031952|Ga0315294_10319813 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1483 | Open in IMG/M |
| 3300031952|Ga0315294_10704301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 885 | Open in IMG/M |
| 3300031952|Ga0315294_11100416 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300031952|Ga0315294_11344999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 569 | Open in IMG/M |
| 3300031997|Ga0315278_10060171 | All Organisms → cellular organisms → Bacteria | 3743 | Open in IMG/M |
| 3300031997|Ga0315278_10693926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1036 | Open in IMG/M |
| 3300031999|Ga0315274_10491239 | Not Available | 1391 | Open in IMG/M |
| 3300031999|Ga0315274_10665969 | All Organisms → cellular organisms → Bacteria | 1133 | Open in IMG/M |
| 3300031999|Ga0315274_10686547 | Not Available | 1110 | Open in IMG/M |
| 3300031999|Ga0315274_11318840 | Not Available | 702 | Open in IMG/M |
| 3300031999|Ga0315274_11414274 | Not Available | 668 | Open in IMG/M |
| 3300031999|Ga0315274_11488399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_47_9 | 644 | Open in IMG/M |
| 3300031999|Ga0315274_11627888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_16_47_11 | 604 | Open in IMG/M |
| 3300031999|Ga0315274_11631776 | Not Available | 603 | Open in IMG/M |
| 3300031999|Ga0315274_11784301 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 565 | Open in IMG/M |
| 3300031999|Ga0315274_11793065 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300031999|Ga0315274_11823780 | Not Available | 556 | Open in IMG/M |
| 3300031999|Ga0315274_11985660 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300032020|Ga0315296_10203143 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1183 | Open in IMG/M |
| 3300032020|Ga0315296_10237178 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
| 3300032020|Ga0315296_10240619 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1057 | Open in IMG/M |
| 3300032020|Ga0315296_10271259 | Not Available | 976 | Open in IMG/M |
| 3300032020|Ga0315296_10485202 | All Organisms → cellular organisms → Bacteria | 655 | Open in IMG/M |
| 3300032020|Ga0315296_10489716 | Not Available | 651 | Open in IMG/M |
| 3300032020|Ga0315296_10663375 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300032046|Ga0315289_10282237 | All Organisms → cellular organisms → Bacteria | 1734 | Open in IMG/M |
| 3300032046|Ga0315289_10352497 | Not Available | 1491 | Open in IMG/M |
| 3300032046|Ga0315289_10374698 | All Organisms → cellular organisms → Bacteria | 1429 | Open in IMG/M |
| 3300032046|Ga0315289_10539325 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 1107 | Open in IMG/M |
| 3300032046|Ga0315289_10685000 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 932 | Open in IMG/M |
| 3300032046|Ga0315289_10783067 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_47_9 | 844 | Open in IMG/M |
| 3300032046|Ga0315289_10855246 | All Organisms → cellular organisms → Bacteria | 790 | Open in IMG/M |
| 3300032046|Ga0315289_11011361 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 696 | Open in IMG/M |
| 3300032046|Ga0315289_11095615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 655 | Open in IMG/M |
| 3300032046|Ga0315289_11125055 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 642 | Open in IMG/M |
| 3300032046|Ga0315289_11129721 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 640 | Open in IMG/M |
| 3300032046|Ga0315289_11247862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium RBG_13_52_11b | 593 | Open in IMG/M |
| 3300032046|Ga0315289_11367927 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300032053|Ga0315284_10299162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2027 | Open in IMG/M |
| 3300032053|Ga0315284_10703165 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1187 | Open in IMG/M |
| 3300032053|Ga0315284_11334410 | Not Available | 775 | Open in IMG/M |
| 3300032053|Ga0315284_11625695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300032053|Ga0315284_11657905 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300032053|Ga0315284_11665501 | Not Available | 666 | Open in IMG/M |
| 3300032053|Ga0315284_11789284 | All Organisms → cellular organisms → Bacteria | 634 | Open in IMG/M |
| 3300032053|Ga0315284_11923912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 603 | Open in IMG/M |
| 3300032053|Ga0315284_11951892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 597 | Open in IMG/M |
| 3300032053|Ga0315284_12475745 | All Organisms → cellular organisms → Bacteria | 506 | Open in IMG/M |
| 3300032070|Ga0315279_10142477 | All Organisms → cellular organisms → Bacteria → FCB group → candidate division Zixibacteria → unclassified candidate division Zixibacteria → candidate division Zixibacteria bacterium SM1_73 | 1963 | Open in IMG/M |
| 3300032070|Ga0315279_10199040 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1559 | Open in IMG/M |
| 3300032070|Ga0315279_10278760 | All Organisms → cellular organisms → Bacteria | 1228 | Open in IMG/M |
| 3300032070|Ga0315279_10302988 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → unclassified Syntrophaceae → Syntrophaceae bacterium | 1156 | Open in IMG/M |
| 3300032070|Ga0315279_10454268 | Not Available | 857 | Open in IMG/M |
| 3300032070|Ga0315279_10481628 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 820 | Open in IMG/M |
| 3300032070|Ga0315279_10744638 | Not Available | 586 | Open in IMG/M |
| 3300032070|Ga0315279_10887960 | Not Available | 511 | Open in IMG/M |
| 3300032118|Ga0315277_10103054 | All Organisms → cellular organisms → Bacteria | 3214 | Open in IMG/M |
| 3300032118|Ga0315277_10294623 | All Organisms → cellular organisms → Bacteria | 1711 | Open in IMG/M |
| 3300032118|Ga0315277_10349115 | Not Available | 1537 | Open in IMG/M |
| 3300032118|Ga0315277_10736194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 942 | Open in IMG/M |
| 3300032118|Ga0315277_10911460 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 814 | Open in IMG/M |
| 3300032118|Ga0315277_10915522 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300032118|Ga0315277_11195590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 675 | Open in IMG/M |
| 3300032118|Ga0315277_11441759 | Not Available | 593 | Open in IMG/M |
| 3300032118|Ga0315277_11495299 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 578 | Open in IMG/M |
| 3300032143|Ga0315292_10081188 | All Organisms → cellular organisms → Bacteria | 2491 | Open in IMG/M |
| 3300032143|Ga0315292_10161447 | All Organisms → cellular organisms → Bacteria | 1811 | Open in IMG/M |
| 3300032143|Ga0315292_10238413 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1499 | Open in IMG/M |
| 3300032143|Ga0315292_10244330 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300032143|Ga0315292_10308939 | All Organisms → cellular organisms → Bacteria | 1317 | Open in IMG/M |
| 3300032143|Ga0315292_10797604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 791 | Open in IMG/M |
| 3300032143|Ga0315292_11574711 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 530 | Open in IMG/M |
| 3300032156|Ga0315295_10012188 | All Organisms → cellular organisms → Bacteria | 7490 | Open in IMG/M |
| 3300032156|Ga0315295_10113673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 2656 | Open in IMG/M |
| 3300032156|Ga0315295_10289796 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1658 | Open in IMG/M |
| 3300032156|Ga0315295_10433994 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300032156|Ga0315295_10523933 | Not Available | 1204 | Open in IMG/M |
| 3300032156|Ga0315295_10581486 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1135 | Open in IMG/M |
| 3300032156|Ga0315295_10911507 | All Organisms → cellular organisms → Bacteria | 876 | Open in IMG/M |
| 3300032156|Ga0315295_11384312 | Not Available | 682 | Open in IMG/M |
| 3300032156|Ga0315295_11528077 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 642 | Open in IMG/M |
| 3300032156|Ga0315295_11892308 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 563 | Open in IMG/M |
| 3300032156|Ga0315295_12115986 | All Organisms → cellular organisms → Bacteria | 525 | Open in IMG/M |
| 3300032156|Ga0315295_12237696 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 507 | Open in IMG/M |
| 3300032163|Ga0315281_10113193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 3124 | Open in IMG/M |
| 3300032163|Ga0315281_10709701 | Not Available | 1046 | Open in IMG/M |
| 3300032164|Ga0315283_10511510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1304 | Open in IMG/M |
| 3300032164|Ga0315283_11129626 | Not Available | 822 | Open in IMG/M |
| 3300032164|Ga0315283_11611534 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 660 | Open in IMG/M |
| 3300032177|Ga0315276_10331516 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1622 | Open in IMG/M |
| 3300032177|Ga0315276_10412940 | Not Available | 1446 | Open in IMG/M |
| 3300032177|Ga0315276_10443150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1393 | Open in IMG/M |
| 3300032177|Ga0315276_10452788 | All Organisms → cellular organisms → Bacteria | 1377 | Open in IMG/M |
| 3300032177|Ga0315276_11470153 | All Organisms → cellular organisms → Bacteria | 710 | Open in IMG/M |
| 3300032177|Ga0315276_11616716 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 671 | Open in IMG/M |
| 3300032342|Ga0315286_10370892 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfuromonadales | 1507 | Open in IMG/M |
| 3300032342|Ga0315286_10387352 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1470 | Open in IMG/M |
| 3300032342|Ga0315286_10514638 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1244 | Open in IMG/M |
| 3300032342|Ga0315286_10725950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1012 | Open in IMG/M |
| 3300032342|Ga0315286_11302305 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 705 | Open in IMG/M |
| 3300032342|Ga0315286_11685537 | Not Available | 600 | Open in IMG/M |
| 3300032342|Ga0315286_11763123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 583 | Open in IMG/M |
| 3300032342|Ga0315286_12112241 | Not Available | 520 | Open in IMG/M |
| 3300032397|Ga0315287_10739337 | All Organisms → cellular organisms → Bacteria | 1160 | Open in IMG/M |
| 3300032397|Ga0315287_11914623 | Not Available | 656 | Open in IMG/M |
| 3300032397|Ga0315287_12441045 | Not Available | 563 | Open in IMG/M |
| 3300032401|Ga0315275_11152324 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300032401|Ga0315275_11446923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 739 | Open in IMG/M |
| 3300032401|Ga0315275_11531455 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300032401|Ga0315275_11821860 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 645 | Open in IMG/M |
| 3300032401|Ga0315275_11984872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 613 | Open in IMG/M |
| 3300032516|Ga0315273_10087260 | All Organisms → cellular organisms → Bacteria | 4251 | Open in IMG/M |
| 3300032516|Ga0315273_10177439 | Not Available | 2918 | Open in IMG/M |
| 3300032516|Ga0315273_10377961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1912 | Open in IMG/M |
| 3300032516|Ga0315273_10380590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae | 1905 | Open in IMG/M |
| 3300032516|Ga0315273_10399244 | Not Available | 1854 | Open in IMG/M |
| 3300032516|Ga0315273_10427447 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1782 | Open in IMG/M |
| 3300032516|Ga0315273_10463340 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 1701 | Open in IMG/M |
| 3300032516|Ga0315273_10499795 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria | 1628 | Open in IMG/M |
| 3300032516|Ga0315273_10647540 | All Organisms → cellular organisms → Bacteria | 1396 | Open in IMG/M |
| 3300032516|Ga0315273_10811327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophorhabdales → Syntrophorhabdaceae → Syntrophorhabdus → Syntrophorhabdus aromaticivorans | 1217 | Open in IMG/M |
| 3300032516|Ga0315273_11018563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatiglans → Desulfatiglans anilini | 1058 | Open in IMG/M |
| 3300032516|Ga0315273_12111830 | Not Available | 665 | Open in IMG/M |
| 3300032516|Ga0315273_13064327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium | 521 | Open in IMG/M |
| 3300033489|Ga0299912_11125242 | Not Available | 577 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 93.53% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.99% |
| Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.50% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.50% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.50% |
| Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Cave Water → Groundwater | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000229 | Groundwater microbial communities from subsurface biofilms in sulfidic aquifier in Frasassi Gorge, Italy, sample from two redox zones- LI09_3 | Environmental | Open in IMG/M |
| 3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
| 3300012931 | Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaG | Environmental | Open in IMG/M |
| 3300018070 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_b1 | Environmental | Open in IMG/M |
| 3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
| 3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
| 3300030613 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT92D227 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031746 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_20 | Environmental | Open in IMG/M |
| 3300031772 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20 | Environmental | Open in IMG/M |
| 3300031834 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_0 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031885 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36 | Environmental | Open in IMG/M |
| 3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
| 3300031952 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40 | Environmental | Open in IMG/M |
| 3300031997 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_0 | Environmental | Open in IMG/M |
| 3300031999 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20 | Environmental | Open in IMG/M |
| 3300032020 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18 | Environmental | Open in IMG/M |
| 3300032046 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40 | Environmental | Open in IMG/M |
| 3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
| 3300032070 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20 | Environmental | Open in IMG/M |
| 3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
| 3300032143 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_0 | Environmental | Open in IMG/M |
| 3300032156 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_0 | Environmental | Open in IMG/M |
| 3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
| 3300032164 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_0 | Environmental | Open in IMG/M |
| 3300032177 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0 | Environmental | Open in IMG/M |
| 3300032342 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0 | Environmental | Open in IMG/M |
| 3300032397 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_0 | Environmental | Open in IMG/M |
| 3300032401 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0 | Environmental | Open in IMG/M |
| 3300032516 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0 | Environmental | Open in IMG/M |
| 3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| TB_LI09_3DRAFT_10046414 | 3300000229 | Groundwater | LPASSRKKTPKGGDVSFPLWKRGIEGDFIVILLISLAFEIHFSKG* |
| TB_LI09_3DRAFT_10077671 | 3300000229 | Groundwater | PCLPLPASRRRKTPKGGDVSFPLCVFFLPEAGKRGIEGDFMVILLISLAFEIHFSKG* |
| Ga0069718_146967432 | 3300004481 | Sediment | PKGGDVSFPLWRLFPAGGRQRGIEGDFMVILLISLAFEIHFSKG* |
| Ga0153915_133640561 | 3300012931 | Freshwater Wetlands | LKIPPRLSFPKGGDVSFPLWKRGIEGDLMVILLISLAFEIH |
| Ga0184631_100897563 | 3300018070 | Groundwater Sediment | VKKSLPASLFPPGQRPKGGDVSFPLWKRGIEGDFMVILLISLPFEIHFSKG |
| Ga0209254_101774753 | 3300027897 | Freshwater Lake Sediment | LKIPPYLPFPKGGDISFPLWKRGIEGDFMVILLISLAFEIHFSKS |
| Ga0209253_100483634 | 3300027900 | Freshwater Lake Sediment | MIPKGGDVSFPLWKRGLEGDFMVILLISLAFEIHFSKG |
| Ga0209253_103231872 | 3300027900 | Freshwater Lake Sediment | LKIPPCLPFPKGGDVSFPLWKRGMEGDFMGILLISLAFEIHFSKG |
| Ga0209253_107721552 | 3300027900 | Freshwater Lake Sediment | LPASLFPPGQRPKGGDVSFPLWKRGVEGDFMVILLISLAFEIHFSKG |
| Ga0299915_103555061 | 3300030613 | Soil | PKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0299915_109501111 | 3300030613 | Soil | KGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315291_104423592 | 3300031707 | Sediment | LPAFGREKIPKGGDISFPLWKRGIEGDFMVILLISLAFEIHFSKS |
| Ga0315291_104523211 | 3300031707 | Sediment | FPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315291_105985643 | 3300031707 | Sediment | RPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315291_106568702 | 3300031707 | Sediment | MPRREALSGQRPKGGEVSFPLWKRGIEGDFMVILLIPLAFEIHF |
| Ga0315291_106736522 | 3300031707 | Sediment | RKKIPKGGDISFPLWKRGIEGDFMVILLISLAFEIHFSKC |
| Ga0315291_107289523 | 3300031707 | Sediment | LKIPPCLPASFFPPGQRPKGGDVSFPLWKRGIEGDFMVILSISLAFEIHFSK |
| Ga0315291_107301161 | 3300031707 | Sediment | LPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFPKG |
| Ga0315291_107563012 | 3300031707 | Sediment | LPAFGRKKIPKGGDISFPLWKRGIEGDFMVILLISLAFEIHFSKS |
| Ga0315291_109384541 | 3300031707 | Sediment | LKIPPRLPFPKGGDVSFPLWKRGIEGDFMVILLISLAFEIH |
| Ga0315291_109707502 | 3300031707 | Sediment | LPASSRKKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315291_109726581 | 3300031707 | Sediment | SGPPGQRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315291_110015552 | 3300031707 | Sediment | FSALKIPPCLPFPKGGDISFPLWKRGIEGDFIVILLIYLVFEIHF |
| Ga0315291_110571921 | 3300031707 | Sediment | LKIPPCLPLEKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315291_110784753 | 3300031707 | Sediment | LPASGRKKTPKGGDISFPLWKRGIEGDFMMILLISLAFEIHFSKD |
| Ga0315291_110967991 | 3300031707 | Sediment | PPGQRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315291_111731921 | 3300031707 | Sediment | PFPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315291_112100282 | 3300031707 | Sediment | ALKIPPCLPLPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315291_113946541 | 3300031707 | Sediment | PGQRPKGGDVSFPPWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315291_114018331 | 3300031707 | Sediment | LPASGRKKTPKGGDVSFPLWKRGIEGDVMVILLISLAFEIHFSKG |
| Ga0315291_115019531 | 3300031707 | Sediment | LPASGRRKTPKGGDVSVPLCKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315291_115645772 | 3300031707 | Sediment | LPASSRKKTPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315291_115778141 | 3300031707 | Sediment | SHLFHIWYQFSALKIPPCLPFPKGGDISFPLWKRGIEGDFIVILLNSLVFEIHF |
| Ga0315291_116003562 | 3300031707 | Sediment | LPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315293_100461031 | 3300031746 | Sediment | PFPKGGDISFPLWKRGIEGDFIVILLIFLAFEIHFSKG |
| Ga0315293_103195934 | 3300031746 | Sediment | GQRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315293_105399851 | 3300031746 | Sediment | SLFPPGQRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSEG |
| Ga0315293_107330031 | 3300031746 | Sediment | LFPPGQRPKGGEVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315293_108920452 | 3300031746 | Sediment | MIPLWRLFPAGGRQRGMEGDFMVILSISLAFEIHFSKG |
| Ga0315288_100615364 | 3300031772 | Sediment | ALKIPPCLPLPASGRKKTPKGGDVSFPLWKRGMEGDFMVILLISLAFEIHFSKG |
| Ga0315288_101164894 | 3300031772 | Sediment | LPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKS |
| Ga0315288_101758992 | 3300031772 | Sediment | LPASGRRKTPKGEDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315288_104118182 | 3300031772 | Sediment | MQYFSALKIPPCLPLPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315288_104330443 | 3300031772 | Sediment | KSLPTSLFPPGQRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315288_106423952 | 3300031772 | Sediment | LPASCRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315288_108192671 | 3300031772 | Sediment | KGGEVSFPLWERGIEGDFMVILLISLAFEIHFSKG |
| Ga0315288_109890761 | 3300031772 | Sediment | PASLFPPGQRPKGGDVSFPLWKRGIEGDFMVIHLISLAFEIHFSKG |
| Ga0315288_111586741 | 3300031772 | Sediment | PKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315288_115644511 | 3300031772 | Sediment | LPASGRRKTPKGGDVSFPLWKNGVEGDFMVMLLISLAFEI |
| Ga0315290_102573381 | 3300031834 | Sediment | LPASGRKKTPTGGDVSFPLWKRGMEGDFMVILLISLAFEIHFLKG |
| Ga0315290_106845643 | 3300031834 | Sediment | LWRLFPAGGRQRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315297_101773442 | 3300031873 | Sediment | MVSMPNHFPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315297_101964753 | 3300031873 | Sediment | QRPMGGEVSFPLWRLFPAGGRQRGIEGDFMVILLISLGFEIHF |
| Ga0315297_102069601 | 3300031873 | Sediment | LASGPPGQRPKGGEVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315297_102885773 | 3300031873 | Sediment | LKIPPYLPLPASGREKTPKGGDVSFPLWKRGIEGDFM |
| Ga0315297_103566071 | 3300031873 | Sediment | PKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFPKG |
| Ga0315297_105328172 | 3300031873 | Sediment | MVSMPNHFPKGGDAIFPLWKRGIEGDFMVIFLISLAFEIHFSKG |
| Ga0315297_105754061 | 3300031873 | Sediment | LASGPPGQRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIH |
| Ga0315297_107219273 | 3300031873 | Sediment | MVSMPNHFPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315297_110962461 | 3300031873 | Sediment | MVSMPNHFPKGGDVSFPLWKRGIEGDFMVILLIALVFEIHFSKG |
| Ga0315297_113122282 | 3300031873 | Sediment | LPASGRRKTPKGGDFTFPLWKRGIEGDFMVILLISLAFEIHCSSGDNF |
| Ga0315297_116654761 | 3300031873 | Sediment | PLWRLFPAGGRQRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315285_101307873 | 3300031885 | Sediment | LKIPPCLPLPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315285_101376501 | 3300031885 | Sediment | TPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315285_102648512 | 3300031885 | Sediment | AFLFPPGQRSKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315285_102991142 | 3300031885 | Sediment | QRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFPKG |
| Ga0315285_103616103 | 3300031885 | Sediment | LPASGREKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315285_103953492 | 3300031885 | Sediment | QRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315285_104692963 | 3300031885 | Sediment | KTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315285_106067462 | 3300031885 | Sediment | LPAFGRKKIPKGGDISFPLWKRGIEGDFMVILLISLAFEIHF |
| Ga0315285_107489673 | 3300031885 | Sediment | PKGGDISFPLWKRGIEGDFMVILLISLAFEIHFSKS |
| Ga0214473_104273652 | 3300031949 | Soil | LPASSRKKTPKGGDVSFPLWKRGIEGDFIVILLISLAFEIHFSKG |
| Ga0315294_100490866 | 3300031952 | Sediment | IPPCLPLPASGRRKTPKGGDVSFPLWKNGVEGDFMVMLLISLAFEIHFSKG |
| Ga0315294_102193301 | 3300031952 | Sediment | PLWRLFPAGGRQRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315294_102486881 | 3300031952 | Sediment | LPASSREKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315294_102806272 | 3300031952 | Sediment | LPASGRRKTPKGGDVSFPLWKRGIEEDFMVILLISLAFEIHFSKG |
| Ga0315294_103198131 | 3300031952 | Sediment | LPASCRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIH |
| Ga0315294_107043012 | 3300031952 | Sediment | RKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315294_111004162 | 3300031952 | Sediment | LPASGRKKTPKGGDVSFPLLKRGTEGDFMVILLISLAFEIHFS |
| Ga0315294_113449991 | 3300031952 | Sediment | LPASGRRKTPKGGDVSVPLCKRGIEGDFMVILLISLAFEI |
| Ga0315278_100601718 | 3300031997 | Sediment | LPAFGREKIPKGGDISFLWKRGIEGDFMVILLISLAFEIHFSKS |
| Ga0315278_106939262 | 3300031997 | Sediment | LPASSRKKTPKGGDVSFPLWKRGIEGDFMVILLIALVFEIHFSKG |
| Ga0315274_104912391 | 3300031999 | Sediment | PGQRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315274_106659691 | 3300031999 | Sediment | LPASGRKKTPKGGDVSFPLLKRGTEGDFMVILLISLAFEIHFSKG |
| Ga0315274_106865472 | 3300031999 | Sediment | LPASLFPPGQRPKGGDVSFPLWKRGIEGDFMVILLISLASEIHFSKG |
| Ga0315274_113188402 | 3300031999 | Sediment | LKIPPCLPLPASGRKKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315274_114142741 | 3300031999 | Sediment | LKIPPCLPLPASGRKKTPKGGDVSFPLWKRGMEGDFMVILLISLAFEIHFSKG |
| Ga0315274_114883991 | 3300031999 | Sediment | PASLFPPGQRPKGGDVSFPPWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315274_116278882 | 3300031999 | Sediment | LPASGRKKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315274_116317761 | 3300031999 | Sediment | LKIPPCLPLPASGRRKKPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315274_117843011 | 3300031999 | Sediment | LKIPLCLPLPASGRKKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315274_117930651 | 3300031999 | Sediment | RPKGGDVSFPLWKRGIEGDFMVILSISLAFEIHFSKG |
| Ga0315274_118237801 | 3300031999 | Sediment | FLKGGDVSFPLWKRGIEGDFMVILLISLAFKIHFSKG |
| Ga0315274_119856602 | 3300031999 | Sediment | LPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315296_102031431 | 3300032020 | Sediment | YLPLPASSRKKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315296_102371781 | 3300032020 | Sediment | LKIPPCLPFPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHF |
| Ga0315296_102406191 | 3300032020 | Sediment | LPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLVFEIH |
| Ga0315296_102712591 | 3300032020 | Sediment | EALSGQRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315296_104852022 | 3300032020 | Sediment | ASLFPPGQRPKGGDVSFPLWKRGIEGDFMVILSISLAFEIHFSKG |
| Ga0315296_104897161 | 3300032020 | Sediment | SLFPPGQRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFPKG |
| Ga0315296_106633751 | 3300032020 | Sediment | NTLALRKSLPASLFPPGQRPKGGEVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315289_102822371 | 3300032046 | Sediment | KGGDVSFPLWKRGIKGDFMVILLISLAFEIRFSKG |
| Ga0315289_103524971 | 3300032046 | Sediment | RPKGDDVSFPLWKRGIEGDFMVILLISLTFEIHFSKG |
| Ga0315289_103746983 | 3300032046 | Sediment | PFPASGRRKTPQGGDVSFPLWKRGIEGDFMVILLISLVFEILFSKG |
| Ga0315289_105393252 | 3300032046 | Sediment | LPASGRRKTPKGGDVSFPLWQRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315289_106850003 | 3300032046 | Sediment | IPPSLPFPKGGDISFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315289_107830671 | 3300032046 | Sediment | LPASGRRKKPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315289_108552462 | 3300032046 | Sediment | LFPPGQRPKGGDVSFPLWKRGIEGDFMVILLISLPFEIHFSKG |
| Ga0315289_110113612 | 3300032046 | Sediment | LPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKD |
| Ga0315289_110956151 | 3300032046 | Sediment | LPTSLYPPGQRPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315289_111250551 | 3300032046 | Sediment | LPASGRRKTSKGGDVSFPLWKRGIEGDFMVILLISLAFEIHF |
| Ga0315289_111297212 | 3300032046 | Sediment | PFPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315289_112478622 | 3300032046 | Sediment | LKIPPCLPASFFPPGQRPKGGDVSFPLWKRGIEGDFMVILSISLAFEIHFSKG |
| Ga0315289_113679272 | 3300032046 | Sediment | LPASGRKKTPKGGDVSFPLWKRGIEGDFMVILLIFLAFEIHFSKG |
| Ga0315284_102991621 | 3300032053 | Sediment | KTPKGGDVSFPLWKRGIEEDFMVILLISLAFEIHFSKG |
| Ga0315284_107031653 | 3300032053 | Sediment | LFPPGQRPKGGDVSFPLWKRGVEGDFMVILLISLAFEIHFSKG |
| Ga0315284_113344101 | 3300032053 | Sediment | FPSGPEALSGQRPKGGEVSFPLWKRGIEGNSMVILLISLAFEIHFSKG |
| Ga0315284_116256951 | 3300032053 | Sediment | SSREKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315284_116579051 | 3300032053 | Sediment | YFSALNIPPCLPLPASSRKKTPKGGDVGFPLWKRGMEGDFMVILLISLAFEIHFSKG |
| Ga0315284_116655012 | 3300032053 | Sediment | SSGLKIPPCLPFPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315284_117892841 | 3300032053 | Sediment | KTPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315284_119239122 | 3300032053 | Sediment | PGQRPKGGEVSFPLWKRGIEGDFMVILLIPLVFEIHF |
| Ga0315284_119518922 | 3300032053 | Sediment | LPASGRRKTSKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315284_124757452 | 3300032053 | Sediment | LKIPPRLPLPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKELKCYENL |
| Ga0315279_101424774 | 3300032070 | Sediment | IPPCLPLPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLTFEIHFSKG |
| Ga0315279_101990402 | 3300032070 | Sediment | PPGQRPKGGDVSFPLWKRGMEGDFMVILLISLVFEIHFSKG |
| Ga0315279_102787604 | 3300032070 | Sediment | SFPLWRLFPAGGRQRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315279_103029883 | 3300032070 | Sediment | LKIPPCLPLPASGRRKTPKGGDIGFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315279_104542681 | 3300032070 | Sediment | LPLPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIRFSKG |
| Ga0315279_104816282 | 3300032070 | Sediment | LKIPPCLPLPAPGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315279_107446381 | 3300032070 | Sediment | LPASGRRKTPKGGDVSFPLWNRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315279_108879601 | 3300032070 | Sediment | PKGGDVSLPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315277_101030541 | 3300032118 | Sediment | KGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKD |
| Ga0315277_102946231 | 3300032118 | Sediment | PKGGDVSFPLWKRGIEGDFMVILLISFNFFGFLNSFFKRLK |
| Ga0315277_103491152 | 3300032118 | Sediment | KSLPASLFPPGQRPKGGDLSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315277_107361943 | 3300032118 | Sediment | SALKIPPCLPFPKGGNISFPLWKRGIEGDFIVILLIFLAFEIHFSKG |
| Ga0315277_109114602 | 3300032118 | Sediment | LKIPPCLPFSKGGDVSFPLWKRGIEGDFMVILLISLAFEIH |
| Ga0315277_109155222 | 3300032118 | Sediment | GDVSFPLWKRGIEGDFMVILLISLAFKIHFSKGKAIQNRYISLGNKRRV |
| Ga0315277_111955901 | 3300032118 | Sediment | FSALKIPPCLPLPASGRRKTPKGGDVSFPLWKRGREGDFMVILLISLAFEIHFSKG |
| Ga0315277_114417592 | 3300032118 | Sediment | ASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHLSKG |
| Ga0315277_114952991 | 3300032118 | Sediment | RKTSKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315292_100811883 | 3300032143 | Sediment | PSFDRLRMVSMPNHFPKGGDVSFPLWKRGIEGDFMVILLIALVFEIHFSKG |
| Ga0315292_101614471 | 3300032143 | Sediment | KMIPQGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315292_102384131 | 3300032143 | Sediment | MVSMPNHFPKGGDVSFPLWRLFPAGGRQRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315292_102443303 | 3300032143 | Sediment | CLPFPKGGDVSFPLWKRGIEGDFMVILLIALAFAIHFSKG |
| Ga0315292_103089392 | 3300032143 | Sediment | MVSMPNHFPKGGDVSFPLWKRGIEGDFMVIFLISLVFEIYFSKKLSKMVS |
| Ga0315292_107976041 | 3300032143 | Sediment | YSGLKIPPCLPFPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315292_115747113 | 3300032143 | Sediment | KGGDVNFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315295_100121882 | 3300032156 | Sediment | LPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLIYLAFEIHFSKG |
| Ga0315295_101136733 | 3300032156 | Sediment | PCLPFPKGGDISFPLWKRGIEGDFIGILLIFLAFEIHFSKG |
| Ga0315295_102897963 | 3300032156 | Sediment | LPASGRRKTPKGGDVSFPLWKRGIEEEFMVILLISLAFEIHFSKG |
| Ga0315295_104339943 | 3300032156 | Sediment | SGPPGQRPKGGDVSFPLWKRGIKGDFMVILLISLAFEIRFSKG |
| Ga0315295_105239332 | 3300032156 | Sediment | KIPPCLPLPASGRKKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315295_105814862 | 3300032156 | Sediment | MPRREALSGQRPKGGEVSFPLWKRGIEGDFMVIFLISLAFEIHFSKG |
| Ga0315295_109115073 | 3300032156 | Sediment | QRPKGGDVGSPLWKRGIKGDFMVILLISLAFEIHFSKG |
| Ga0315295_113843122 | 3300032156 | Sediment | LPASSRKKTPKGGDVSFPLWKRGIEGDFMVILLIYLVFEIHFSKG |
| Ga0315295_115280772 | 3300032156 | Sediment | LPFSKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315295_118923082 | 3300032156 | Sediment | SGPPGQRPKGGEVSFPLWKRGREGDFMVILLISLAFEIHFSKG |
| Ga0315295_121159863 | 3300032156 | Sediment | PQGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315295_122376962 | 3300032156 | Sediment | PKGGDVSFPLWKRGIEGDFMVILLISLAFKIHFSKG |
| Ga0315281_101131934 | 3300032163 | Sediment | MGGDVSFPLWNRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315281_107097012 | 3300032163 | Sediment | IPPCLPLPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315283_105115101 | 3300032164 | Sediment | MKISPCLPFPKGGDISFPLWKRGIEGDFMVILLISLAFEIHFSRS |
| Ga0315283_111296261 | 3300032164 | Sediment | GREKTPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315283_116115341 | 3300032164 | Sediment | LPASCRRKTPKGGDFSFPLWKRGIEGDFMVILLISLAFEIHFS |
| Ga0315276_103315162 | 3300032177 | Sediment | LPASGREKTPKGGDVSFPLWKRGIEGDFMVILLIYLVFEIHFSKG |
| Ga0315276_104129401 | 3300032177 | Sediment | LASGLPGQRPKGGEVSFPLWPLFPAGGRQRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315276_104431501 | 3300032177 | Sediment | KIPPCLPLPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFKIHFSKG |
| Ga0315276_104527881 | 3300032177 | Sediment | GQRPKGGEVSFPLWRLFPAVGRQRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315276_114701531 | 3300032177 | Sediment | YLPLANGPPGQRPKGGDVSCPLWKRGIEGDFMVILLISLTFEIHFSKG |
| Ga0315276_116167162 | 3300032177 | Sediment | GPPGQRPKGGEVSFPFWKRGREGDFMVILLISLAFEIHFSKG |
| Ga0315286_103708924 | 3300032342 | Sediment | RPKGGEVRFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315286_103873521 | 3300032342 | Sediment | QRPKGGDVSFPLWKRGIEEDFMMILLTSLAFEIHFSKG |
| Ga0315286_105146381 | 3300032342 | Sediment | SLPTSLFPPGQRPKGGEVSFPLWRLFPAGGRQRGIEGDFMVILLISLAFEIHFLKG |
| Ga0315286_107259501 | 3300032342 | Sediment | SSRKKTPKGGDVSFPLWKRGIEGDFMVILLISLVFEIRFSKG |
| Ga0315286_113023051 | 3300032342 | Sediment | LPASGRKKTPKGGDVSFPLWKRGIEGDFMVILLISLAFKIHFSKG |
| Ga0315286_116855372 | 3300032342 | Sediment | MYNFSAFKIPPCLPLPASGRRKMPKGGEVSFPLWKRGIEGDFMVILLISLVFEIHFPKG |
| Ga0315286_117631231 | 3300032342 | Sediment | GDVSFPLWPLFPAGGRQRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315286_121122412 | 3300032342 | Sediment | PASLFPPGQRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFLKG |
| Ga0315287_107393371 | 3300032397 | Sediment | VSMPNHFPKGGDVSFPLWKRGIEGDFMVILLIALVFEIHFSKG |
| Ga0315287_119146233 | 3300032397 | Sediment | NHFPKGGDVSFPLWKRGIEGDFMVILLISLVFEIHFSKG |
| Ga0315287_124410451 | 3300032397 | Sediment | LKIPPRLPLPASGRRKTPKGGDVSFPLWKRGIEGDFMVILLISLAFKIHFSKG |
| Ga0315275_111523242 | 3300032401 | Sediment | LGRRPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315275_114469232 | 3300032401 | Sediment | MPRREALSGQRPKGGEVSFPLWKRGIEGDFMVILLIPLVFEIHF |
| Ga0315275_115314551 | 3300032401 | Sediment | GQRPKGGDVSFPLWKRGIEGDFMVILLISLASEIHFSKG |
| Ga0315275_118218602 | 3300032401 | Sediment | GQRPKGGDVRFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315275_119848722 | 3300032401 | Sediment | PKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKS |
| Ga0315273_100872601 | 3300032516 | Sediment | QFSALKIPPCLPFPKGGDISFPLWKRGIEGDFMVILLISLAFQIHFSKS |
| Ga0315273_101774391 | 3300032516 | Sediment | PCLPLPKGGDVSFPLWKRGIEGDFMVILLISLTFEIHFSKG |
| Ga0315273_103779611 | 3300032516 | Sediment | CLPFPKGGDISFPLRKRGIEGDFIVILLIFLAFEIHFSKG |
| Ga0315273_103805901 | 3300032516 | Sediment | MVSMPNPFPKGGDVSFPLWKWGIEGDFMVILLISLAFEIHFSKG |
| Ga0315273_103992444 | 3300032516 | Sediment | MVSMPNHFPKGGDVNFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315273_104274471 | 3300032516 | Sediment | LSGQRPKGGDVSFPLWRLFPAGGRQRGIEGDFMVILLIPLAFEIHFSKG |
| Ga0315273_104633401 | 3300032516 | Sediment | HFPKGGDVSFPLWKRGIEGDFMVILLIALVFEIHFSKG |
| Ga0315273_104997952 | 3300032516 | Sediment | LKIPPYLPLPASGREKTPKGGDVSFPLWKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315273_106475402 | 3300032516 | Sediment | SLPASIFPPGQRPKRGDVSFPLWKRGIEGDFMVILLISMAFEMYFSKR |
| Ga0315273_108113271 | 3300032516 | Sediment | SGQRPKGGEVSFPLWKRGIEGDSMVILLISLAFEIHFSKG |
| Ga0315273_110185632 | 3300032516 | Sediment | LPAFGRKKIPKGGDISFPLWKRGIEGDFMVILSISFAFEIHFSKS |
| Ga0315273_121118301 | 3300032516 | Sediment | KIFPCLPLPASGRRKTPKGGDVSVPLCKRGIEGDFMVILLISLAFEIHFSKG |
| Ga0315273_130643272 | 3300032516 | Sediment | GDVSIPLWPLFPAGGRQRGMEGDFMVILLISLAFEIHD |
| Ga0299912_111252421 | 3300033489 | Soil | ALKIPPCLPFPKGGDVSFPLRKRGIEGDFMVILLISLAFEIHFSKG |
| ⦗Top⦘ |