| Basic Information | |
|---|---|
| Family ID | F025351 |
| Family Type | Metagenome |
| Number of Sequences | 202 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MARVSPEELLARLEKGKPIPAILLLGEEPYLRDACRTELIE |
| Number of Associated Samples | 159 |
| Number of Associated Scaffolds | 202 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 99.50 % |
| % of genes near scaffold ends (potentially truncated) | 97.03 % |
| % of genes from short scaffolds (< 2000 bps) | 90.10 % |
| Associated GOLD sequencing projects | 141 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.40 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (99.505 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (21.782 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.238 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (54.950 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 27.54% β-sheet: 0.00% Coil/Unstructured: 72.46% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.40 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 202 Family Scaffolds |
|---|---|---|
| PF04390 | LptE | 69.31 |
| PF02774 | Semialdhyde_dhC | 6.44 |
| PF01066 | CDP-OH_P_transf | 0.99 |
| PF02666 | PS_Dcarbxylase | 0.99 |
| PF00930 | DPPIV_N | 0.50 |
| PF04909 | Amidohydro_2 | 0.50 |
| PF00583 | Acetyltransf_1 | 0.50 |
| PF00814 | TsaD | 0.50 |
| PF02910 | Succ_DH_flav_C | 0.50 |
| PF06144 | DNA_pol3_delta | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 202 Family Scaffolds |
|---|---|---|---|
| COG2980 | Outer membrane lipoprotein LptE/RlpB (LPS assembly) | Cell wall/membrane/envelope biogenesis [M] | 69.31 |
| COG0002 | N-acetyl-gamma-glutamylphosphate reductase | Amino acid transport and metabolism [E] | 6.44 |
| COG0136 | Aspartate-semialdehyde dehydrogenase | Amino acid transport and metabolism [E] | 6.44 |
| COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.99 |
| COG0688 | Phosphatidylserine decarboxylase | Lipid transport and metabolism [I] | 0.99 |
| COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.99 |
| COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.99 |
| COG0533 | tRNA A37 threonylcarbamoyltransferase TsaD | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.50 |
| COG1214 | tRNA A37 threonylcarbamoyladenosine modification protein TsaB | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1466 | DNA polymerase III, delta subunit | Replication, recombination and repair [L] | 0.50 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.50 |
| COG2812 | DNA polymerase III, gamma/tau subunits | Replication, recombination and repair [L] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 99.50 % |
| Unclassified | root | N/A | 0.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_101926835 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2568 | Open in IMG/M |
| 3300000364|INPhiseqgaiiFebDRAFT_104652431 | All Organisms → cellular organisms → Bacteria | 635 | Open in IMG/M |
| 3300001431|F14TB_101773749 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300001431|F14TB_102977767 | All Organisms → cellular organisms → Bacteria | 559 | Open in IMG/M |
| 3300001661|JGI12053J15887_10338668 | All Organisms → cellular organisms → Bacteria | 729 | Open in IMG/M |
| 3300003350|JGI26347J50199_1025679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 654 | Open in IMG/M |
| 3300004080|Ga0062385_10159492 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1175 | Open in IMG/M |
| 3300004080|Ga0062385_10205588 | All Organisms → cellular organisms → Bacteria | 1066 | Open in IMG/M |
| 3300004080|Ga0062385_11074002 | All Organisms → cellular organisms → Bacteria | 544 | Open in IMG/M |
| 3300005165|Ga0066869_10114832 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 552 | Open in IMG/M |
| 3300005167|Ga0066672_10535934 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
| 3300005175|Ga0066673_10853427 | All Organisms → cellular organisms → Bacteria | 519 | Open in IMG/M |
| 3300005332|Ga0066388_105793559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 625 | Open in IMG/M |
| 3300005446|Ga0066686_10005663 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6014 | Open in IMG/M |
| 3300005450|Ga0066682_10656495 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300005468|Ga0070707_100382457 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1367 | Open in IMG/M |
| 3300005526|Ga0073909_10700003 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300005536|Ga0070697_102107482 | All Organisms → cellular organisms → Bacteria | 505 | Open in IMG/M |
| 3300005541|Ga0070733_10882970 | All Organisms → cellular organisms → Bacteria | 600 | Open in IMG/M |
| 3300005544|Ga0070686_101309613 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
| 3300005557|Ga0066704_10121784 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1730 | Open in IMG/M |
| 3300005558|Ga0066698_10153420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1557 | Open in IMG/M |
| 3300005559|Ga0066700_10499265 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 849 | Open in IMG/M |
| 3300005559|Ga0066700_11097451 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300005560|Ga0066670_10062076 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1979 | Open in IMG/M |
| 3300005560|Ga0066670_10819369 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300005566|Ga0066693_10368503 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300005576|Ga0066708_10062265 | All Organisms → cellular organisms → Bacteria | 2122 | Open in IMG/M |
| 3300005586|Ga0066691_10457413 | All Organisms → cellular organisms → Bacteria | 763 | Open in IMG/M |
| 3300005586|Ga0066691_10491079 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300005598|Ga0066706_10742120 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
| 3300005610|Ga0070763_10576580 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 650 | Open in IMG/M |
| 3300005764|Ga0066903_100582575 | All Organisms → cellular organisms → Bacteria | 1931 | Open in IMG/M |
| 3300005764|Ga0066903_103905740 | All Organisms → cellular organisms → Bacteria | 800 | Open in IMG/M |
| 3300005764|Ga0066903_106659615 | All Organisms → cellular organisms → Bacteria | 601 | Open in IMG/M |
| 3300006059|Ga0075017_101058674 | All Organisms → cellular organisms → Bacteria | 633 | Open in IMG/M |
| 3300006173|Ga0070716_101783459 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
| 3300006174|Ga0075014_100593739 | All Organisms → cellular organisms → Bacteria | 632 | Open in IMG/M |
| 3300006175|Ga0070712_100820142 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 799 | Open in IMG/M |
| 3300006176|Ga0070765_100678839 | All Organisms → cellular organisms → Bacteria | 973 | Open in IMG/M |
| 3300006237|Ga0097621_100507177 | All Organisms → cellular organisms → Bacteria | 1093 | Open in IMG/M |
| 3300006358|Ga0068871_101189107 | All Organisms → cellular organisms → Bacteria | 715 | Open in IMG/M |
| 3300006755|Ga0079222_10983037 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
| 3300006800|Ga0066660_11129822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 619 | Open in IMG/M |
| 3300006800|Ga0066660_11238296 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300006806|Ga0079220_10925227 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300006854|Ga0075425_100932370 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 992 | Open in IMG/M |
| 3300006871|Ga0075434_100836604 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 936 | Open in IMG/M |
| 3300006903|Ga0075426_10355449 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1077 | Open in IMG/M |
| 3300006903|Ga0075426_10807854 | All Organisms → cellular organisms → Bacteria | 706 | Open in IMG/M |
| 3300007255|Ga0099791_10533388 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300007265|Ga0099794_10037904 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2283 | Open in IMG/M |
| 3300009012|Ga0066710_101608153 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 995 | Open in IMG/M |
| 3300009038|Ga0099829_10850110 | All Organisms → cellular organisms → Bacteria | 757 | Open in IMG/M |
| 3300009038|Ga0099829_11012147 | All Organisms → cellular organisms → Bacteria | 689 | Open in IMG/M |
| 3300009038|Ga0099829_11056960 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300009038|Ga0099829_11659433 | All Organisms → cellular organisms → Bacteria | 526 | Open in IMG/M |
| 3300009088|Ga0099830_10977617 | All Organisms → cellular organisms → Bacteria | 701 | Open in IMG/M |
| 3300009137|Ga0066709_101325461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1053 | Open in IMG/M |
| 3300009137|Ga0066709_101548860 | All Organisms → cellular organisms → Bacteria | 953 | Open in IMG/M |
| 3300009638|Ga0116113_1066680 | All Organisms → cellular organisms → Bacteria | 844 | Open in IMG/M |
| 3300009792|Ga0126374_10383346 | All Organisms → cellular organisms → Bacteria | 976 | Open in IMG/M |
| 3300009792|Ga0126374_11506009 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300010304|Ga0134088_10111529 | All Organisms → cellular organisms → Bacteria | 1291 | Open in IMG/M |
| 3300010322|Ga0134084_10164766 | All Organisms → cellular organisms → Bacteria | 754 | Open in IMG/M |
| 3300010325|Ga0134064_10005591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3179 | Open in IMG/M |
| 3300010329|Ga0134111_10571231 | All Organisms → cellular organisms → Bacteria | 504 | Open in IMG/M |
| 3300010358|Ga0126370_10644926 | All Organisms → cellular organisms → Bacteria | 922 | Open in IMG/M |
| 3300010360|Ga0126372_12428603 | All Organisms → cellular organisms → Bacteria | 575 | Open in IMG/M |
| 3300010361|Ga0126378_13262378 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300010362|Ga0126377_10901208 | All Organisms → cellular organisms → Bacteria | 947 | Open in IMG/M |
| 3300010398|Ga0126383_11200581 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300010400|Ga0134122_10966487 | All Organisms → cellular organisms → Bacteria | 831 | Open in IMG/M |
| 3300011270|Ga0137391_10693666 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300011270|Ga0137391_11320925 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300012202|Ga0137363_10044355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3152 | Open in IMG/M |
| 3300012202|Ga0137363_10732348 | All Organisms → cellular organisms → Bacteria | 837 | Open in IMG/M |
| 3300012205|Ga0137362_10688701 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300012206|Ga0137380_10725499 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300012207|Ga0137381_11297929 | All Organisms → cellular organisms → Bacteria | 621 | Open in IMG/M |
| 3300012209|Ga0137379_10538261 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1075 | Open in IMG/M |
| 3300012209|Ga0137379_10742627 | All Organisms → cellular organisms → Bacteria | 887 | Open in IMG/M |
| 3300012211|Ga0137377_10299782 | All Organisms → cellular organisms → Bacteria | 1542 | Open in IMG/M |
| 3300012211|Ga0137377_10516305 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1133 | Open in IMG/M |
| 3300012285|Ga0137370_10860877 | All Organisms → cellular organisms → Bacteria | 561 | Open in IMG/M |
| 3300012362|Ga0137361_10131205 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2219 | Open in IMG/M |
| 3300012683|Ga0137398_10646961 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
| 3300012685|Ga0137397_10343253 | All Organisms → cellular organisms → Bacteria | 1113 | Open in IMG/M |
| 3300012685|Ga0137397_10602205 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
| 3300012917|Ga0137395_10071859 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2236 | Open in IMG/M |
| 3300012922|Ga0137394_10196482 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1722 | Open in IMG/M |
| 3300012923|Ga0137359_10373968 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1266 | Open in IMG/M |
| 3300012925|Ga0137419_10510608 | All Organisms → cellular organisms → Bacteria | 955 | Open in IMG/M |
| 3300012927|Ga0137416_11432436 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300012944|Ga0137410_10870848 | All Organisms → cellular organisms → Bacteria | 760 | Open in IMG/M |
| 3300012971|Ga0126369_11207208 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300012971|Ga0126369_11566663 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300012975|Ga0134110_10124976 | All Organisms → cellular organisms → Bacteria | 1051 | Open in IMG/M |
| 3300015051|Ga0137414_1102766 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 1237 | Open in IMG/M |
| 3300015054|Ga0137420_1131777 | All Organisms → cellular organisms → Bacteria | 975 | Open in IMG/M |
| 3300015054|Ga0137420_1324001 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1864 | Open in IMG/M |
| 3300015089|Ga0167643_1037733 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300015241|Ga0137418_11014183 | All Organisms → cellular organisms → Bacteria | 599 | Open in IMG/M |
| 3300015241|Ga0137418_11044419 | All Organisms → cellular organisms → Bacteria | 587 | Open in IMG/M |
| 3300015245|Ga0137409_11610730 | All Organisms → cellular organisms → Bacteria | 501 | Open in IMG/M |
| 3300015371|Ga0132258_13463888 | All Organisms → cellular organisms → Bacteria | 1082 | Open in IMG/M |
| 3300016387|Ga0182040_10417149 | All Organisms → cellular organisms → Bacteria | 1057 | Open in IMG/M |
| 3300016422|Ga0182039_11255907 | All Organisms → cellular organisms → Bacteria | 670 | Open in IMG/M |
| 3300016445|Ga0182038_11167959 | All Organisms → cellular organisms → Bacteria | 685 | Open in IMG/M |
| 3300017822|Ga0187802_10149220 | All Organisms → cellular organisms → Bacteria | 893 | Open in IMG/M |
| 3300017955|Ga0187817_10076539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2088 | Open in IMG/M |
| 3300017973|Ga0187780_10869139 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
| 3300018012|Ga0187810_10155488 | All Organisms → cellular organisms → Bacteria | 919 | Open in IMG/M |
| 3300018431|Ga0066655_10460913 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300018431|Ga0066655_11018643 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 573 | Open in IMG/M |
| 3300018433|Ga0066667_11673257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 570 | Open in IMG/M |
| 3300020150|Ga0187768_1079289 | All Organisms → cellular organisms → Bacteria | 741 | Open in IMG/M |
| 3300020579|Ga0210407_10066930 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2694 | Open in IMG/M |
| 3300020579|Ga0210407_11152436 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300020580|Ga0210403_10298141 | All Organisms → cellular organisms → Bacteria | 1321 | Open in IMG/M |
| 3300020580|Ga0210403_11198158 | All Organisms → cellular organisms → Bacteria | 585 | Open in IMG/M |
| 3300020581|Ga0210399_11305648 | All Organisms → cellular organisms → Bacteria | 571 | Open in IMG/M |
| 3300020582|Ga0210395_10090619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2257 | Open in IMG/M |
| 3300021046|Ga0215015_10161134 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300021046|Ga0215015_10306112 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300021181|Ga0210388_10009934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7545 | Open in IMG/M |
| 3300021181|Ga0210388_11030500 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300021181|Ga0210388_11267214 | All Organisms → cellular organisms → Bacteria | 623 | Open in IMG/M |
| 3300021404|Ga0210389_10188702 | All Organisms → cellular organisms → Bacteria | 1606 | Open in IMG/M |
| 3300021405|Ga0210387_10417164 | All Organisms → cellular organisms → Bacteria | 1190 | Open in IMG/M |
| 3300021405|Ga0210387_10966302 | All Organisms → cellular organisms → Bacteria | 747 | Open in IMG/M |
| 3300021405|Ga0210387_11081872 | All Organisms → cellular organisms → Bacteria | 700 | Open in IMG/M |
| 3300021405|Ga0210387_11656102 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300021433|Ga0210391_10468995 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300021433|Ga0210391_11019407 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300021474|Ga0210390_11269964 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300021475|Ga0210392_10021148 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3693 | Open in IMG/M |
| 3300021477|Ga0210398_11427185 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300021478|Ga0210402_10006868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 10023 | Open in IMG/M |
| 3300021478|Ga0210402_10124802 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2329 | Open in IMG/M |
| 3300021478|Ga0210402_11881103 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300021479|Ga0210410_10841545 | All Organisms → cellular organisms → Bacteria | 803 | Open in IMG/M |
| 3300024227|Ga0228598_1117183 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300024271|Ga0224564_1078505 | All Organisms → cellular organisms → Bacteria | 661 | Open in IMG/M |
| 3300024330|Ga0137417_1191906 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1282 | Open in IMG/M |
| 3300024330|Ga0137417_1459460 | All Organisms → cellular organisms → Bacteria | 1428 | Open in IMG/M |
| 3300025922|Ga0207646_10302156 | All Organisms → cellular organisms → Bacteria | 1446 | Open in IMG/M |
| 3300025939|Ga0207665_10265036 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Terriglobus | 1274 | Open in IMG/M |
| 3300025939|Ga0207665_11351059 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300025961|Ga0207712_11603647 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300026298|Ga0209236_1226010 | All Organisms → cellular organisms → Bacteria | 645 | Open in IMG/M |
| 3300026309|Ga0209055_1048525 | All Organisms → cellular organisms → Bacteria | 1844 | Open in IMG/M |
| 3300026313|Ga0209761_1117986 | All Organisms → cellular organisms → Bacteria | 1295 | Open in IMG/M |
| 3300026314|Ga0209268_1151661 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300026317|Ga0209154_1060402 | All Organisms → cellular organisms → Bacteria | 1670 | Open in IMG/M |
| 3300026319|Ga0209647_1338912 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300026332|Ga0209803_1205733 | All Organisms → cellular organisms → Bacteria | 717 | Open in IMG/M |
| 3300026333|Ga0209158_1253025 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300026515|Ga0257158_1007122 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1624 | Open in IMG/M |
| 3300026523|Ga0209808_1046072 | All Organisms → cellular organisms → Bacteria | 2017 | Open in IMG/M |
| 3300026538|Ga0209056_10485938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 659 | Open in IMG/M |
| 3300026550|Ga0209474_10000838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 31850 | Open in IMG/M |
| 3300026550|Ga0209474_10115717 | All Organisms → cellular organisms → Bacteria | 1785 | Open in IMG/M |
| 3300026551|Ga0209648_10773479 | All Organisms → cellular organisms → Bacteria | 524 | Open in IMG/M |
| 3300026557|Ga0179587_10271824 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1087 | Open in IMG/M |
| 3300027591|Ga0209733_1083484 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300027655|Ga0209388_1116778 | All Organisms → cellular organisms → Bacteria | 762 | Open in IMG/M |
| 3300027660|Ga0209736_1188219 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
| 3300027671|Ga0209588_1250522 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300027706|Ga0209581_1079658 | All Organisms → cellular organisms → Bacteria | 1168 | Open in IMG/M |
| 3300027729|Ga0209248_10143578 | Not Available | 713 | Open in IMG/M |
| 3300027765|Ga0209073_10083466 | All Organisms → cellular organisms → Bacteria | 1104 | Open in IMG/M |
| 3300027821|Ga0209811_10436292 | All Organisms → cellular organisms → Bacteria | 508 | Open in IMG/M |
| 3300027846|Ga0209180_10670306 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300027875|Ga0209283_10651281 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300027903|Ga0209488_10038711 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3489 | Open in IMG/M |
| 3300028536|Ga0137415_10525943 | All Organisms → cellular organisms → Bacteria | 991 | Open in IMG/M |
| 3300030490|Ga0302184_10426389 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300031057|Ga0170834_101043754 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300031128|Ga0170823_10582340 | All Organisms → cellular organisms → Bacteria | 913 | Open in IMG/M |
| 3300031564|Ga0318573_10027460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2631 | Open in IMG/M |
| 3300031715|Ga0307476_10906511 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300031715|Ga0307476_11366886 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300031723|Ga0318493_10285518 | All Organisms → cellular organisms → Bacteria | 888 | Open in IMG/M |
| 3300031724|Ga0318500_10568025 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300031740|Ga0307468_100698638 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
| 3300031754|Ga0307475_10385976 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300031754|Ga0307475_10493390 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
| 3300031754|Ga0307475_11285070 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300031781|Ga0318547_10820960 | All Organisms → cellular organisms → Bacteria | 579 | Open in IMG/M |
| 3300031823|Ga0307478_10736371 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300031893|Ga0318536_10386929 | All Organisms → cellular organisms → Bacteria | 707 | Open in IMG/M |
| 3300031942|Ga0310916_10607193 | All Organisms → cellular organisms → Bacteria | 930 | Open in IMG/M |
| 3300031945|Ga0310913_10710044 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300031959|Ga0318530_10100107 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300031962|Ga0307479_11328165 | All Organisms → cellular organisms → Bacteria | 679 | Open in IMG/M |
| 3300031962|Ga0307479_12024616 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 524 | Open in IMG/M |
| 3300032001|Ga0306922_10215176 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2063 | Open in IMG/M |
| 3300032009|Ga0318563_10512168 | All Organisms → cellular organisms → Bacteria | 648 | Open in IMG/M |
| 3300032180|Ga0307471_100618804 | All Organisms → cellular organisms → Bacteria | 1243 | Open in IMG/M |
| 3300032895|Ga0335074_11600218 | All Organisms → cellular organisms → Bacteria | 509 | Open in IMG/M |
| 3300033004|Ga0335084_10335260 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1561 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.78% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 16.34% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 13.37% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 4.95% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.95% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 4.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.47% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.48% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.98% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.98% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.49% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 1.49% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.99% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.50% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.50% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.50% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300003350 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005165 | Soil and rhizosphere microbial communities from Laval, Canada - mgHMC | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005558 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 | Environmental | Open in IMG/M |
| 3300005559 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_149 | Environmental | Open in IMG/M |
| 3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
| 3300005566 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 | Environmental | Open in IMG/M |
| 3300005576 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
| 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Environmental | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009638 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_10 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_09182015 | Environmental | Open in IMG/M |
| 3300010322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_0_1 metaG | Environmental | Open in IMG/M |
| 3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012285 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaG | Environmental | Open in IMG/M |
| 3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012975 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_5_11112015 | Environmental | Open in IMG/M |
| 3300015051 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015054 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015089 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G8A, Adjacent to main proglacial river, end of transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015241 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015245 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300018012 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_5 | Environmental | Open in IMG/M |
| 3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
| 3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020580 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300021046 | Soil microbial communities from Shale Hills CZO, Pennsylvania, United States - 90cm depth | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
| 3300024271 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU5 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026298 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026314 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_143 (SPAdes) | Environmental | Open in IMG/M |
| 3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
| 3300026319 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026515 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-03-A | Environmental | Open in IMG/M |
| 3300026523 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027660 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027706 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen15_06102014_R2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300031057 | Oak Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032895 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1019268351 | 3300000364 | Soil | MPSIGPEELLARLKKGKPIPALLLLGKETYLRDSCRAALIDAFVSEAARTWAIS |
| INPhiseqgaiiFebDRAFT_1046524312 | 3300000364 | Soil | MPVSPDELLSRLKKGKPVPAILLLGEEPYLRDLCRAQLIKQYVAEAAR |
| F14TB_1017737491 | 3300001431 | Soil | MPSIGPEELLARVKKGKPIPAILLLGDETYLRDSCRASLI |
| F14TB_1029777672 | 3300001431 | Soil | MPAVGPSELLARLKKGKIIPAVLLLGQEPYLRDTCRAQLIDHYVA |
| JGI12053J15887_103386683 | 3300001661 | Forest Soil | MARISQQELLERLEKGKPVPAILLLGEETYLRDACRA |
| JGI26347J50199_10256791 | 3300003350 | Bog Forest Soil | MAQVSTQELLARLELGKIIPALLLLGEEPYLRDECRKRLIEKFVPEAARTWAVS |
| Ga0062385_101594921 | 3300004080 | Bog Forest Soil | MAQVSLQELLARLESGKKIPAILLLGDEPYLRDECRKQLIERFV |
| Ga0062385_102055881 | 3300004080 | Bog Forest Soil | MTRVSTEELVARLEKGKLIPALLLLGEEPYLRDACRKQLIEKFV |
| Ga0062385_110740022 | 3300004080 | Bog Forest Soil | MARVSREELLARLKKGTAPPAMLLLGEEPYLRDACRKQLIDTFVPEA |
| Ga0066869_101148322 | 3300005165 | Soil | MAQILAGELLARLEKGRPIPAILLLGEETYLRDTCRAQLINRFVPEAARA |
| Ga0066672_105359342 | 3300005167 | Soil | MARISTNELLSRLEKGKPIPAILLLGEEPYLRDSCRKLLTERHVPEAA |
| Ga0066673_108534272 | 3300005175 | Soil | MAQISAGELLARLEKGKPVPSILLLGEETYLRDTCRAQLIG |
| Ga0066388_1057935592 | 3300005332 | Tropical Forest Soil | MAQISAGDLLARLEKGRPAPAILLLGEETYLRDTCRAQLIERFVP |
| Ga0066686_100056631 | 3300005446 | Soil | MTRISANELLSRLEKGKAIPAILLLGEEPYLRDRCRALLMERYVPDAARPWAVSRYS |
| Ga0066682_106564952 | 3300005450 | Soil | MARLSAEELLGRLEKGKPIPAILLLGEEPYLRDACRTQLIERFVT |
| Ga0070707_1003824573 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MARISQREFLARLEKGKAIPAILLLGDEPYLRDSCRAQLIERFVPEAARVWA |
| Ga0073909_107000032 | 3300005526 | Surface Soil | MPAISPDEMLARLKKGKPIPAVLLLGEEPYLRDSCRALLI |
| Ga0070697_1021074822 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPVSPNDLLARLKKAKPIPAILLLGEEPYLRDSCRAQLI |
| Ga0070733_108829702 | 3300005541 | Surface Soil | MPQISTQELLARLERGTAIPALLLHGEEPYLRDECRK |
| Ga0070686_1013096132 | 3300005544 | Switchgrass Rhizosphere | MPSIGPEELLARVKKGKPIPAILLLGDETYLRDSCRASLIDAYVNEAA |
| Ga0066704_101217841 | 3300005557 | Soil | MARISQQELVGRLEKGKPVPAILLLGEEPYLRDAC |
| Ga0066698_101534203 | 3300005558 | Soil | MTRISANELLSRLEKGKAIPAILLLGEEPYLRDRCRAL |
| Ga0066700_104992653 | 3300005559 | Soil | MARISPVELLGRLEKGKPVAAILLLGEEVYLRDACREQLIERFVPEAAR |
| Ga0066700_110974512 | 3300005559 | Soil | MPQIFAGELLARLEKGKPVPSILLLGEETYLRDTCRAQLIDRFVPEAARA |
| Ga0066670_100620764 | 3300005560 | Soil | MARLSAEELLVRLEKGKPIPAILLLGEEPYLRDACRTQLI |
| Ga0066670_108193692 | 3300005560 | Soil | MARISADELLARLEKGKPIPAILLLGEEPYLRDSCRTLLIER |
| Ga0066693_103685031 | 3300005566 | Soil | MARISTNELLSRLEKGKPIPAILLLGEEPYLRDSCRKLLTERYVPEAARA |
| Ga0066708_100622653 | 3300005576 | Soil | MTRISANELLSRLEKGKAIPAILLLGEEPYLRDRCRALLMERYVPDAARPWAVSRY* |
| Ga0066691_104574132 | 3300005586 | Soil | MARLSAEELLGRLEKGKPIPAILLLGEEPYLRDAC |
| Ga0066691_104910792 | 3300005586 | Soil | MARISQQELVGRLEKGKPVPAILLVGEEPYLRDACRALLIE |
| Ga0066706_107421202 | 3300005598 | Soil | MARLSAEELLGRLEKGKPIPAILLLGEEPYLRDACRTQLI |
| Ga0070763_105765801 | 3300005610 | Soil | MPQVSTEELVARLERGKAIPAVLLLGEEPYLRDECRKLLIERFVPEAARTWA |
| Ga0066903_1005825754 | 3300005764 | Tropical Forest Soil | MPSIGPEELLARLKKGKPIPAILLLGEETYLRDCCRSALMDAYVKEA |
| Ga0066903_1039057401 | 3300005764 | Tropical Forest Soil | MPSIKPNELLARLKKGQTVPAVLLLGEEAYLRDTCRALLIDQYVTEAARTWA |
| Ga0066903_1066596152 | 3300005764 | Tropical Forest Soil | MPSIGTEELLARLKKGKPIPALLLLGEETYLRDCCRA |
| Ga0075017_1010586741 | 3300006059 | Watersheds | MPQVSTQELLARLEQGKAIPALLLCGEETYLRDGCRKLLVEKYVPEAA |
| Ga0070716_1017834591 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQISAGELLARLEKGKPVPSILLLGEETYLRDTCRAQLIDRFVPEAARAWA |
| Ga0075014_1005937392 | 3300006174 | Watersheds | MARISSQGLMERLKKGKVIPALLLLGDEPYLRDVCRKLLVETFI |
| Ga0070712_1008201422 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPVSTDELLSRLKKSKIIPAILLLGEEPYLRDICRAQLIDQYVPEAARTWAV |
| Ga0070765_1006788393 | 3300006176 | Soil | MARVSTDELLARLQKGKPITALLLLGEETYLRDMCRGKLIEKFIPEAAR |
| Ga0097621_1005071773 | 3300006237 | Miscanthus Rhizosphere | MAPMNTDELFKRLRKGKPLPAIVLLGEEPYLRDACRAQLIDQYVPETARTW |
| Ga0068871_1011891072 | 3300006358 | Miscanthus Rhizosphere | MPSIGPEELLARVKKGKPIPAILLLGAETYLRDSCRASLIDAYVNEAART |
| Ga0079222_109830371 | 3300006755 | Agricultural Soil | MARVSENELLSRLKKGKPVAAILLLGEEPYLRDRCRTLLIERY |
| Ga0066660_111298222 | 3300006800 | Soil | MTRISPEELLGRLGKGKPVAAILLLGEEVYLRDACREQLIERFVPE |
| Ga0066660_112382961 | 3300006800 | Soil | MAQISAGELLARLEKGKPVPSILLLGEETYLRDTCRAQLIGRFVPEAARAWA |
| Ga0079220_109252271 | 3300006806 | Agricultural Soil | VARISVNELVSRLERGKPVPAILLLGEEPYLRDSCRTLL |
| Ga0075425_1009323701 | 3300006854 | Populus Rhizosphere | MPAIGPDELLSRLKKGKPIPALLLLGEETYLRDACRTQ |
| Ga0075434_1008366041 | 3300006871 | Populus Rhizosphere | MPSIGPEELLARLKKAKPIPALLLLGEETYLRDSCRAALIDAYVS |
| Ga0075426_103554491 | 3300006903 | Populus Rhizosphere | MPSIGPEELLARLKKGKPIPALLLLGEETYLRDSC |
| Ga0075426_108078542 | 3300006903 | Populus Rhizosphere | MARISADELLSRLEKGKPLPAILLLGEEPYLRDSCRT |
| Ga0099791_105333881 | 3300007255 | Vadose Zone Soil | MAQISPEELLAWLERGRAIPAILLLGEEPYLRDSCRELLIERFVPE |
| Ga0099794_100379041 | 3300007265 | Vadose Zone Soil | MARVSPEELLGRLEKGKLIPAILLLGEEPYLRDTCRTQLIERF |
| Ga0066710_1016081531 | 3300009012 | Grasslands Soil | MARISQKELLARLEKGKPIPAILLLGEEPYLRDACRAQL |
| Ga0099829_108501101 | 3300009038 | Vadose Zone Soil | MARISQEELLGRLEKGKPIPAILLLGEEAYLRDTCREQ |
| Ga0099829_110121472 | 3300009038 | Vadose Zone Soil | MKRIPRDELRALLEKGEPVRAILLLGEEPYLRDSCRAQLIETFV |
| Ga0099829_110569602 | 3300009038 | Vadose Zone Soil | MPPVTPDELLARLKKGKLIPCILLLGEEPYLRDACRAQLI |
| Ga0099829_116594331 | 3300009038 | Vadose Zone Soil | MARISQKELLARLEKGKPIPAILLLGEEPYLRDACRAQLIEKF |
| Ga0099830_109776171 | 3300009088 | Vadose Zone Soil | MARISQEELVGRLEKGKLVPAILLLGEEPYLRDSCRAQL |
| Ga0066709_1013254613 | 3300009137 | Grasslands Soil | MTRISPEELLGRLEKGKPVAAILLLGEEVYLRDACREQLIERFVPEAAR |
| Ga0066709_1015488601 | 3300009137 | Grasslands Soil | MARLSPGELLGRLEKGKPIPAILLLGKEPYLRDACRT |
| Ga0116113_10666801 | 3300009638 | Peatland | MAKVSSEELLARLKKGTAPPAILLLGEEPYLRDACRKQLIDTFVPEAA |
| Ga0126374_103833463 | 3300009792 | Tropical Forest Soil | MARIRAKELLDRLRKGKAIPAILLVGDEPYLRDQCRALLIDRYVPPAAR |
| Ga0126374_115060092 | 3300009792 | Tropical Forest Soil | MPQINAGELLARLQKGRTVPAILLLGEETYLRDTCRAQLIE |
| Ga0134088_101115293 | 3300010304 | Grasslands Soil | MARISQKELLARLEKGKPIPAILLLGEEPYLRDACRAQLVE |
| Ga0134084_101647661 | 3300010322 | Grasslands Soil | MARLSAEELLGRLEKGKPIPAILLLGEEPYLRDACRTQLIERF |
| Ga0134064_100055911 | 3300010325 | Grasslands Soil | MARISPVELLGRLEKGKPVAAILLVGEEVYLRDACREQLIERFVPEAARTWAVSR |
| Ga0134111_105712311 | 3300010329 | Grasslands Soil | MARISQKELLARLEKGKPIPAILLLGEEPYLRDACRAQLIEKFVP |
| Ga0126370_106449261 | 3300010358 | Tropical Forest Soil | MPSVNPDELLARLKKGKPVPAIVLLGEEAYLRDSCRAVLIDQYVTEAA |
| Ga0126372_124286031 | 3300010360 | Tropical Forest Soil | MPAVGPEELLARLGKGKAIPAVLLLGEEIYLRDSCRDALIDAYVNEAARAW |
| Ga0126378_132623781 | 3300010361 | Tropical Forest Soil | VTRISANELLSRLEKGKPVPAILLLGEEPYLRDSCRTLLIERYVAEAARAWAV |
| Ga0126377_109012081 | 3300010362 | Tropical Forest Soil | MLSIGPEELLARVKKSKPIPAIVLLGEETYLRDSCRSALSEAYVNEA |
| Ga0126383_112005811 | 3300010398 | Tropical Forest Soil | MPSIGPEELLARLKKGKPIPAILLLGEETYLRDCCRAALLDAYV |
| Ga0134122_109664873 | 3300010400 | Terrestrial Soil | MPSIGPEELLARVKKGKPIPAILLLGDETYLRDSCRARLIDA |
| Ga0137391_106936661 | 3300011270 | Vadose Zone Soil | MARISREELVARLEKGKPVPAILLLGEEAYLRDACREQLIERFVPEASRTWAVS |
| Ga0137391_113209252 | 3300011270 | Vadose Zone Soil | MARISQEELVARLEKGKPVPAILLLGEEAYLRNACRKQLI |
| Ga0137363_100443551 | 3300012202 | Vadose Zone Soil | MARISAEELLARLEKGQPIPAILLLGEEPYLRDECRKELIERFVPEAARTWAV |
| Ga0137363_107323482 | 3300012202 | Vadose Zone Soil | MARISQKELLARLEKGKPIPAILLLGEEPYLRDACRGQ* |
| Ga0137362_106887011 | 3300012205 | Vadose Zone Soil | MARLSPEELLGRLEKGKPIPAILLLGEEPYLRDACRTLLIERFV |
| Ga0137380_107254993 | 3300012206 | Vadose Zone Soil | MARISQKELLARLEKGKPIPAILLLGEEPYLRDACRAQ |
| Ga0137381_112979291 | 3300012207 | Vadose Zone Soil | MARISAHELLSRVEKGKPMPAILLLGEEPYLRDRC |
| Ga0137379_105382611 | 3300012209 | Vadose Zone Soil | MARISQKELLARLEKGKAIPAILLLGEEPYLRDACRA |
| Ga0137379_107426273 | 3300012209 | Vadose Zone Soil | MARISQKELLARLEKGKPIPAILLLGEEPYLRDACRAQLIEKFVPEA |
| Ga0137377_102997821 | 3300012211 | Vadose Zone Soil | MARISQKELLARLEKGKPIPAILLLGEEPYLRDACRAQLIEKFVPEAARA |
| Ga0137377_105163051 | 3300012211 | Vadose Zone Soil | MPPVNPDDLIARLKKGKPVPAILLLGEELYLRDRCRAQLIDQYVAA |
| Ga0137370_108608772 | 3300012285 | Vadose Zone Soil | MAQISAGELLARLEKGKLVPSILLLGEETYLRDTCRA |
| Ga0137361_101312054 | 3300012362 | Vadose Zone Soil | MARVSPEELLGRLERGKPIPAILLLGEEPYLRDACRT |
| Ga0137398_106469612 | 3300012683 | Vadose Zone Soil | MARISANELLARLEKGKPVPAILLLGEEPYLRDSCRTLLVERYVPEAARPW |
| Ga0137397_103432533 | 3300012685 | Vadose Zone Soil | MAQIGTEELLTRLKKGKPIPAILLLGEEPYLRDACRAQLIEQYVSE |
| Ga0137397_106022052 | 3300012685 | Vadose Zone Soil | MARLSPEELLGRLEKGKPIPAILLLGEEPYLRDACRTLLIERFVAE |
| Ga0137395_100718594 | 3300012917 | Vadose Zone Soil | MARISQQELVGRLEKGKPVPAILLVGEEPYLRDACRALLIERFVPEASRTWAV |
| Ga0137394_101964821 | 3300012922 | Vadose Zone Soil | MARISPEELLARLEKGKTIPAILLLGEEPYLRDSCRELLIERFVPE |
| Ga0137359_103739683 | 3300012923 | Vadose Zone Soil | MARVSPEELLARLEKGKPISALLLLGEERYLRDACRA |
| Ga0137419_105106083 | 3300012925 | Vadose Zone Soil | MARISPEDLLARREKGKTIPAILLLGEEPYLRDSCRVGLI |
| Ga0137416_114324362 | 3300012927 | Vadose Zone Soil | MARLSAEELLGKLEKGKPIPAILLLGEEPYLRDACRT |
| Ga0137410_108708481 | 3300012944 | Vadose Zone Soil | MARISAEELLARLEKGKAIPAILLLGEEPYLRDSCRAELIDRFVPEGSRE |
| Ga0126369_112072081 | 3300012971 | Tropical Forest Soil | MARISAPELLGRLQKGKPVPAILFLGEEVYLRDACREQ |
| Ga0126369_115666632 | 3300012971 | Tropical Forest Soil | MAQVSPQELLARLEKGKTPAVLLLGEEPYLRDACRRQLADKFVPEAA |
| Ga0134110_101249761 | 3300012975 | Grasslands Soil | MARLSPGELLGRLEKGKPISAILLLGKEPYLRDVCRTELTER |
| Ga0137414_11027661 | 3300015051 | Vadose Zone Soil | MAQISAGELLARLEKGKPVPSILLLGEETYLRDTCRAQLIDRTCRAQ |
| Ga0137420_11317771 | 3300015054 | Vadose Zone Soil | MAQIGREELLARLKKGKPIPAILLLGEEPYLRDGCRAQLIEQYVSEAAPREPGRFRGFPLNA |
| Ga0137420_13240011 | 3300015054 | Vadose Zone Soil | MARLSPEELLGRLEKGKPIPAILLLGEEPYLRDACRTLLIERFVAEARRGPGR |
| Ga0167643_10377332 | 3300015089 | Glacier Forefield Soil | MARISTQELLSRLEKGKLIPTIVLLGEEMYLRDACRARLIEAFVPEASRT |
| Ga0137418_110141832 | 3300015241 | Vadose Zone Soil | MAQISAGELLARLEKGRPVPAILLLGEEAYLRDTCRAQLIERFVPEAARA |
| Ga0137418_110444192 | 3300015241 | Vadose Zone Soil | MARISPEELLGRLEKGKTIPAILLLGEEPYLRDSCRAELIERFVPEA |
| Ga0137409_116107302 | 3300015245 | Vadose Zone Soil | MARISAEELLARLEKGKPVPAILLLGEEPYLRDKGRKELIERFVPEAART |
| Ga0132258_134638883 | 3300015371 | Arabidopsis Rhizosphere | MPSIGPEELLARLKKGKLISALLLLGKETYLRDSCRAALIDAFVSEAAR |
| Ga0182040_104171491 | 3300016387 | Soil | MARIRTEQLKEKLGKGKPIPAMLLLGDEPYLRDACRAELIEAY |
| Ga0182039_112559071 | 3300016422 | Soil | MAGISANELLARLGKGRPIPAILLLGEEPYLRDRCRTLLMERYVPDAARPWAVSRY |
| Ga0182038_111679592 | 3300016445 | Soil | MPSVKPDELMARLKKGTPVPAVVLLGEEAYLRDSCRALLIDRYVTEA |
| Ga0187802_101492201 | 3300017822 | Freshwater Sediment | MARVSPEELLKRLEKRKPISAILLLGEEVYLRDSCR |
| Ga0187817_100765394 | 3300017955 | Freshwater Sediment | MTRTSASELLERLGKGKAVPALLLLGEEPYLRDLCRAQLIEKYVPEA |
| Ga0187780_108691391 | 3300017973 | Tropical Peatland | MARISQQEFLARLEKGKPIPAILLLGEEVYLRDSCRTHL |
| Ga0187810_101554881 | 3300018012 | Freshwater Sediment | MARVSPEELLNRLEKRKPIPAILLLGEEVYLRDSCRAQLIECFVPEAA |
| Ga0066655_104609131 | 3300018431 | Grasslands Soil | MTRISANELLSRLEKGKAIPAILLLGEEPYLRDRCRALLMERYV |
| Ga0066655_110186432 | 3300018431 | Grasslands Soil | MARISPEELLGRLEKGKPVAAILLLGEEVYLRDACREQL |
| Ga0066667_116732571 | 3300018433 | Grasslands Soil | MARISPEELLGRLKKGKPVAAILLLGEEVYLRDACREQL |
| Ga0187768_10792892 | 3300020150 | Tropical Peatland | MARVSVEQLKERLEKGKVIPALLLLGDEPYLRDACRA |
| Ga0210407_100669304 | 3300020579 | Soil | MARLSPEALLERLEKGKPIPAILLLGEEPYLRDACRTL |
| Ga0210407_111524362 | 3300020579 | Soil | MARISSQELLARLEKGKPIPAILLLGEEPYLRDGCRKELIE |
| Ga0210403_102981411 | 3300020580 | Soil | MAQVSPEELLERLERGKAIPALLLLGEEPYLRDECRKQLIER |
| Ga0210403_111981581 | 3300020580 | Soil | MARVSPEELLARLEKGKLIPAILLLGEEPYLRDSCRAQLIERFVPEASR |
| Ga0210399_113056481 | 3300020581 | Soil | MAQVSPEQLLARLASGKALPAVLLLGEEPYLRDECRARLIEK |
| Ga0210395_100906191 | 3300020582 | Soil | MARMSQQKFLAQLQSGKMIAAILLLGDEPYLRDAC |
| Ga0215015_101611341 | 3300021046 | Soil | MARVSQQEFLKRLEKGKAIPAILLLGDEPYLCDNCRAHLIERFVPEAARVLSLIHI |
| Ga0215015_103061122 | 3300021046 | Soil | MARVSPDEVVARLKKGKPVPAILLLGEEAYLRDTCREQLIDTFV |
| Ga0210388_100099341 | 3300021181 | Soil | MPQISTQELLARLERGTAIPALLLHGEEPYLRDECRKQLIEKFVPEAARA |
| Ga0210388_110305001 | 3300021181 | Soil | MARVSTEELLARLEKGKLIPAILLLGEEPYLRDTCRAQLIEKFVPEA |
| Ga0210388_112672141 | 3300021181 | Soil | MARITTEQLAAKLEKAKPIPSILLLGDEPYLRDACRALLIERFVPEA |
| Ga0210389_101887021 | 3300021404 | Soil | MARMSQQKFLAQLQSGKMIAAILLLGDEPYLRDACRAELI |
| Ga0210387_104171641 | 3300021405 | Soil | MAQVSPEELLERLERGKAIPALLLLGEEPYLRDECRKQL |
| Ga0210387_109663023 | 3300021405 | Soil | MPGISSDELLARLKKAKAVPCILLLGEEPYLRDSCRAML |
| Ga0210387_110818721 | 3300021405 | Soil | MARVTSEELLVRLEKGKAIPAVLLLGEEPYLRDAC |
| Ga0210387_116561022 | 3300021405 | Soil | MAQVSPQELLARLESGKKIPAMLLLGEEPYLRDECRKQLIERFVPEAART |
| Ga0210391_104689951 | 3300021433 | Soil | MPQISTQELLARLERGTAIPALLLHGEEPYLRDECRKQLIEKFVPEAARAW |
| Ga0210391_110194071 | 3300021433 | Soil | MPQVSTEELIARLERGKAIPAILLLGEEPYLRDECRKQLIERFVPEAART |
| Ga0210390_112699641 | 3300021474 | Soil | MAALSPQELLARVAKGKPVPAILLLGADRYLRDLC |
| Ga0210392_100211486 | 3300021475 | Soil | MPKASTEDLLTRLKKGSSVPALLLLGEEPYLRDACRAQLIDTYV |
| Ga0210398_114271851 | 3300021477 | Soil | MPQVSTEELIARLERGKAIPALLLLGEEPYLRDECRKQLIE |
| Ga0210402_1000686814 | 3300021478 | Soil | MAQISSGELLARLEKGRPVPAILLLGEETYLRDTCRAQLIDRFVPE |
| Ga0210402_101248024 | 3300021478 | Soil | MAHVSPEQLLARLAGGKAIPALLLLGEEPYLRDECRARLIEKF |
| Ga0210402_118811031 | 3300021478 | Soil | MARVSTDELLARLQKGKPIAALLLLGEETYLRDMCRGQ |
| Ga0210410_108415453 | 3300021479 | Soil | MARISSQELLARLEKGKPIPAILLLGEEVYLRDTCREQLIAR |
| Ga0228598_11171831 | 3300024227 | Rhizosphere | MAQLSPEELLERLERGKTIPALLLLGEEPYLRDECRKQLIDRFVPE |
| Ga0224564_10785052 | 3300024271 | Soil | MAQVSPEELLERLERGKTIPALLLLGEEPYLRDECRKQLIERFV |
| Ga0137417_11919063 | 3300024330 | Vadose Zone Soil | MARVSPEELLARLEKGKPIPAILLLGEEPYLRDACRTELIE |
| Ga0137417_14594602 | 3300024330 | Vadose Zone Soil | MARISQKELLARLEKGKPIPAILLLGEEPYLRDACRRN |
| Ga0207646_103021562 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MPPVSTDELLSRLKKGKPIPAILLLGEEPYLRDICRD |
| Ga0207665_102650361 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MAQISAGELLARLEKGKPVPSILLLGEETYLRDTCRAQLIDRFVP |
| Ga0207665_113510591 | 3300025939 | Corn, Switchgrass And Miscanthus Rhizosphere | MARISPEELLARLEKGKAIPAILLLGEEPYLRDSCRAELIEK |
| Ga0207712_116036471 | 3300025961 | Switchgrass Rhizosphere | MPSIGPEELLARVKKGKPIPAILLLGDETYLRDSCRARLI |
| Ga0209236_12260101 | 3300026298 | Grasslands Soil | MARLSAQELLWKLEKGKPIPAILLLGEEPYLRDACRTQLIERFVTEASRTW |
| Ga0209055_10485254 | 3300026309 | Soil | MARISQEELLGRLEKGKPIAAILLLGEETYLRDKC |
| Ga0209761_11179863 | 3300026313 | Grasslands Soil | MARIAAADLLSRLTKGKPIPAVLLLGDEVYLRDTCRSQLIEKQIPEEARA |
| Ga0209268_11516612 | 3300026314 | Soil | MTRISANELLSRLEKGKAIPAILLLGEEPYLRDRCRALLMERYVPDATRPRAAIFG |
| Ga0209154_10604021 | 3300026317 | Soil | MARVSPIELLGRLEKGKPIPAILLLGEEPYLRDACRK |
| Ga0209647_13389121 | 3300026319 | Grasslands Soil | MAQISAGELLARLEKGKPVPSILLLGEETYLRDTC |
| Ga0209803_12057332 | 3300026332 | Soil | MARVSQREFLARLEKGKAIPAILLLGDEPYLRDSCR |
| Ga0209158_12530252 | 3300026333 | Soil | MARISANELLSRLEKGKPIPAILLLGEEPYLRDRC |
| Ga0257158_10071223 | 3300026515 | Soil | MARISPEELLGRLEKGKPVPAILLLGEEPYLRDACRA |
| Ga0209808_10460722 | 3300026523 | Soil | MTRISANELLSRLEKGKAIPAILLLGEEPYLRDRCRALLMERYVPDAARPWAVSRY |
| Ga0209056_104859382 | 3300026538 | Soil | MTRISPEELLGRLEKGKPVAAILLLGEEVYLRDACREQLIERFVPE |
| Ga0209474_1000083834 | 3300026550 | Soil | MARISTNELLSRLEKGKPIPAILLLGEEPYLRDSCRKLLTE |
| Ga0209474_101157171 | 3300026550 | Soil | MARISQEELLGRLEKGKPIAAILLLGEETYLRDKCREQLIER |
| Ga0209648_107734792 | 3300026551 | Grasslands Soil | MARVSPEELLGRLERGKPIPAILLLGEEPYLRDACRTLLVERFV |
| Ga0179587_102718242 | 3300026557 | Vadose Zone Soil | MARISREELVGRLEKGKPVPAILLLGEEPYLRDACRAG |
| Ga0209733_10834841 | 3300027591 | Forest Soil | MARLSPEELVARLEKGKPVPAILLLGEEPYLRDGCRTQLIERFVPEAART |
| Ga0209388_11167781 | 3300027655 | Vadose Zone Soil | MARISAEELLARLEKGKAIPAILLLGEEPYLRDSCRELLIERFVPEGS |
| Ga0209736_11882191 | 3300027660 | Forest Soil | MPQISTQELSERLERGKAIPALLLLGEEPYLRDECRKQLIEKFVPEAARTWA |
| Ga0209588_12505221 | 3300027671 | Vadose Zone Soil | MARISAEELLARLEKGKVIPAILLLGEEPYLRDSCR |
| Ga0209581_10796583 | 3300027706 | Surface Soil | MAQISAGELLARLEKGRPVPAILLLGEETYLRDTCR |
| Ga0209248_101435782 | 3300027729 | Bog Forest Soil | MAQVSPEELLERLERGKAIPALLLLGEEPYLRDECRK |
| Ga0209073_100834663 | 3300027765 | Agricultural Soil | MPRISADELLARLGKGNPIPAILLLGEEAYLRDRCRTHLIERFV |
| Ga0209811_104362922 | 3300027821 | Surface Soil | MPAISPDELLARLKKGKPIPAVLLLGEEPYLRDSCRALLI |
| Ga0209180_106703062 | 3300027846 | Vadose Zone Soil | MARVTTEGLLARLAKGKPVAAIFLLGDELYLRDACRAL |
| Ga0209283_106512812 | 3300027875 | Vadose Zone Soil | MAQVSPEELLARLEKGKAIPAILLLGTEPYLRDTCRAQLIE |
| Ga0209488_100387115 | 3300027903 | Vadose Zone Soil | MARLSPEELLGRLEKGKPIPAILLLGEEPYLRDACRTLLVERFVAEASRTWA |
| Ga0137415_105259431 | 3300028536 | Vadose Zone Soil | MARVSPEELLARLEKGKPIPAILLLGEEPYLRDACRT |
| Ga0302184_104263891 | 3300030490 | Palsa | MAKVSTEDLLARLKKGNAVPALLLLGEEPYLRDACRA |
| Ga0170834_1010437541 | 3300031057 | Forest Soil | MPKVSTEELLALLGLGKHVPALLLYGEEPYLRDECRKQLIEKCE |
| Ga0170823_105823401 | 3300031128 | Forest Soil | MPPVNPDQLLAQLKKGKPIAAILLLGDQPYLRDACRK |
| Ga0318573_100274601 | 3300031564 | Soil | MARISANELLSRLEKGKPIPAILLLGEEPYLRDRCRALLMERYVPDAARPW |
| Ga0307476_109065111 | 3300031715 | Hardwood Forest Soil | MAQVSPEQLLARLAGGKAIPAVLLLGEEPYLRDECRARLIEKFVPE |
| Ga0307476_113668861 | 3300031715 | Hardwood Forest Soil | MPSISAEELLARLKKGKPIPALLLLGEESYLRDACRA |
| Ga0318493_102855181 | 3300031723 | Soil | MARISANELLSRLEKGKPIPAILLLGEEPYLRDRCRALLMERYVP |
| Ga0318500_105680251 | 3300031724 | Soil | MARISANELLSRLEKGKPIPAILLLGEEPYLRDRCRALLM |
| Ga0307468_1006986383 | 3300031740 | Hardwood Forest Soil | LARLGKGKAIPAILLLGEEPYLRDSCRAELIERFVPEGSR |
| Ga0307475_103859761 | 3300031754 | Hardwood Forest Soil | MARVSPQELLMRLEKGKIIPAILLLGDEPYLRDACRAQLIEQFVPEA |
| Ga0307475_104933903 | 3300031754 | Hardwood Forest Soil | MARISPEELMERLVKGKPVPAILLLGEEPYLRDACRAQ |
| Ga0307475_112850703 | 3300031754 | Hardwood Forest Soil | MARLSPEALLERLEKGKPIPAILLLGEEPYLRDACRTLL |
| Ga0318547_108209601 | 3300031781 | Soil | VPQLSTEEFLVRLKKGRPIPAILLLGEEAYLRDLCRTALLD |
| Ga0307478_107363711 | 3300031823 | Hardwood Forest Soil | MARLSSEELLERLEKGKAIPAVLLLGEEPYLRDACRAHVV |
| Ga0318536_103869291 | 3300031893 | Soil | VPQLSTEEFLVRLKKGRPIPAILLLGEEAYLRDLCRTALLDAYVPQAARTWAVSR |
| Ga0310916_106071933 | 3300031942 | Soil | MASVGPEELLARLKKGKPIPAILLLGEETYLRDCCRAA |
| Ga0310913_107100442 | 3300031945 | Soil | VPQLSTEEFLVRLKKGRPIPAILLLGEEAYLRDLCRTALLDAYV |
| Ga0318530_101001071 | 3300031959 | Soil | MASVGPEELLARLKKGKPIPAILLLGEETYLRDCCRAALMDAY |
| Ga0307479_113281651 | 3300031962 | Hardwood Forest Soil | MARISSQELLARLEKGKPIPAILLLGEEVYLRDTCREQL |
| Ga0307479_120246161 | 3300031962 | Hardwood Forest Soil | MARVSAEELLKRLEKGKPIPAILLLGEEPYLRDACRTLLIERFVADAART |
| Ga0306922_102151764 | 3300032001 | Soil | MARIRTEQLKEKLGKGKPIPAMLLLGDEPYLRDACRA |
| Ga0318563_105121681 | 3300032009 | Soil | VPQLSTEEFLVRLKKGRPIPAILLLGEEAYLRDLCRTALL |
| Ga0307471_1006188041 | 3300032180 | Hardwood Forest Soil | MARLSPEALLERLEKGKPIPAILLLGEEPYLRDACRTLLVERFVAEALR |
| Ga0335074_116002182 | 3300032895 | Soil | MARVTREELLARLEKGKPIPAVLLLGEEPFLRDACRSL |
| Ga0335084_103352603 | 3300033004 | Soil | MAQILAGELLARLEKGRPIPAILLLGEETYLRDTCRAQLINRFVPEA |
| ⦗Top⦘ |