NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F025317

Metagenome / Metatranscriptome Family F025317

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025317
Family Type Metagenome / Metatranscriptome
Number of Sequences 202
Average Sequence Length 38 residues
Representative Sequence MARVTERLAVLAFAALIVAAIIGIAFAVGYGIGKLLL
Number of Associated Samples 156
Number of Associated Scaffolds 202

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.00 %
% of genes near scaffold ends (potentially truncated) 18.32 %
% of genes from short scaffolds (< 2000 bps) 80.20 %
Associated GOLD sequencing projects 149
AlphaFold2 3D model prediction Yes
3D model pTM-score0.60

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (91.584 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(20.792 % of family members)
Environment Ontology (ENVO) Unclassified
(31.683 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(26.238 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 53.85%    β-sheet: 0.00%    Coil/Unstructured: 46.15%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.60
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 202 Family Scaffolds
PF12773DZR 22.77
PF00334NDK 10.40
PF08245Mur_ligase_M 8.42
PF08241Methyltransf_11 3.96
PF02545Maf 2.97
PF10458Val_tRNA-synt_C 2.97
PF06723MreB_Mbl 0.99
PF12804NTP_transf_3 0.50
PF04085MreC 0.50
PF13460NAD_binding_10 0.50
PF01266DAO 0.50
PF13920zf-C3HC4_3 0.50
PF00753Lactamase_B 0.50
PF01019G_glu_transpept 0.50
PF04284DUF441 0.50
PF14264Glucos_trans_II 0.50

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 202 Family Scaffolds
COG0105Nucleoside diphosphate kinaseNucleotide transport and metabolism [F] 10.40
COG04247-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamilySecondary metabolites biosynthesis, transport and catabolism [Q] 2.97
COG1077Cell shape-determining ATPase MreB, actin-like superfamilyCell cycle control, cell division, chromosome partitioning [D] 0.99
COG0405Gamma-glutamyltranspeptidaseAmino acid transport and metabolism [E] 0.50
COG1792Cell shape-determining protein MreCCell cycle control, cell division, chromosome partitioning [D] 0.50
COG2707Uncharacterized membrane protein, DUF441 familyFunction unknown [S] 0.50


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms91.58 %
UnclassifiedrootN/A8.42 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000858|JGI10213J12805_10169216All Organisms → cellular organisms → Bacteria1448Open in IMG/M
3300000858|JGI10213J12805_10355056All Organisms → cellular organisms → Bacteria1409Open in IMG/M
3300000881|JGI10215J12807_1305664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria747Open in IMG/M
3300000956|JGI10216J12902_100946411All Organisms → cellular organisms → Bacteria786Open in IMG/M
3300000956|JGI10216J12902_106279964Not Available558Open in IMG/M
3300000956|JGI10216J12902_108165598Not Available533Open in IMG/M
3300000956|JGI10216J12902_117398090All Organisms → cellular organisms → Bacteria906Open in IMG/M
3300001213|JGIcombinedJ13530_108819454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria510Open in IMG/M
3300002121|C687J26615_10004966All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2965Open in IMG/M
3300002121|C687J26615_10098063All Organisms → cellular organisms → Bacteria734Open in IMG/M
3300002123|C687J26634_10125427All Organisms → cellular organisms → Bacteria903Open in IMG/M
3300003994|Ga0055435_10187780All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria590Open in IMG/M
3300004070|Ga0055488_10033243All Organisms → cellular organisms → Bacteria1042Open in IMG/M
3300005456|Ga0070678_100890396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria813Open in IMG/M
3300005526|Ga0073909_10553985All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300005543|Ga0070672_100156689All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1886Open in IMG/M
3300005543|Ga0070672_100203775All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300005548|Ga0070665_101700395All Organisms → cellular organisms → Bacteria638Open in IMG/M
3300005577|Ga0068857_100009622All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8397Open in IMG/M
3300005713|Ga0066905_100175404All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1575Open in IMG/M
3300005840|Ga0068870_11206208Not Available548Open in IMG/M
3300005937|Ga0081455_10521844All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria792Open in IMG/M
3300006196|Ga0075422_10563170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria524Open in IMG/M
3300006572|Ga0074051_11257954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria917Open in IMG/M
3300006573|Ga0074055_11621396All Organisms → cellular organisms → Bacteria578Open in IMG/M
3300006844|Ga0075428_100174213All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2331Open in IMG/M
3300006845|Ga0075421_101326659All Organisms → cellular organisms → Bacteria795Open in IMG/M
3300006852|Ga0075433_10025093All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria5037Open in IMG/M
3300006865|Ga0073934_10063580All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3064Open in IMG/M
3300006865|Ga0073934_10086988All Organisms → cellular organisms → Bacteria2445Open in IMG/M
3300006865|Ga0073934_10278498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1081Open in IMG/M
3300006880|Ga0075429_101104312All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300006969|Ga0075419_10659064All Organisms → cellular organisms → Bacteria739Open in IMG/M
3300007004|Ga0079218_11371184All Organisms → cellular organisms → Bacteria752Open in IMG/M
3300009167|Ga0113563_10346289All Organisms → cellular organisms → Bacteria1563Open in IMG/M
3300009176|Ga0105242_10618535All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1049Open in IMG/M
3300009176|Ga0105242_11711376All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria665Open in IMG/M
3300009177|Ga0105248_11494227All Organisms → cellular organisms → Bacteria765Open in IMG/M
3300009609|Ga0105347_1189521All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300009798|Ga0105060_126624All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium509Open in IMG/M
3300009799|Ga0105075_1004037All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1167Open in IMG/M
3300009817|Ga0105062_1004381All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2004Open in IMG/M
3300009820|Ga0105085_1083554All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria609Open in IMG/M
3300010359|Ga0126376_11580328All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria687Open in IMG/M
3300010362|Ga0126377_12442902All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria598Open in IMG/M
3300010391|Ga0136847_13038762All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia3997Open in IMG/M
3300010391|Ga0136847_13308929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1134Open in IMG/M
3300011412|Ga0137424_1017242All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1060Open in IMG/M
3300011412|Ga0137424_1113846All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria562Open in IMG/M
3300011412|Ga0137424_1143609Not Available507Open in IMG/M
3300011415|Ga0137325_1042273All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria955Open in IMG/M
3300011421|Ga0137462_1137293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium596Open in IMG/M
3300011423|Ga0137436_1162963All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria593Open in IMG/M
3300011443|Ga0137457_1118391All Organisms → cellular organisms → Bacteria858Open in IMG/M
3300011993|Ga0120182_1021505Not Available583Open in IMG/M
3300012043|Ga0136631_10000114All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria23002Open in IMG/M
3300012530|Ga0136635_10026685All Organisms → cellular organisms → Bacteria1712Open in IMG/M
3300012892|Ga0157294_10162594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria630Open in IMG/M
3300012904|Ga0157282_10145585All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium716Open in IMG/M
3300012905|Ga0157296_10135427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria719Open in IMG/M
3300012911|Ga0157301_10236207All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria635Open in IMG/M
3300012943|Ga0164241_10315062All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1119Open in IMG/M
3300012958|Ga0164299_11112738All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria591Open in IMG/M
3300012986|Ga0164304_10236977All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1215Open in IMG/M
3300012989|Ga0164305_11539887Not Available591Open in IMG/M
3300013308|Ga0157375_11059264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria948Open in IMG/M
3300014267|Ga0075313_1001110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5766Open in IMG/M
3300014272|Ga0075327_1174731Not Available678Open in IMG/M
3300014299|Ga0075303_1000830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2757Open in IMG/M
3300014299|Ga0075303_1036952All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300014315|Ga0075350_1185380All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium542Open in IMG/M
3300014318|Ga0075351_1167499Not Available535Open in IMG/M
3300014969|Ga0157376_11118867All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria814Open in IMG/M
3300014969|Ga0157376_11586813All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria688Open in IMG/M
3300015371|Ga0132258_10537346All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2928Open in IMG/M
3300015371|Ga0132258_11194709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1923Open in IMG/M
3300015372|Ga0132256_100666080All Organisms → cellular organisms → Bacteria1156Open in IMG/M
3300015374|Ga0132255_102162516All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300017792|Ga0163161_10079742All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2408Open in IMG/M
3300017944|Ga0187786_10058640All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1184Open in IMG/M
3300017965|Ga0190266_10002050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3978Open in IMG/M
3300017965|Ga0190266_10062202All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1377Open in IMG/M
3300017965|Ga0190266_10766857All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria613Open in IMG/M
3300017997|Ga0184610_1102862All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria907Open in IMG/M
3300018028|Ga0184608_10462958All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium545Open in IMG/M
3300018052|Ga0184638_1047001All Organisms → cellular organisms → Bacteria1571Open in IMG/M
3300018055|Ga0184616_10162330All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria829Open in IMG/M
3300018055|Ga0184616_10170594All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300018056|Ga0184623_10374216All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium633Open in IMG/M
3300018063|Ga0184637_10415504All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium798Open in IMG/M
3300018063|Ga0184637_10526499All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria683Open in IMG/M
3300018067|Ga0184611_1157304All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria806Open in IMG/M
3300018072|Ga0184635_10349532All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium568Open in IMG/M
3300018077|Ga0184633_10039704All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2379Open in IMG/M
3300018077|Ga0184633_10596370Not Available522Open in IMG/M
3300018078|Ga0184612_10042910All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2350Open in IMG/M
3300018078|Ga0184612_10180632All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1099Open in IMG/M
3300018083|Ga0184628_10101284All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1481Open in IMG/M
3300018422|Ga0190265_12930831All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria570Open in IMG/M
3300018429|Ga0190272_11017438All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300018432|Ga0190275_10045193All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3644Open in IMG/M
3300018432|Ga0190275_10852098All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium977Open in IMG/M
3300018432|Ga0190275_11046125All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria889Open in IMG/M
3300018466|Ga0190268_11437975All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria594Open in IMG/M
3300018469|Ga0190270_10021822All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales3972Open in IMG/M
3300018469|Ga0190270_10161739All Organisms → cellular organisms → Bacteria1836Open in IMG/M
3300018469|Ga0190270_11039498All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria848Open in IMG/M
3300018469|Ga0190270_11055654All Organisms → cellular organisms → Bacteria842Open in IMG/M
3300018476|Ga0190274_10605821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1122Open in IMG/M
3300018476|Ga0190274_13207854All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria550Open in IMG/M
3300018481|Ga0190271_10021089All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5027Open in IMG/M
3300019232|Ga0180114_1284918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300019356|Ga0173481_10098485All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1119Open in IMG/M
3300019356|Ga0173481_10100295All Organisms → cellular organisms → Bacteria1112Open in IMG/M
3300019361|Ga0173482_10020854All Organisms → cellular organisms → Bacteria1857Open in IMG/M
3300019884|Ga0193741_1007384All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2916Open in IMG/M
3300019884|Ga0193741_1083160All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria822Open in IMG/M
3300019884|Ga0193741_1087593All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria799Open in IMG/M
3300020016|Ga0193696_1140422Not Available602Open in IMG/M
3300020020|Ga0193738_1017730All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2262Open in IMG/M
3300020020|Ga0193738_1135897All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium673Open in IMG/M
3300021078|Ga0210381_10413084Not Available500Open in IMG/M
3300021082|Ga0210380_10334961All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300021329|Ga0210362_1439467All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales6418Open in IMG/M
3300022214|Ga0224505_10408856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium514Open in IMG/M
3300022756|Ga0222622_10616303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria784Open in IMG/M
3300022756|Ga0222622_11149194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria571Open in IMG/M
3300022899|Ga0247795_1018378All Organisms → cellular organisms → Bacteria1124Open in IMG/M
3300022915|Ga0247790_10182405Not Available552Open in IMG/M
3300023064|Ga0247801_1056398Not Available609Open in IMG/M
3300023066|Ga0247793_1032886All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria788Open in IMG/M
3300023261|Ga0247796_1017514All Organisms → cellular organisms → Bacteria1087Open in IMG/M
3300025160|Ga0209109_10011721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia4715Open in IMG/M
3300025164|Ga0209521_10045455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2981Open in IMG/M
3300025165|Ga0209108_10544228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium551Open in IMG/M
3300025167|Ga0209642_10275174All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Thermithiobacillaceae → Thermithiobacillus → Thermithiobacillus tepidarius961Open in IMG/M
3300025310|Ga0209172_10015830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales5825Open in IMG/M
3300025310|Ga0209172_10059569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales2326Open in IMG/M
3300025324|Ga0209640_10013486All Organisms → cellular organisms → Bacteria7110Open in IMG/M
3300025325|Ga0209341_10457437All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1025Open in IMG/M
3300025559|Ga0210087_1054430All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria800Open in IMG/M
3300025791|Ga0210115_1058928All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium810Open in IMG/M
3300025893|Ga0207682_10639159All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium500Open in IMG/M
3300025922|Ga0207646_11037282All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria723Open in IMG/M
3300025925|Ga0207650_10051352All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3051Open in IMG/M
3300025927|Ga0207687_10599087All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300025931|Ga0207644_11813838All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300025937|Ga0207669_10333124All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1166Open in IMG/M
3300026023|Ga0207677_10194764All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales1606Open in IMG/M
3300026062|Ga0208654_1001170All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3792Open in IMG/M
3300026067|Ga0207678_10257900All Organisms → cellular organisms → Bacteria1494Open in IMG/M
3300026089|Ga0207648_10009918All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia9079Open in IMG/M
3300026089|Ga0207648_10773922All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria892Open in IMG/M
3300026350|Ga0256823_1025427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium578Open in IMG/M
3300026815|Ga0207442_105149All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300027209|Ga0209875_1020064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria790Open in IMG/M
3300027401|Ga0208637_1025094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium666Open in IMG/M
3300027438|Ga0207564_108252Not Available511Open in IMG/M
(restricted) 3300027799|Ga0233416_10000011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria58641Open in IMG/M
(restricted) 3300027799|Ga0233416_10015024All Organisms → cellular organisms → Bacteria2532Open in IMG/M
(restricted) 3300027799|Ga0233416_10019721All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2224Open in IMG/M
3300027870|Ga0209023_10137177All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1686Open in IMG/M
3300027880|Ga0209481_10097764All Organisms → cellular organisms → Bacteria → Acidobacteria1415Open in IMG/M
3300027886|Ga0209486_11126811All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria534Open in IMG/M
3300028379|Ga0268266_11450847Not Available662Open in IMG/M
3300028596|Ga0247821_11012050All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria557Open in IMG/M
3300028707|Ga0307291_1023564All Organisms → cellular organisms → Bacteria1411Open in IMG/M
3300028719|Ga0307301_10242241All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria588Open in IMG/M
3300028811|Ga0307292_10285311All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria690Open in IMG/M
3300028824|Ga0307310_10583718All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria568Open in IMG/M
3300028884|Ga0307308_10131215All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1198Open in IMG/M
3300028889|Ga0247827_10539719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria736Open in IMG/M
3300030006|Ga0299907_10020027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter5014Open in IMG/M
3300031096|Ga0308193_1067690All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria566Open in IMG/M
3300031562|Ga0310886_10261272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria974Open in IMG/M
3300031576|Ga0247727_10022646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia9365Open in IMG/M
3300031576|Ga0247727_10135851All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2428Open in IMG/M
3300031576|Ga0247727_10319828All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium1304Open in IMG/M
3300031576|Ga0247727_10644542All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria787Open in IMG/M
3300031576|Ga0247727_10679199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium757Open in IMG/M
3300031707|Ga0315291_10634367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria962Open in IMG/M
3300031820|Ga0307473_10480926All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria834Open in IMG/M
3300031873|Ga0315297_10835018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria767Open in IMG/M
3300031908|Ga0310900_11816564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria519Open in IMG/M
3300031965|Ga0326597_10023274All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria7968Open in IMG/M
3300032013|Ga0310906_10429627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria879Open in IMG/M
3300032122|Ga0310895_10482642All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria620Open in IMG/M
3300032180|Ga0307471_103399777All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria564Open in IMG/M
3300033417|Ga0214471_10179669All Organisms → cellular organisms → Bacteria1741Open in IMG/M
3300033417|Ga0214471_11018845All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria636Open in IMG/M
3300033550|Ga0247829_10149949All Organisms → cellular organisms → Bacteria1815Open in IMG/M
3300033550|Ga0247829_10750766All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300033550|Ga0247829_11309824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria599Open in IMG/M
3300033551|Ga0247830_10089261All Organisms → cellular organisms → Bacteria2142Open in IMG/M
3300033811|Ga0364924_008007All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1915Open in IMG/M
3300033811|Ga0364924_130745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium584Open in IMG/M
3300033811|Ga0364924_165267All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria526Open in IMG/M
3300034164|Ga0364940_0254785All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300034176|Ga0364931_0252737All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium580Open in IMG/M
3300034354|Ga0364943_0439000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium508Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil20.79%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment7.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil4.95%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.96%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil3.47%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands3.47%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere3.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil2.97%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment2.97%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.48%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment2.48%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.48%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.48%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm2.48%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.98%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.98%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere1.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.49%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere1.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.49%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.99%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand0.99%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.99%
Freshwater And SedimentEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment0.50%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands0.50%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment0.50%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.50%
WetlandEnvironmental → Aquatic → Marine → Wetlands → Sediment → Wetland0.50%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.50%
TerrestrialEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial0.50%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.50%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.50%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.50%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.50%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.50%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.50%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.50%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.50%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.50%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300000881Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soilEnvironmentalOpen in IMG/M
3300000956Soil microbial communities from Great Prairies - Kansas, Native Prairie soilEnvironmentalOpen in IMG/M
3300001213Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly)EnvironmentalOpen in IMG/M
3300002121Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1EnvironmentalOpen in IMG/M
3300002123Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3EnvironmentalOpen in IMG/M
3300003994Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005543Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaGHost-AssociatedOpen in IMG/M
3300005548Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaGHost-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005840Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2Host-AssociatedOpen in IMG/M
3300005937Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1Host-AssociatedOpen in IMG/M
3300006196Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1Host-AssociatedOpen in IMG/M
3300006572Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006573Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006845Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5Host-AssociatedOpen in IMG/M
3300006852Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2Host-AssociatedOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300006880Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3Host-AssociatedOpen in IMG/M
3300006969Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3Host-AssociatedOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009167Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2)EnvironmentalOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009609Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890EnvironmentalOpen in IMG/M
3300009798Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_40_50EnvironmentalOpen in IMG/M
3300009799Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30EnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300009820Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300011412Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2EnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011421Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2EnvironmentalOpen in IMG/M
3300011423Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2EnvironmentalOpen in IMG/M
3300011443Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2EnvironmentalOpen in IMG/M
3300011993Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1EnvironmentalOpen in IMG/M
3300012043Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06)EnvironmentalOpen in IMG/M
3300012530Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06)EnvironmentalOpen in IMG/M
3300012892Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1EnvironmentalOpen in IMG/M
3300012904Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1EnvironmentalOpen in IMG/M
3300012905Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2EnvironmentalOpen in IMG/M
3300012911Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2EnvironmentalOpen in IMG/M
3300012943Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY)EnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014267Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1EnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014299Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1EnvironmentalOpen in IMG/M
3300014315Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1EnvironmentalOpen in IMG/M
3300014318Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rdEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300017792Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaGHost-AssociatedOpen in IMG/M
3300017944Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MGEnvironmentalOpen in IMG/M
3300017965Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 TEnvironmentalOpen in IMG/M
3300017997Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018055Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coexEnvironmentalOpen in IMG/M
3300018056Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018077Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1EnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018083Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1EnvironmentalOpen in IMG/M
3300018422Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 TEnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018481Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 TEnvironmentalOpen in IMG/M
3300019232Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019356Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2)EnvironmentalOpen in IMG/M
3300019361Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2)EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020020Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300021329Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022214Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300022899Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300023064Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6EnvironmentalOpen in IMG/M
3300023066Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6EnvironmentalOpen in IMG/M
3300023261Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6EnvironmentalOpen in IMG/M
3300025160Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2EnvironmentalOpen in IMG/M
3300025164Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4EnvironmentalOpen in IMG/M
3300025165Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025310Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025324Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025559Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025791Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025893Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026062Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026067Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026350Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU6EnvironmentalOpen in IMG/M
3300026815Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4w-12 (SPAdes)EnvironmentalOpen in IMG/M
3300027209Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes)EnvironmentalOpen in IMG/M
3300027401Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes)EnvironmentalOpen in IMG/M
3300027438Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A3a-11 (SPAdes)EnvironmentalOpen in IMG/M
3300027799 (restricted)Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MGEnvironmentalOpen in IMG/M
3300027870Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027886Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028884Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300030006Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031562Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3EnvironmentalOpen in IMG/M
3300031576Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031873Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031965Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033417Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155EnvironmentalOpen in IMG/M
3300033550Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300033811Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17EnvironmentalOpen in IMG/M
3300034164Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17EnvironmentalOpen in IMG/M
3300034176Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17EnvironmentalOpen in IMG/M
3300034354Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
JGI10213J12805_1016921633300000858SoilMARVTERLTVLAFAALLVAAIIGIAFGVGYGIGKLLL*
JGI10213J12805_1035505623300000858SoilMGRVTDRLTVLAFATLLVGAIIGIAFAVGYGVGKLLL*
JGI10215J12807_130566423300000881SoilMARLTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL*
JGI10216J12902_10094641123300000956SoilMARVTERVTVLVFAALLVGAIIGIAFAVGYGIGKLLL*
JGI10216J12902_10627996423300000956SoilMARVRDRLAVLAFATIVVAAIIGLAFALGYGVGKLLL*
JGI10216J12902_10816559823300000956SoilMAGRVTERLTVLAFAALIVGTIIGAAFLVGYGIGKLLL*
JGI10216J12902_11739809023300000956SoilMARLKERLAVLAFAVLIVAAIIGVAFALGYGVGKLLL*
JGIcombinedJ13530_10881945423300001213WetlandMARAWERLVVFAFAALIVAAIIGIAFAVGYGIGKLLL*
C687J26615_1000496633300002121SoilMARVTERLTVLAFAAVLVAAIIGIAFALGYGIGKLLL*
C687J26615_1009806323300002121SoilMARLRERLAVFAFAALLVAAIIAIAFGLGYGIGKLLL*
C687J26634_1012542723300002123SoilVARIRERLSVLAFAALLVAAIIGIAFALGYGIGKLLL*
Ga0055435_1018778023300003994Natural And Restored WetlandsRRNQGVIERLVVLAFAAFLVAAIVGLAYALGYAIGKVLL*
Ga0055488_1003324333300004070Natural And Restored WetlandsVIAVGRLLDRLTVLAFAALIVGTIIGVAFLVGYGIGKLLL*
Ga0070678_10089039623300005456Miscanthus RhizosphereGAACGMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL*
Ga0073909_1055398523300005526Surface SoilMSRILDRLSVLAFAVLVVAAIIGLAFALGYGVGKLLL*
Ga0070672_10015668923300005543Miscanthus RhizosphereMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL*
Ga0070672_10020377533300005543Miscanthus RhizosphereMARVWERLVVLAFAALIVAAIIGLAFAVGYGIGKLLL*
Ga0070665_10170039523300005548Switchgrass RhizosphereMARVGERLAVLVFAALIVAAIIGIAFAVGYGVGKLLL*
Ga0068857_100009622103300005577Corn RhizosphereMARATERLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL*
Ga0066905_10017540423300005713Tropical Forest SoilMARVTERLAVLAFAALIVAAIIGIAFALGYGVGKLLL*
Ga0068870_1120620823300005840Miscanthus RhizosphereMARVTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL*
Ga0081455_1052184423300005937Tabebuia Heterophylla RhizosphereMARVTERLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL*
Ga0075422_1056317013300006196Populus RhizosphereMSRATERLAVLAFAAVIVVAIIGIAFAVGYGIGKLLL*
Ga0074051_1125795423300006572SoilMARLRERLAVLAFAAIIVAAIIGLAFALGYGIGKLLL*
Ga0074055_1162139623300006573SoilMAKVRERLSVLAFGALLVVAIIGLAFALGYGIGKLLL*
Ga0075428_10017421323300006844Populus RhizosphereMARVRERLAVLAFAALIVVAIIGLAFALGYGVGKLLL*
Ga0075421_10132665933300006845Populus RhizosphereGGATCVMARVTERLTVLAFAALLVAAIIGIAFGVGYGIGKLLL*
Ga0075433_1002509343300006852Populus RhizosphereMARVTERLAVLGFAALIVAAIIGIAFALGYGVGKLLL*
Ga0073934_1006358023300006865Hot Spring SedimentMTRAGERLSVLAFAALLVGAIVGVAFLLGYAVGKLLL*
Ga0073934_1008698823300006865Hot Spring SedimentMARLTERLTVLAFAAVLVAAILGAAFALGYGIGKLLL*
Ga0073934_1027849813300006865Hot Spring SedimentMARTTERLAVLAFATLIVGAIIGIAFLVGYGVGKLLL*
Ga0075429_10110431223300006880Populus RhizosphereMARVTERLTVLAFAALLVAAIIGIAFGVGYGIGKLL
Ga0075419_1065906423300006969Populus RhizosphereMARTTERLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL*
Ga0079218_1137118423300007004Agricultural SoilVIGVARMTERLAVLAFAALIVGTIIGVAFVVGYGIGKLLL*
Ga0113563_1034628923300009167Freshwater WetlandsMARVTERLAVLAFAALIVIAIVGLAFALGYGIGKLLL*
Ga0105242_1061853533300009176Miscanthus RhizosphereGAACGMARVTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL*
Ga0105242_1171137623300009176Miscanthus RhizosphereMARVGERLAVLVFAALIVVAIIGIAFAVGYGVGKLLL*
Ga0105248_1149422723300009177Switchgrass RhizosphereMARVTERLSVLAFAALIVAAIIGLAFALGYGVGKLLL*
Ga0105347_118952123300009609SoilMARVRERLAVLAFAALLVLAIIGMAFALGYGIGKLLL*
Ga0105060_12662423300009798Groundwater SandVARVTERLSVLAFAALLVLAIIGIAFALGYGIGKLLL*
Ga0105075_100403723300009799Groundwater SandMARVTERLSVLAFAALLVGAIIAIAFGLGYGIGKLLL*
Ga0105062_100438143300009817Groundwater SandMARVTERLSVFAFAALLVGAIIAIAFGLGYGIGKLLL*
Ga0105085_108355423300009820Groundwater SandMGRVTDRLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL*
Ga0126376_1158032823300010359Tropical Forest SoilMARVTERLAVLAFAALIVIAIIGIAFALGYGVGKLLL*
Ga0126377_1244290223300010362Tropical Forest SoilMARVAERLAVLAFAALIVAAIIGIAFALGYGVGKLLL*
Ga0136847_1303876223300010391Freshwater SedimentVARVTERLSVLAFAALLVAAIIGIAFALGYGIGKLLL*
Ga0136847_1330892923300010391Freshwater SedimentVARVTERLSVLAFAAVLVLAIIGIAFALGYGIGKLLL*
Ga0137424_101724223300011412SoilVARVRERLSVLAFAAVLVLAIVGIAFALGYGIGKLLL*
Ga0137424_111384623300011412SoilVIGVARMTERLAVLAFAALIVGTIIVVAFVVGYGIGKLLL*
Ga0137424_114360923300011412SoilMARVTERLTVLAFAALLVAAIIGLAFAMGYGIGKLLL*
Ga0137325_104227313300011415SoilMTERLAVLAFAALIVGTIIGVAFVLGYGIGKLLL*
Ga0137462_113729323300011421SoilMSRVTERLAVLTFAALLVLAIIGMAFALGYGIGKLLL*
Ga0137436_116296313300011423SoilMTERLAVLAFAALIVGTIIVVAFVVGYGIGKLLL*
Ga0137457_111839113300011443SoilAGGAAHRVVRVRERLSVLAFAALLVVAIIGIAFALGYGIGKLLL*
Ga0120182_102150523300011993TerrestrialMARLIERLTVLAFAALLVAAIIGIAFAMGYGIGKLLL*
Ga0136631_10000114273300012043Polar Desert SandVIGVARMSERLAVLAFAALIVGTIIGVAFVVGYGIGKLLL*
Ga0136635_1002668533300012530Polar Desert SandMTERLAVLAFAALIVGTIIGVAFAVGYGIGKLLL*
Ga0157294_1016259413300012892SoilACGMARVTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL*
Ga0157282_1014558523300012904SoilMARVTERLAVLAFAALIVVAIIGLAFALGYGVGKLLL*
Ga0157296_1013542723300012905SoilMARVWERLVVLAFAALIVAAIIGLAFALGYGVGKLLL*
Ga0157301_1023620723300012911SoilAACGMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL*
Ga0164241_1031506223300012943SoilMARVRERLAVLVFAALIVAAIIGVAFAVGYGVGKLLL*
Ga0164299_1111273823300012958SoilMARVTERLTVLAFAALIVAAIIGIAFAVGYGVGKLLL*
Ga0164304_1023697743300012986SoilRPGGAALGMARVRERLAVLAFAALIVAAIIGIAFALGYGVGKLLL*
Ga0164305_1153988723300012989SoilMSRILDRLSVLAFAVLVVAAITGLAFALGYGVGKLLL*
Ga0157375_1105926423300013308Miscanthus RhizosphereMARVTERLAVLGFAALIVVAIIGIAFAIGYGVGKLLL*
Ga0075313_100111073300014267Natural And Restored WetlandsMARVTERLTVLAFAALLVSAIIGIAFAVGYGIGKLLL*
Ga0075327_117473123300014272Natural And Restored WetlandsMLDRLTVLAFAALIVGTIIGVAFLVGYGIGKLLL*
Ga0075303_100083043300014299Natural And Restored WetlandsVIERLVVLAFAAFLVAAIVGLAYALGYAIGKVLL*
Ga0075303_103695223300014299Natural And Restored WetlandsMARMTERLAVLAFAALVVAAIVGIAFALGYAIGKLLL*
Ga0075350_118538013300014315Natural And Restored WetlandsMARMTERLAVLAFAALVVAAIVGVAFALGYAIGKLLL*
Ga0075351_116749923300014318Natural And Restored WetlandsMARVMERIAVLAFAAVLVAAIVALAFALGYAIGKVLL*
Ga0157376_1111886723300014969Miscanthus RhizosphereMARVTERLAVLGFAALIVAAIIGIAFALGYAVGKLLL*
Ga0157376_1158681313300014969Miscanthus RhizosphereSRILDRLSVLAFAVLVVAAIIGLAFALGYGVGKLLL*
Ga0132258_1053734633300015371Arabidopsis RhizosphereMARVRERLSVLAFAVLIVATIIGLAFALGYGVGKLLL*
Ga0132258_1119470923300015371Arabidopsis RhizosphereMRRVWDRLVVLAFAALIVGAIIGLAFAVGYGIGKLLL*
Ga0132256_10066608033300015372Arabidopsis RhizosphereMARVTERLAVLAFGALIVAAIIGLAFALGYGVGKLLL*
Ga0132255_10216251613300015374Arabidopsis RhizospherePGAGGAACGMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL*
Ga0163161_1007974223300017792Switchgrass RhizosphereMARVTERLAVLAFAALIVAAIIGLAFAVGYGVGKLLL
Ga0187786_1005864023300017944Tropical PeatlandMSRLRERLAVLAFAALLVLAIVGLAYALGYAIGKLLL
Ga0190266_1000205033300017965SoilMGRVTERLTVLAFAALIVAAIIGIAFAVGYGVGKLLL
Ga0190266_1006220223300017965SoilMARVRERLAVLAFAALIVAAIIGIAFAVGYGIGKLLL
Ga0190266_1076685723300017965SoilVIGVARMTERLAVLAFAALIVGTIIGVAFVVGYGIGKLLL
Ga0184610_110286223300017997Groundwater SedimentMARVRERLAVLAFAALLVAAIVGIAFVLGYGIGRLLL
Ga0184608_1046295823300018028Groundwater SedimentMARVTERLAVLAFAALIVAAIIGIAFAFGYGIGKLLL
Ga0187788_1050426523300018032Tropical PeatlandLAKVRERLAVLAFAALVVAGIVGGAFALVYLVGKLLL
Ga0184638_104700133300018052Groundwater SedimentMARVTERLSVLAFAALLVGAIIAIAFGLGYGIGKLLL
Ga0184616_1016233023300018055Groundwater SedimentMSRVTERLAVLTFAALLVLAIIGMAFALGYGIGKLLL
Ga0184616_1017059423300018055Groundwater SedimentVIGVARMTERLAVLAFAALIVGTIIVVAFVVGYGIGKLLL
Ga0184623_1037421623300018056Groundwater SedimentVARVTERLSVFAFAALLVAAIIGIAFALGYGIGKLLL
Ga0184637_1041550423300018063Groundwater SedimentMARVTERLAVFAFAALIVAAIIGIAFAVGYGIGKLLL
Ga0184637_1052649923300018063Groundwater SedimentMGRVTERLAVLAFAALLVAAIIGIAFALGYGIGRLLL
Ga0184611_115730423300018067Groundwater SedimentMARVTERLTVLAFAALIVAAIIGIAFAFGYGIGKLLL
Ga0184635_1034953223300018072Groundwater SedimentMARVTERLAVLAFAALIVAAIIGIAFAVGYGIGKLLL
Ga0184633_1003970423300018077Groundwater SedimentVARVRERLSVLAFAALLVAAIIGIAFALGYGIGKLLL
Ga0184633_1059637023300018077Groundwater SedimentMARVTGRLSVLAFAALLVAAIIGIAFALGYGIGKLLL
Ga0184612_1004291053300018078Groundwater SedimentVARVRERLSVLAFAAVLVLAIIGIAFALGYGIGKLLL
Ga0184612_1018063223300018078Groundwater SedimentMARVRERLAVLAFAALLVVAIIGMAFALGYGIGKLLL
Ga0184628_1010128423300018083Groundwater SedimentMARVTERLTVLAFAALIVAAIIGIAFAVGYGVGKLLL
Ga0190265_1293083123300018422SoilVIGVARMTERLAVLAFAALIVGTIIGVAFVVGYGVGKLLL
Ga0190272_1101743823300018429SoilVIGVARMTERLAVLAFAALIVGTIIGIAFVVGYGIGKLLL
Ga0190275_1004519333300018432SoilMARVTDRLTVLAFAALLVGAIIGAAFAVGYGIGKLLL
Ga0190275_1085209823300018432SoilMARVTERLAVFAFAAFIVASIIGIAFAVGYGIGKLLL
Ga0190275_1104612523300018432SoilMARVTERLTVLAFAALLVGAIIGLAFAVGYGIGKLLL
Ga0190268_1143797523300018466SoilMARATERLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL
Ga0190270_1002182233300018469SoilMARVTERLTVLAFAALLVAAIIAIAFGVGYGIGKLLL
Ga0190270_1016173923300018469SoilMARVTERLAVFAFAAIIVASIIGIAFAVGYGIGKLLL
Ga0190270_1103949823300018469SoilVARVREGLSVLAFAAVLVLAIVGIAFALGYGIGKLLL
Ga0190270_1105565423300018469SoilVIGVARTTERLAVLAFAALIVGTIIGVAFVVGYGIGKLLL
Ga0190274_1060582123300018476SoilMARVTERVTVLVFAALLVGAIIGIAFAVGYGIGKLLL
Ga0190274_1320785413300018476SoilRAGGAARVMARVTERLAVFAFAAFIVASIIGIAFAVGYGIGKLLL
Ga0190271_1002108963300018481SoilVIAVGRLLDRLTVLAFAALIVGTIIGVAFLVGYGIGKLLL
Ga0190271_1058410123300018481SoilMAKLRERLAVLAFAALIVTAIVGGSLALGYLVGKLLL
Ga0180114_128491823300019232Groundwater SedimentVIGVARMTERLAVLAFATLIVGTIIVVAFVVGYGIGKLLL
Ga0173481_1009848533300019356SoilMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL
Ga0173481_1010029523300019356SoilMARLTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL
Ga0173482_1002085443300019361SoilMARVGERLAVLVFAALIVAAIIGIAFAVGYGVGKLLL
Ga0193741_100738423300019884SoilMARVTERLTVLAFAALLVAAIIGAAFAVGYGIGKLLL
Ga0193741_108316023300019884SoilMARVTERLTVLAFAVLLVGAIIGAAFAVGYGIGKLLL
Ga0193741_108759323300019884SoilVARVRERLSVLAFAAVLVLAIVGIAFALGYGIGKLLL
Ga0193696_114042223300020016SoilMSRVTERLTVLAFAALIVAAIIGIAFAVGYGVGKL
Ga0193738_101773023300020020SoilVIGVARMTERLAVFAFAALIVGTIIGVAFVVGYGIGKLLL
Ga0193738_113589723300020020SoilMARVKERVAVLAFAALIVGSIIGLAFAVGYGIGKLLL
Ga0210381_1041308423300021078Groundwater SedimentMARVTERLAVLAFAAIIVAAIIGLAFALGYGIGKLLL
Ga0210380_1033496123300021082Groundwater SedimentMARVTERLTVLAFAALIVAAIIGIAFALGYGVGKLLL
Ga0210362_143946773300021329EstuarineVARVTERLSVLAFAALLVAAIIGIAFALGYGIGKLLL
Ga0224505_1040885623300022214SedimentMARVTERLAVLAFAVFLVAAIVGLAFALGYAIGKALL
Ga0222622_1061630323300022756Groundwater SedimentMARVRERLAVLAFAVLVVAAIIGLAFALGYGIGKLLL
Ga0222622_1114919423300022756Groundwater SedimentMSRVTERLTVLAFAALIVAAIIGIAFAVGYGVGKLLL
Ga0247795_101837833300022899SoilGMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL
Ga0247790_1018240523300022915SoilMARVTERLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL
Ga0247801_105639823300023064SoilMARVTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL
Ga0247793_103288633300023066SoilCGMARVTERLAVLAFAALIVAAIIGIAFALGYGVGKLLL
Ga0247796_101751433300023261SoilRVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL
Ga0209109_1001172133300025160SoilMARVTERLTVLAFAALLVAAIIGIAFAVGYGIGKLLL
Ga0209521_1004545553300025164SoilVARIRERLSVLAFAALLVAAIIGIAFALGYGIGKLLL
Ga0209108_1054422823300025165SoilMARVTERLTVLAFAAVLVAAIIGIAFALGYGIGKLLL
Ga0209642_1027517433300025167SoilMARVTERLAVLAFAALLVVAIIAIAFGLGYGIGKLLL
Ga0209172_1001583053300025310Hot Spring SedimentMTRAGERLSVLAFAALLVGAIVGVAFLLGYAVGKLLL
Ga0209172_1005956923300025310Hot Spring SedimentMARLTERLTVLAFAAVLVAAILGAAFALGYGIGKLLL
Ga0209640_1001348693300025324SoilVARVTERLSVLAFAALLVAAIIAIAFGLGYGIGKLLL
Ga0209341_1045743723300025325SoilMARVTERLAVLAFAALLVAAIIGIAFALGYGIGKLLL
Ga0210087_105443023300025559Natural And Restored WetlandsMARAWERLVVFAFAALIVAAIIGIAFAVGYGIGKLLL
Ga0210115_105892833300025791Natural And Restored WetlandsMARLTERLAVLAFAALIVATIVGLAFALGYGIGKLLL
Ga0207682_1063915923300025893Miscanthus RhizosphereMARVWERLVVLAFAALIVAAIIGLAFAVGYGIGKLLL
Ga0207646_1103728223300025922Corn, Switchgrass And Miscanthus RhizosphereMARVTERLAVLAFAALIVAAIIGIAFALGYGVGKLLL
Ga0207650_1005135233300025925Switchgrass RhizosphereMARVAERLAVLAFAALIVAAIIGLAFALGYGVGKLLL
Ga0207687_1059908733300025927Miscanthus RhizosphereRVTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL
Ga0207644_1181383823300025931Switchgrass RhizosphereMARVTERLAVLGFAALIVVAIIGIAFALGYGVGKLLL
Ga0207669_1033312423300025937Miscanthus RhizosphereMARVTERLAVLAFATLIVAAIIGLAFALGYGVGKLLL
Ga0207677_1019476423300026023Miscanthus RhizosphereMARVWERFVVLAFAALIVAAIIGLAFAVGYGIGKLLL
Ga0208654_100117033300026062Natural And Restored WetlandsMARVTERLTVLAFAALLVSAIIGIAFAVGYGIGKLLL
Ga0207678_1025790043300026067Corn RhizosphereAFTMARVGERLAVLVFAALIVAAIIGIAFAVGYGVGKLLL
Ga0207648_1000991813300026089Miscanthus RhizosphereGAGGAACGMARVTERLAVLAFAALIVAAIIGIAFALGYGVGKLLL
Ga0207648_1077392213300026089Miscanthus RhizosphereMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLL
Ga0256823_102542723300026350SedimentMARMTERLAVLAFAALVVAAIVGVAFALGYAIGKLLL
Ga0207442_10514923300026815SoilMARVRERLAVLAFAALIVVAIIGLAFALGYGVGKLLL
Ga0209875_102006423300027209Groundwater SandMARVTERLAVLAFAALVVAAIVGIAFGLGYGIGKLLL
Ga0208637_102509423300027401SoilMARLRERLAVLAFAAIIVAAIIGLAFALGYGIGKLLL
Ga0207564_10825213300027438SoilAGGAACGMARLTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL
(restricted) Ga0233416_10000011473300027799SedimentMARVTERLAVLAFAALIVVAIVGLAFALGYGIGKLLL
(restricted) Ga0233416_1001502423300027799SedimentMGRVTERLAVLAFAALIVAAIIALAFALGYGIGKLLL
(restricted) Ga0233416_1001972133300027799SedimentMARVTERLAVLAFAALIVAAIIGLAFALGYGLGKLLL
Ga0209023_1013717723300027870Freshwater And SedimentMPRVTERLAVLTFAALLVLAIIGMAFALGYGIGKLLL
Ga0209481_1009776433300027880Populus RhizosphereMARVTERLTVLAFAALLVAAIIGIAFGVGYGIGKLLL
Ga0209486_1112681123300027886Agricultural SoilVARVTERLAVFAFAAFVVASIIGIAFVVGYAIGKLLL
Ga0268266_1145084713300028379Switchgrass RhizosphereMARVWERLVVLAFAALIVAAIIGLAFAVGYGIGKLL
Ga0247821_1101205023300028596SoilHCAAGAARGVARVTERLSVLAFAALLVGAIIAIAFGLGYGIGKLLL
Ga0307291_102356433300028707SoilMARLKERLAVLAFAVLIVAAIIGVAFALGYGVGKLLL
Ga0307301_1024224123300028719SoilGMARVTERLAVLAFAALIVAAIIGIAFAFGYGIGKLLL
Ga0307292_1028531113300028811SoilMARVRERLAVLAFAVVVVAAIIGLAFALGYGIGKLLL
Ga0307310_1058371823300028824SoilMARLRERLAVLAFAVLIVAAIIGLAFALGYGVGKLLL
Ga0307308_1013121543300028884SoilMARVTERLAVLAFAAIIVAAIIGLAFVLGYVIGKLLL
Ga0247827_1053971913300028889SoilMARVAERLAVLAFAALIVAAIIGIAFAFGYGIGKLLL
Ga0299907_1002002713300030006SoilMARVRERLAVLAFAALIVGSIIGLAFAVGYGVGKLLL
Ga0308193_106769013300031096SoilRTGGAACAMARLRERLAVLAFAVLIVAAIIGLAFALGYGVGKLLL
Ga0310886_1026127223300031562SoilMARVTERLAVLAFAALIVVAIIGLAFALGYGVGKLLL
Ga0247727_10022646113300031576BiofilmGGTACRMPRVGERLSVLAFAALIVAAIVGIAFALGYLVGKLLL
Ga0247727_1013585123300031576BiofilmVARLRERLSVLAFAALLVAAIIAIAFGLGYGIGKLLL
Ga0247727_1031982823300031576BiofilmMARVTERLSVLAFAALLVAAIIGIAFALGYGIGKLLL
Ga0247727_1064454223300031576BiofilmMARVTERLSVLAFAALLVGAIIVFAFALGYGVGKLLL
Ga0247727_1067919923300031576BiofilmMPRVGERLSVLAFAALIVAAIVGIAFALGYLVGKLL
Ga0315291_1063436713300031707SedimentVARVKERLSVLAFAALLVAAIIGIAFALGYGIGKLLL
Ga0307473_1048092623300031820Hardwood Forest SoilMARVTERLAVLAFAALIVAAVIGIAFALGYGVGKLLL
Ga0315297_1083501823300031873SedimentMPRVTERLAVLAFAALLVLAIIGMAFALGYGIGKLLL
Ga0310900_1181656423300031908SoilGVAWRMARVWERLVVLAFAALIVAAIIGLAFAVGYGIGKLLL
Ga0326597_1002327493300031965SoilVARVTERLSVLAFAALLVAAIIVIAFGLGYGIGKLLL
Ga0310906_1042962723300032013SoilMARVTERLTVLAFAALLVGAIIGIAFAVGYGIGKLLL
Ga0310895_1048264213300032122SoilCGMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL
Ga0307471_10339977723300032180Hardwood Forest SoilMARVTERLSVLAFAALLVGAIIAIAFALGYGIGKLLL
Ga0214471_1017966933300033417SoilMARVTERLSVLAFAALLVAAIIAIAFGLGYGIGKLLL
Ga0214471_1101884523300033417SoilMARVTERLTVLVFAALIVAAIIGIAFAVGYGIGKLLL
Ga0247829_1014994913300033550SoilACGMARLTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL
Ga0247829_1075076613300033550SoilAACGMSQVTERLTVLAFAALIVAAIIGIAFALGYGVGKLLL
Ga0247829_1130982423300033550SoilGGAARVVARVTERLAVFAFAAFVVASIIGIAFVVGYAIGKLLL
Ga0247830_1008926113300033551SoilREGGATCVMARVTERLAVLAFAALIVAAIIGIAFAFGYGIGKLLL
Ga0364924_008007_1352_14653300033811SedimentMARVTERLAVLVFAALLVAAIIGIAFALGYGIGKLLL
Ga0364924_130745_279_3923300033811SedimentVARVTERLSVLAFAALLVAAIVGIAFALGYGIGKLLL
Ga0364924_165267_30_1433300033811SedimentMASVRERLAVLAFAALLVAAIVGIAFALGYGIGKLLL
Ga0364940_0254785_110_2233300034164SedimentMARVRERLAVFAFAAIVVAAIVGIAFGLGYGIGKLLL
Ga0364931_0252737_241_3543300034176SedimentMARVTERLTVLVFAALIVATIIGIAFAVGYGIGKLLL
Ga0364943_0439000_164_2773300034354SedimentMARVTEKLSVLAFAALLVAAIIGIAFALGYGIGKLLL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.