| Basic Information | |
|---|---|
| Family ID | F025317 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 202 |
| Average Sequence Length | 38 residues |
| Representative Sequence | MARVTERLAVLAFAALIVAAIIGIAFAVGYGIGKLLL |
| Number of Associated Samples | 156 |
| Number of Associated Scaffolds | 202 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 82.00 % |
| % of genes near scaffold ends (potentially truncated) | 18.32 % |
| % of genes from short scaffolds (< 2000 bps) | 80.20 % |
| Associated GOLD sequencing projects | 149 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.60 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (91.584 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (20.792 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.683 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (26.238 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 53.85% β-sheet: 0.00% Coil/Unstructured: 46.15% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.60 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 202 Family Scaffolds |
|---|---|---|
| PF12773 | DZR | 22.77 |
| PF00334 | NDK | 10.40 |
| PF08245 | Mur_ligase_M | 8.42 |
| PF08241 | Methyltransf_11 | 3.96 |
| PF02545 | Maf | 2.97 |
| PF10458 | Val_tRNA-synt_C | 2.97 |
| PF06723 | MreB_Mbl | 0.99 |
| PF12804 | NTP_transf_3 | 0.50 |
| PF04085 | MreC | 0.50 |
| PF13460 | NAD_binding_10 | 0.50 |
| PF01266 | DAO | 0.50 |
| PF13920 | zf-C3HC4_3 | 0.50 |
| PF00753 | Lactamase_B | 0.50 |
| PF01019 | G_glu_transpept | 0.50 |
| PF04284 | DUF441 | 0.50 |
| PF14264 | Glucos_trans_II | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 202 Family Scaffolds |
|---|---|---|---|
| COG0105 | Nucleoside diphosphate kinase | Nucleotide transport and metabolism [F] | 10.40 |
| COG0424 | 7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily | Secondary metabolites biosynthesis, transport and catabolism [Q] | 2.97 |
| COG1077 | Cell shape-determining ATPase MreB, actin-like superfamily | Cell cycle control, cell division, chromosome partitioning [D] | 0.99 |
| COG0405 | Gamma-glutamyltranspeptidase | Amino acid transport and metabolism [E] | 0.50 |
| COG1792 | Cell shape-determining protein MreC | Cell cycle control, cell division, chromosome partitioning [D] | 0.50 |
| COG2707 | Uncharacterized membrane protein, DUF441 family | Function unknown [S] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 91.58 % |
| Unclassified | root | N/A | 8.42 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000858|JGI10213J12805_10169216 | All Organisms → cellular organisms → Bacteria | 1448 | Open in IMG/M |
| 3300000858|JGI10213J12805_10355056 | All Organisms → cellular organisms → Bacteria | 1409 | Open in IMG/M |
| 3300000881|JGI10215J12807_1305664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 747 | Open in IMG/M |
| 3300000956|JGI10216J12902_100946411 | All Organisms → cellular organisms → Bacteria | 786 | Open in IMG/M |
| 3300000956|JGI10216J12902_106279964 | Not Available | 558 | Open in IMG/M |
| 3300000956|JGI10216J12902_108165598 | Not Available | 533 | Open in IMG/M |
| 3300000956|JGI10216J12902_117398090 | All Organisms → cellular organisms → Bacteria | 906 | Open in IMG/M |
| 3300001213|JGIcombinedJ13530_108819454 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 510 | Open in IMG/M |
| 3300002121|C687J26615_10004966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2965 | Open in IMG/M |
| 3300002121|C687J26615_10098063 | All Organisms → cellular organisms → Bacteria | 734 | Open in IMG/M |
| 3300002123|C687J26634_10125427 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300003994|Ga0055435_10187780 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
| 3300004070|Ga0055488_10033243 | All Organisms → cellular organisms → Bacteria | 1042 | Open in IMG/M |
| 3300005456|Ga0070678_100890396 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 813 | Open in IMG/M |
| 3300005526|Ga0073909_10553985 | All Organisms → cellular organisms → Bacteria | 562 | Open in IMG/M |
| 3300005543|Ga0070672_100156689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1886 | Open in IMG/M |
| 3300005543|Ga0070672_100203775 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
| 3300005548|Ga0070665_101700395 | All Organisms → cellular organisms → Bacteria | 638 | Open in IMG/M |
| 3300005577|Ga0068857_100009622 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8397 | Open in IMG/M |
| 3300005713|Ga0066905_100175404 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1575 | Open in IMG/M |
| 3300005840|Ga0068870_11206208 | Not Available | 548 | Open in IMG/M |
| 3300005937|Ga0081455_10521844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 792 | Open in IMG/M |
| 3300006196|Ga0075422_10563170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 524 | Open in IMG/M |
| 3300006572|Ga0074051_11257954 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 917 | Open in IMG/M |
| 3300006573|Ga0074055_11621396 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300006844|Ga0075428_100174213 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2331 | Open in IMG/M |
| 3300006845|Ga0075421_101326659 | All Organisms → cellular organisms → Bacteria | 795 | Open in IMG/M |
| 3300006852|Ga0075433_10025093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5037 | Open in IMG/M |
| 3300006865|Ga0073934_10063580 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3064 | Open in IMG/M |
| 3300006865|Ga0073934_10086988 | All Organisms → cellular organisms → Bacteria | 2445 | Open in IMG/M |
| 3300006865|Ga0073934_10278498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1081 | Open in IMG/M |
| 3300006880|Ga0075429_101104312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 693 | Open in IMG/M |
| 3300006969|Ga0075419_10659064 | All Organisms → cellular organisms → Bacteria | 739 | Open in IMG/M |
| 3300007004|Ga0079218_11371184 | All Organisms → cellular organisms → Bacteria | 752 | Open in IMG/M |
| 3300009167|Ga0113563_10346289 | All Organisms → cellular organisms → Bacteria | 1563 | Open in IMG/M |
| 3300009176|Ga0105242_10618535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1049 | Open in IMG/M |
| 3300009176|Ga0105242_11711376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 665 | Open in IMG/M |
| 3300009177|Ga0105248_11494227 | All Organisms → cellular organisms → Bacteria | 765 | Open in IMG/M |
| 3300009609|Ga0105347_1189521 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300009798|Ga0105060_126624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 509 | Open in IMG/M |
| 3300009799|Ga0105075_1004037 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1167 | Open in IMG/M |
| 3300009817|Ga0105062_1004381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2004 | Open in IMG/M |
| 3300009820|Ga0105085_1083554 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 609 | Open in IMG/M |
| 3300010359|Ga0126376_11580328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 687 | Open in IMG/M |
| 3300010362|Ga0126377_12442902 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 598 | Open in IMG/M |
| 3300010391|Ga0136847_13038762 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3997 | Open in IMG/M |
| 3300010391|Ga0136847_13308929 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1134 | Open in IMG/M |
| 3300011412|Ga0137424_1017242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1060 | Open in IMG/M |
| 3300011412|Ga0137424_1113846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 562 | Open in IMG/M |
| 3300011412|Ga0137424_1143609 | Not Available | 507 | Open in IMG/M |
| 3300011415|Ga0137325_1042273 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 955 | Open in IMG/M |
| 3300011421|Ga0137462_1137293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 596 | Open in IMG/M |
| 3300011423|Ga0137436_1162963 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 593 | Open in IMG/M |
| 3300011443|Ga0137457_1118391 | All Organisms → cellular organisms → Bacteria | 858 | Open in IMG/M |
| 3300011993|Ga0120182_1021505 | Not Available | 583 | Open in IMG/M |
| 3300012043|Ga0136631_10000114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 23002 | Open in IMG/M |
| 3300012530|Ga0136635_10026685 | All Organisms → cellular organisms → Bacteria | 1712 | Open in IMG/M |
| 3300012892|Ga0157294_10162594 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 630 | Open in IMG/M |
| 3300012904|Ga0157282_10145585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 716 | Open in IMG/M |
| 3300012905|Ga0157296_10135427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 719 | Open in IMG/M |
| 3300012911|Ga0157301_10236207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 635 | Open in IMG/M |
| 3300012943|Ga0164241_10315062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1119 | Open in IMG/M |
| 3300012958|Ga0164299_11112738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 591 | Open in IMG/M |
| 3300012986|Ga0164304_10236977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1215 | Open in IMG/M |
| 3300012989|Ga0164305_11539887 | Not Available | 591 | Open in IMG/M |
| 3300013308|Ga0157375_11059264 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 948 | Open in IMG/M |
| 3300014267|Ga0075313_1001110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5766 | Open in IMG/M |
| 3300014272|Ga0075327_1174731 | Not Available | 678 | Open in IMG/M |
| 3300014299|Ga0075303_1000830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2757 | Open in IMG/M |
| 3300014299|Ga0075303_1036952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300014315|Ga0075350_1185380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 542 | Open in IMG/M |
| 3300014318|Ga0075351_1167499 | Not Available | 535 | Open in IMG/M |
| 3300014969|Ga0157376_11118867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 814 | Open in IMG/M |
| 3300014969|Ga0157376_11586813 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 688 | Open in IMG/M |
| 3300015371|Ga0132258_10537346 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2928 | Open in IMG/M |
| 3300015371|Ga0132258_11194709 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1923 | Open in IMG/M |
| 3300015372|Ga0132256_100666080 | All Organisms → cellular organisms → Bacteria | 1156 | Open in IMG/M |
| 3300015374|Ga0132255_102162516 | All Organisms → cellular organisms → Bacteria | 848 | Open in IMG/M |
| 3300017792|Ga0163161_10079742 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2408 | Open in IMG/M |
| 3300017944|Ga0187786_10058640 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1184 | Open in IMG/M |
| 3300017965|Ga0190266_10002050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3978 | Open in IMG/M |
| 3300017965|Ga0190266_10062202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1377 | Open in IMG/M |
| 3300017965|Ga0190266_10766857 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 613 | Open in IMG/M |
| 3300017997|Ga0184610_1102862 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 907 | Open in IMG/M |
| 3300018028|Ga0184608_10462958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 545 | Open in IMG/M |
| 3300018052|Ga0184638_1047001 | All Organisms → cellular organisms → Bacteria | 1571 | Open in IMG/M |
| 3300018055|Ga0184616_10162330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 829 | Open in IMG/M |
| 3300018055|Ga0184616_10170594 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
| 3300018056|Ga0184623_10374216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 633 | Open in IMG/M |
| 3300018063|Ga0184637_10415504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 798 | Open in IMG/M |
| 3300018063|Ga0184637_10526499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 683 | Open in IMG/M |
| 3300018067|Ga0184611_1157304 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 806 | Open in IMG/M |
| 3300018072|Ga0184635_10349532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 568 | Open in IMG/M |
| 3300018077|Ga0184633_10039704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2379 | Open in IMG/M |
| 3300018077|Ga0184633_10596370 | Not Available | 522 | Open in IMG/M |
| 3300018078|Ga0184612_10042910 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2350 | Open in IMG/M |
| 3300018078|Ga0184612_10180632 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1099 | Open in IMG/M |
| 3300018083|Ga0184628_10101284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1481 | Open in IMG/M |
| 3300018422|Ga0190265_12930831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 570 | Open in IMG/M |
| 3300018429|Ga0190272_11017438 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 793 | Open in IMG/M |
| 3300018432|Ga0190275_10045193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3644 | Open in IMG/M |
| 3300018432|Ga0190275_10852098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 977 | Open in IMG/M |
| 3300018432|Ga0190275_11046125 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 889 | Open in IMG/M |
| 3300018466|Ga0190268_11437975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 594 | Open in IMG/M |
| 3300018469|Ga0190270_10021822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3972 | Open in IMG/M |
| 3300018469|Ga0190270_10161739 | All Organisms → cellular organisms → Bacteria | 1836 | Open in IMG/M |
| 3300018469|Ga0190270_11039498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 848 | Open in IMG/M |
| 3300018469|Ga0190270_11055654 | All Organisms → cellular organisms → Bacteria | 842 | Open in IMG/M |
| 3300018476|Ga0190274_10605821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1122 | Open in IMG/M |
| 3300018476|Ga0190274_13207854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 550 | Open in IMG/M |
| 3300018481|Ga0190271_10021089 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5027 | Open in IMG/M |
| 3300019232|Ga0180114_1284918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300019356|Ga0173481_10098485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1119 | Open in IMG/M |
| 3300019356|Ga0173481_10100295 | All Organisms → cellular organisms → Bacteria | 1112 | Open in IMG/M |
| 3300019361|Ga0173482_10020854 | All Organisms → cellular organisms → Bacteria | 1857 | Open in IMG/M |
| 3300019884|Ga0193741_1007384 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2916 | Open in IMG/M |
| 3300019884|Ga0193741_1083160 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 822 | Open in IMG/M |
| 3300019884|Ga0193741_1087593 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 799 | Open in IMG/M |
| 3300020016|Ga0193696_1140422 | Not Available | 602 | Open in IMG/M |
| 3300020020|Ga0193738_1017730 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2262 | Open in IMG/M |
| 3300020020|Ga0193738_1135897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 673 | Open in IMG/M |
| 3300021078|Ga0210381_10413084 | Not Available | 500 | Open in IMG/M |
| 3300021082|Ga0210380_10334961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300021329|Ga0210362_1439467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6418 | Open in IMG/M |
| 3300022214|Ga0224505_10408856 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 514 | Open in IMG/M |
| 3300022756|Ga0222622_10616303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 784 | Open in IMG/M |
| 3300022756|Ga0222622_11149194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 571 | Open in IMG/M |
| 3300022899|Ga0247795_1018378 | All Organisms → cellular organisms → Bacteria | 1124 | Open in IMG/M |
| 3300022915|Ga0247790_10182405 | Not Available | 552 | Open in IMG/M |
| 3300023064|Ga0247801_1056398 | Not Available | 609 | Open in IMG/M |
| 3300023066|Ga0247793_1032886 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 788 | Open in IMG/M |
| 3300023261|Ga0247796_1017514 | All Organisms → cellular organisms → Bacteria | 1087 | Open in IMG/M |
| 3300025160|Ga0209109_10011721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4715 | Open in IMG/M |
| 3300025164|Ga0209521_10045455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2981 | Open in IMG/M |
| 3300025165|Ga0209108_10544228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 551 | Open in IMG/M |
| 3300025167|Ga0209642_10275174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Acidithiobacillia → Acidithiobacillales → Thermithiobacillaceae → Thermithiobacillus → Thermithiobacillus tepidarius | 961 | Open in IMG/M |
| 3300025310|Ga0209172_10015830 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5825 | Open in IMG/M |
| 3300025310|Ga0209172_10059569 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2326 | Open in IMG/M |
| 3300025324|Ga0209640_10013486 | All Organisms → cellular organisms → Bacteria | 7110 | Open in IMG/M |
| 3300025325|Ga0209341_10457437 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1025 | Open in IMG/M |
| 3300025559|Ga0210087_1054430 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 800 | Open in IMG/M |
| 3300025791|Ga0210115_1058928 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 810 | Open in IMG/M |
| 3300025893|Ga0207682_10639159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 500 | Open in IMG/M |
| 3300025922|Ga0207646_11037282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 723 | Open in IMG/M |
| 3300025925|Ga0207650_10051352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3051 | Open in IMG/M |
| 3300025927|Ga0207687_10599087 | All Organisms → cellular organisms → Bacteria | 928 | Open in IMG/M |
| 3300025931|Ga0207644_11813838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 510 | Open in IMG/M |
| 3300025937|Ga0207669_10333124 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1166 | Open in IMG/M |
| 3300026023|Ga0207677_10194764 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1606 | Open in IMG/M |
| 3300026062|Ga0208654_1001170 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3792 | Open in IMG/M |
| 3300026067|Ga0207678_10257900 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
| 3300026089|Ga0207648_10009918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 9079 | Open in IMG/M |
| 3300026089|Ga0207648_10773922 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 892 | Open in IMG/M |
| 3300026350|Ga0256823_1025427 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300026815|Ga0207442_105149 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300027209|Ga0209875_1020064 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 790 | Open in IMG/M |
| 3300027401|Ga0208637_1025094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 666 | Open in IMG/M |
| 3300027438|Ga0207564_108252 | Not Available | 511 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10000011 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 58641 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10015024 | All Organisms → cellular organisms → Bacteria | 2532 | Open in IMG/M |
| (restricted) 3300027799|Ga0233416_10019721 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2224 | Open in IMG/M |
| 3300027870|Ga0209023_10137177 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1686 | Open in IMG/M |
| 3300027880|Ga0209481_10097764 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
| 3300027886|Ga0209486_11126811 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
| 3300028379|Ga0268266_11450847 | Not Available | 662 | Open in IMG/M |
| 3300028596|Ga0247821_11012050 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 557 | Open in IMG/M |
| 3300028707|Ga0307291_1023564 | All Organisms → cellular organisms → Bacteria | 1411 | Open in IMG/M |
| 3300028719|Ga0307301_10242241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 588 | Open in IMG/M |
| 3300028811|Ga0307292_10285311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 690 | Open in IMG/M |
| 3300028824|Ga0307310_10583718 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 568 | Open in IMG/M |
| 3300028884|Ga0307308_10131215 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1198 | Open in IMG/M |
| 3300028889|Ga0247827_10539719 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 736 | Open in IMG/M |
| 3300030006|Ga0299907_10020027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → Solirubrobacteraceae → Solirubrobacter | 5014 | Open in IMG/M |
| 3300031096|Ga0308193_1067690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 566 | Open in IMG/M |
| 3300031562|Ga0310886_10261272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
| 3300031576|Ga0247727_10022646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 9365 | Open in IMG/M |
| 3300031576|Ga0247727_10135851 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2428 | Open in IMG/M |
| 3300031576|Ga0247727_10319828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1304 | Open in IMG/M |
| 3300031576|Ga0247727_10644542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 787 | Open in IMG/M |
| 3300031576|Ga0247727_10679199 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 757 | Open in IMG/M |
| 3300031707|Ga0315291_10634367 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 962 | Open in IMG/M |
| 3300031820|Ga0307473_10480926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 834 | Open in IMG/M |
| 3300031873|Ga0315297_10835018 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 767 | Open in IMG/M |
| 3300031908|Ga0310900_11816564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
| 3300031965|Ga0326597_10023274 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 7968 | Open in IMG/M |
| 3300032013|Ga0310906_10429627 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 879 | Open in IMG/M |
| 3300032122|Ga0310895_10482642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 620 | Open in IMG/M |
| 3300032180|Ga0307471_103399777 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300033417|Ga0214471_10179669 | All Organisms → cellular organisms → Bacteria | 1741 | Open in IMG/M |
| 3300033417|Ga0214471_11018845 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300033550|Ga0247829_10149949 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
| 3300033550|Ga0247829_10750766 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300033550|Ga0247829_11309824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 599 | Open in IMG/M |
| 3300033551|Ga0247830_10089261 | All Organisms → cellular organisms → Bacteria | 2142 | Open in IMG/M |
| 3300033811|Ga0364924_008007 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1915 | Open in IMG/M |
| 3300033811|Ga0364924_130745 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 584 | Open in IMG/M |
| 3300033811|Ga0364924_165267 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 526 | Open in IMG/M |
| 3300034164|Ga0364940_0254785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 519 | Open in IMG/M |
| 3300034176|Ga0364931_0252737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 580 | Open in IMG/M |
| 3300034354|Ga0364943_0439000 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 508 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 20.79% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 7.43% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 4.95% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.47% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 3.47% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.47% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 2.97% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 2.97% |
| Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 2.48% |
| Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.48% |
| Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 2.48% |
| Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 2.48% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.98% |
| Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.99% |
| Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 0.99% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.99% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.99% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.50% |
| Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 0.50% |
| Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.50% |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.50% |
| Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.50% |
| Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.50% |
| Terrestrial | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial | 0.50% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.50% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.50% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.50% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000858 | Soil microbial communities from Great Prairies - Wisconsin Native Prairie soil | Environmental | Open in IMG/M |
| 3300000881 | Soil microbial communities from Great Prairies - Wisconsin Restored Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
| 3300002121 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 | Environmental | Open in IMG/M |
| 3300002123 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_3 | Environmental | Open in IMG/M |
| 3300003994 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300004070 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2 | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006572 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006573 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAC (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
| 3300009167 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 3 metaG - Illumina Assembly (version 2) | Environmental | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
| 3300009798 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_40_50 | Environmental | Open in IMG/M |
| 3300009799 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N2_0_30 | Environmental | Open in IMG/M |
| 3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
| 3300009820 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_50_60 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
| 3300011421 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT769_2 | Environmental | Open in IMG/M |
| 3300011423 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT119_2 | Environmental | Open in IMG/M |
| 3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
| 3300011993 | Terrestrial microbial communites from a soil warming plot in Okalahoma, USA - C1.rep1 | Environmental | Open in IMG/M |
| 3300012043 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ601 (22.06) | Environmental | Open in IMG/M |
| 3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
| 3300012892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 | Environmental | Open in IMG/M |
| 3300012904 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S029-104C-1 | Environmental | Open in IMG/M |
| 3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
| 3300012911 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S088-202R-2 | Environmental | Open in IMG/M |
| 3300012943 | Backyard soil microbial communities from Emeryville, California, USA - Original compost - Back yard soil (BY) | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
| 3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
| 3300014299 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014315 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushSE_TuleC_D1 | Environmental | Open in IMG/M |
| 3300014318 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqA_D1_rd | Environmental | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300017997 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_coex | Environmental | Open in IMG/M |
| 3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
| 3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
| 3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
| 3300018055 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_90_coex | Environmental | Open in IMG/M |
| 3300018056 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_100_b1 | Environmental | Open in IMG/M |
| 3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
| 3300018067 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coex | Environmental | Open in IMG/M |
| 3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
| 3300018077 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b1 | Environmental | Open in IMG/M |
| 3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
| 3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
| 3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
| 3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
| 3300020016 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1 | Environmental | Open in IMG/M |
| 3300020020 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2a1 | Environmental | Open in IMG/M |
| 3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
| 3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
| 3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S016-104C-6 | Environmental | Open in IMG/M |
| 3300022915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4 | Environmental | Open in IMG/M |
| 3300023064 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S001-104B-6 | Environmental | Open in IMG/M |
| 3300023066 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S223-509R-6 | Environmental | Open in IMG/M |
| 3300023261 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S166-409R-6 | Environmental | Open in IMG/M |
| 3300025160 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 2 | Environmental | Open in IMG/M |
| 3300025164 | Soil microbial communities from Rifle, Colorado, USA - sediment 19ft 4 | Environmental | Open in IMG/M |
| 3300025165 | Soil microbial communities from Rifle, Colorado, USA - sediment 10ft 1 | Environmental | Open in IMG/M |
| 3300025167 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025310 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025324 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 10_1 (SPAdes) | Environmental | Open in IMG/M |
| 3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025559 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025791 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026350 | Sediment microbial communities from tidal freshwater marsh on Altamaha River, Georgia, United States - 7-17 PU6 | Environmental | Open in IMG/M |
| 3300026815 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G10A4w-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027209 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_0_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300027401 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC (SPAdes) | Environmental | Open in IMG/M |
| 3300027438 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G08A3a-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027799 (restricted) | Sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - Sediment_Towuti_2014_0_MG | Environmental | Open in IMG/M |
| 3300027870 | Freshwater and sediment microbial communities from Lake Erie, Canada (SPAdes) | Environmental | Open in IMG/M |
| 3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028707 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148 | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028811 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149 | Environmental | Open in IMG/M |
| 3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
| 3300028884 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_195 | Environmental | Open in IMG/M |
| 3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
| 3300030006 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT152D67 | Environmental | Open in IMG/M |
| 3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031576 | Biofilm microbial communities from Wishing Well Cave, Virginia, United States - WW16-25 | Environmental | Open in IMG/M |
| 3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031873 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G15_0 | Environmental | Open in IMG/M |
| 3300031908 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1 | Environmental | Open in IMG/M |
| 3300031965 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT100D185 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033417 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT142D155 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300033811 | Sediment microbial communities from East River floodplain, Colorado, United States - 28_j17 | Environmental | Open in IMG/M |
| 3300034164 | Sediment microbial communities from East River floodplain, Colorado, United States - 14_s17 | Environmental | Open in IMG/M |
| 3300034176 | Sediment microbial communities from East River floodplain, Colorado, United States - 21_j17 | Environmental | Open in IMG/M |
| 3300034354 | Sediment microbial communities from East River floodplain, Colorado, United States - 23_s17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI10213J12805_101692163 | 3300000858 | Soil | MARVTERLTVLAFAALLVAAIIGIAFGVGYGIGKLLL* |
| JGI10213J12805_103550562 | 3300000858 | Soil | MGRVTDRLTVLAFATLLVGAIIGIAFAVGYGVGKLLL* |
| JGI10215J12807_13056642 | 3300000881 | Soil | MARLTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL* |
| JGI10216J12902_1009464112 | 3300000956 | Soil | MARVTERVTVLVFAALLVGAIIGIAFAVGYGIGKLLL* |
| JGI10216J12902_1062799642 | 3300000956 | Soil | MARVRDRLAVLAFATIVVAAIIGLAFALGYGVGKLLL* |
| JGI10216J12902_1081655982 | 3300000956 | Soil | MAGRVTERLTVLAFAALIVGTIIGAAFLVGYGIGKLLL* |
| JGI10216J12902_1173980902 | 3300000956 | Soil | MARLKERLAVLAFAVLIVAAIIGVAFALGYGVGKLLL* |
| JGIcombinedJ13530_1088194542 | 3300001213 | Wetland | MARAWERLVVFAFAALIVAAIIGIAFAVGYGIGKLLL* |
| C687J26615_100049663 | 3300002121 | Soil | MARVTERLTVLAFAAVLVAAIIGIAFALGYGIGKLLL* |
| C687J26615_100980632 | 3300002121 | Soil | MARLRERLAVFAFAALLVAAIIAIAFGLGYGIGKLLL* |
| C687J26634_101254272 | 3300002123 | Soil | VARIRERLSVLAFAALLVAAIIGIAFALGYGIGKLLL* |
| Ga0055435_101877802 | 3300003994 | Natural And Restored Wetlands | RRNQGVIERLVVLAFAAFLVAAIVGLAYALGYAIGKVLL* |
| Ga0055488_100332433 | 3300004070 | Natural And Restored Wetlands | VIAVGRLLDRLTVLAFAALIVGTIIGVAFLVGYGIGKLLL* |
| Ga0070678_1008903962 | 3300005456 | Miscanthus Rhizosphere | GAACGMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL* |
| Ga0073909_105539852 | 3300005526 | Surface Soil | MSRILDRLSVLAFAVLVVAAIIGLAFALGYGVGKLLL* |
| Ga0070672_1001566892 | 3300005543 | Miscanthus Rhizosphere | MARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL* |
| Ga0070672_1002037753 | 3300005543 | Miscanthus Rhizosphere | MARVWERLVVLAFAALIVAAIIGLAFAVGYGIGKLLL* |
| Ga0070665_1017003952 | 3300005548 | Switchgrass Rhizosphere | MARVGERLAVLVFAALIVAAIIGIAFAVGYGVGKLLL* |
| Ga0068857_10000962210 | 3300005577 | Corn Rhizosphere | MARATERLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL* |
| Ga0066905_1001754042 | 3300005713 | Tropical Forest Soil | MARVTERLAVLAFAALIVAAIIGIAFALGYGVGKLLL* |
| Ga0068870_112062082 | 3300005840 | Miscanthus Rhizosphere | MARVTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL* |
| Ga0081455_105218442 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MARVTERLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL* |
| Ga0075422_105631701 | 3300006196 | Populus Rhizosphere | MSRATERLAVLAFAAVIVVAIIGIAFAVGYGIGKLLL* |
| Ga0074051_112579542 | 3300006572 | Soil | MARLRERLAVLAFAAIIVAAIIGLAFALGYGIGKLLL* |
| Ga0074055_116213962 | 3300006573 | Soil | MAKVRERLSVLAFGALLVVAIIGLAFALGYGIGKLLL* |
| Ga0075428_1001742132 | 3300006844 | Populus Rhizosphere | MARVRERLAVLAFAALIVVAIIGLAFALGYGVGKLLL* |
| Ga0075421_1013266593 | 3300006845 | Populus Rhizosphere | GGATCVMARVTERLTVLAFAALLVAAIIGIAFGVGYGIGKLLL* |
| Ga0075433_100250934 | 3300006852 | Populus Rhizosphere | MARVTERLAVLGFAALIVAAIIGIAFALGYGVGKLLL* |
| Ga0073934_100635802 | 3300006865 | Hot Spring Sediment | MTRAGERLSVLAFAALLVGAIVGVAFLLGYAVGKLLL* |
| Ga0073934_100869882 | 3300006865 | Hot Spring Sediment | MARLTERLTVLAFAAVLVAAILGAAFALGYGIGKLLL* |
| Ga0073934_102784981 | 3300006865 | Hot Spring Sediment | MARTTERLAVLAFATLIVGAIIGIAFLVGYGVGKLLL* |
| Ga0075429_1011043122 | 3300006880 | Populus Rhizosphere | MARVTERLTVLAFAALLVAAIIGIAFGVGYGIGKLL |
| Ga0075419_106590642 | 3300006969 | Populus Rhizosphere | MARTTERLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL* |
| Ga0079218_113711842 | 3300007004 | Agricultural Soil | VIGVARMTERLAVLAFAALIVGTIIGVAFVVGYGIGKLLL* |
| Ga0113563_103462892 | 3300009167 | Freshwater Wetlands | MARVTERLAVLAFAALIVIAIVGLAFALGYGIGKLLL* |
| Ga0105242_106185353 | 3300009176 | Miscanthus Rhizosphere | GAACGMARVTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL* |
| Ga0105242_117113762 | 3300009176 | Miscanthus Rhizosphere | MARVGERLAVLVFAALIVVAIIGIAFAVGYGVGKLLL* |
| Ga0105248_114942272 | 3300009177 | Switchgrass Rhizosphere | MARVTERLSVLAFAALIVAAIIGLAFALGYGVGKLLL* |
| Ga0105347_11895212 | 3300009609 | Soil | MARVRERLAVLAFAALLVLAIIGMAFALGYGIGKLLL* |
| Ga0105060_1266242 | 3300009798 | Groundwater Sand | VARVTERLSVLAFAALLVLAIIGIAFALGYGIGKLLL* |
| Ga0105075_10040372 | 3300009799 | Groundwater Sand | MARVTERLSVLAFAALLVGAIIAIAFGLGYGIGKLLL* |
| Ga0105062_10043814 | 3300009817 | Groundwater Sand | MARVTERLSVFAFAALLVGAIIAIAFGLGYGIGKLLL* |
| Ga0105085_10835542 | 3300009820 | Groundwater Sand | MGRVTDRLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL* |
| Ga0126376_115803282 | 3300010359 | Tropical Forest Soil | MARVTERLAVLAFAALIVIAIIGIAFALGYGVGKLLL* |
| Ga0126377_124429022 | 3300010362 | Tropical Forest Soil | MARVAERLAVLAFAALIVAAIIGIAFALGYGVGKLLL* |
| Ga0136847_130387622 | 3300010391 | Freshwater Sediment | VARVTERLSVLAFAALLVAAIIGIAFALGYGIGKLLL* |
| Ga0136847_133089292 | 3300010391 | Freshwater Sediment | VARVTERLSVLAFAAVLVLAIIGIAFALGYGIGKLLL* |
| Ga0137424_10172422 | 3300011412 | Soil | VARVRERLSVLAFAAVLVLAIVGIAFALGYGIGKLLL* |
| Ga0137424_11138462 | 3300011412 | Soil | VIGVARMTERLAVLAFAALIVGTIIVVAFVVGYGIGKLLL* |
| Ga0137424_11436092 | 3300011412 | Soil | MARVTERLTVLAFAALLVAAIIGLAFAMGYGIGKLLL* |
| Ga0137325_10422731 | 3300011415 | Soil | MTERLAVLAFAALIVGTIIGVAFVLGYGIGKLLL* |
| Ga0137462_11372932 | 3300011421 | Soil | MSRVTERLAVLTFAALLVLAIIGMAFALGYGIGKLLL* |
| Ga0137436_11629631 | 3300011423 | Soil | MTERLAVLAFAALIVGTIIVVAFVVGYGIGKLLL* |
| Ga0137457_11183911 | 3300011443 | Soil | AGGAAHRVVRVRERLSVLAFAALLVVAIIGIAFALGYGIGKLLL* |
| Ga0120182_10215052 | 3300011993 | Terrestrial | MARLIERLTVLAFAALLVAAIIGIAFAMGYGIGKLLL* |
| Ga0136631_1000011427 | 3300012043 | Polar Desert Sand | VIGVARMSERLAVLAFAALIVGTIIGVAFVVGYGIGKLLL* |
| Ga0136635_100266853 | 3300012530 | Polar Desert Sand | MTERLAVLAFAALIVGTIIGVAFAVGYGIGKLLL* |
| Ga0157294_101625941 | 3300012892 | Soil | ACGMARVTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL* |
| Ga0157282_101455852 | 3300012904 | Soil | MARVTERLAVLAFAALIVVAIIGLAFALGYGVGKLLL* |
| Ga0157296_101354272 | 3300012905 | Soil | MARVWERLVVLAFAALIVAAIIGLAFALGYGVGKLLL* |
| Ga0157301_102362072 | 3300012911 | Soil | AACGMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL* |
| Ga0164241_103150622 | 3300012943 | Soil | MARVRERLAVLVFAALIVAAIIGVAFAVGYGVGKLLL* |
| Ga0164299_111127382 | 3300012958 | Soil | MARVTERLTVLAFAALIVAAIIGIAFAVGYGVGKLLL* |
| Ga0164304_102369774 | 3300012986 | Soil | RPGGAALGMARVRERLAVLAFAALIVAAIIGIAFALGYGVGKLLL* |
| Ga0164305_115398872 | 3300012989 | Soil | MSRILDRLSVLAFAVLVVAAITGLAFALGYGVGKLLL* |
| Ga0157375_110592642 | 3300013308 | Miscanthus Rhizosphere | MARVTERLAVLGFAALIVVAIIGIAFAIGYGVGKLLL* |
| Ga0075313_10011107 | 3300014267 | Natural And Restored Wetlands | MARVTERLTVLAFAALLVSAIIGIAFAVGYGIGKLLL* |
| Ga0075327_11747312 | 3300014272 | Natural And Restored Wetlands | MLDRLTVLAFAALIVGTIIGVAFLVGYGIGKLLL* |
| Ga0075303_10008304 | 3300014299 | Natural And Restored Wetlands | VIERLVVLAFAAFLVAAIVGLAYALGYAIGKVLL* |
| Ga0075303_10369522 | 3300014299 | Natural And Restored Wetlands | MARMTERLAVLAFAALVVAAIVGIAFALGYAIGKLLL* |
| Ga0075350_11853801 | 3300014315 | Natural And Restored Wetlands | MARMTERLAVLAFAALVVAAIVGVAFALGYAIGKLLL* |
| Ga0075351_11674992 | 3300014318 | Natural And Restored Wetlands | MARVMERIAVLAFAAVLVAAIVALAFALGYAIGKVLL* |
| Ga0157376_111188672 | 3300014969 | Miscanthus Rhizosphere | MARVTERLAVLGFAALIVAAIIGIAFALGYAVGKLLL* |
| Ga0157376_115868131 | 3300014969 | Miscanthus Rhizosphere | SRILDRLSVLAFAVLVVAAIIGLAFALGYGVGKLLL* |
| Ga0132258_105373463 | 3300015371 | Arabidopsis Rhizosphere | MARVRERLSVLAFAVLIVATIIGLAFALGYGVGKLLL* |
| Ga0132258_111947092 | 3300015371 | Arabidopsis Rhizosphere | MRRVWDRLVVLAFAALIVGAIIGLAFAVGYGIGKLLL* |
| Ga0132256_1006660803 | 3300015372 | Arabidopsis Rhizosphere | MARVTERLAVLAFGALIVAAIIGLAFALGYGVGKLLL* |
| Ga0132255_1021625161 | 3300015374 | Arabidopsis Rhizosphere | PGAGGAACGMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL* |
| Ga0163161_100797422 | 3300017792 | Switchgrass Rhizosphere | MARVTERLAVLAFAALIVAAIIGLAFAVGYGVGKLLL |
| Ga0187786_100586402 | 3300017944 | Tropical Peatland | MSRLRERLAVLAFAALLVLAIVGLAYALGYAIGKLLL |
| Ga0190266_100020503 | 3300017965 | Soil | MGRVTERLTVLAFAALIVAAIIGIAFAVGYGVGKLLL |
| Ga0190266_100622022 | 3300017965 | Soil | MARVRERLAVLAFAALIVAAIIGIAFAVGYGIGKLLL |
| Ga0190266_107668572 | 3300017965 | Soil | VIGVARMTERLAVLAFAALIVGTIIGVAFVVGYGIGKLLL |
| Ga0184610_11028622 | 3300017997 | Groundwater Sediment | MARVRERLAVLAFAALLVAAIVGIAFVLGYGIGRLLL |
| Ga0184608_104629582 | 3300018028 | Groundwater Sediment | MARVTERLAVLAFAALIVAAIIGIAFAFGYGIGKLLL |
| Ga0187788_105042652 | 3300018032 | Tropical Peatland | LAKVRERLAVLAFAALVVAGIVGGAFALVYLVGKLLL |
| Ga0184638_10470013 | 3300018052 | Groundwater Sediment | MARVTERLSVLAFAALLVGAIIAIAFGLGYGIGKLLL |
| Ga0184616_101623302 | 3300018055 | Groundwater Sediment | MSRVTERLAVLTFAALLVLAIIGMAFALGYGIGKLLL |
| Ga0184616_101705942 | 3300018055 | Groundwater Sediment | VIGVARMTERLAVLAFAALIVGTIIVVAFVVGYGIGKLLL |
| Ga0184623_103742162 | 3300018056 | Groundwater Sediment | VARVTERLSVFAFAALLVAAIIGIAFALGYGIGKLLL |
| Ga0184637_104155042 | 3300018063 | Groundwater Sediment | MARVTERLAVFAFAALIVAAIIGIAFAVGYGIGKLLL |
| Ga0184637_105264992 | 3300018063 | Groundwater Sediment | MGRVTERLAVLAFAALLVAAIIGIAFALGYGIGRLLL |
| Ga0184611_11573042 | 3300018067 | Groundwater Sediment | MARVTERLTVLAFAALIVAAIIGIAFAFGYGIGKLLL |
| Ga0184635_103495322 | 3300018072 | Groundwater Sediment | MARVTERLAVLAFAALIVAAIIGIAFAVGYGIGKLLL |
| Ga0184633_100397042 | 3300018077 | Groundwater Sediment | VARVRERLSVLAFAALLVAAIIGIAFALGYGIGKLLL |
| Ga0184633_105963702 | 3300018077 | Groundwater Sediment | MARVTGRLSVLAFAALLVAAIIGIAFALGYGIGKLLL |
| Ga0184612_100429105 | 3300018078 | Groundwater Sediment | VARVRERLSVLAFAAVLVLAIIGIAFALGYGIGKLLL |
| Ga0184612_101806322 | 3300018078 | Groundwater Sediment | MARVRERLAVLAFAALLVVAIIGMAFALGYGIGKLLL |
| Ga0184628_101012842 | 3300018083 | Groundwater Sediment | MARVTERLTVLAFAALIVAAIIGIAFAVGYGVGKLLL |
| Ga0190265_129308312 | 3300018422 | Soil | VIGVARMTERLAVLAFAALIVGTIIGVAFVVGYGVGKLLL |
| Ga0190272_110174382 | 3300018429 | Soil | VIGVARMTERLAVLAFAALIVGTIIGIAFVVGYGIGKLLL |
| Ga0190275_100451933 | 3300018432 | Soil | MARVTDRLTVLAFAALLVGAIIGAAFAVGYGIGKLLL |
| Ga0190275_108520982 | 3300018432 | Soil | MARVTERLAVFAFAAFIVASIIGIAFAVGYGIGKLLL |
| Ga0190275_110461252 | 3300018432 | Soil | MARVTERLTVLAFAALLVGAIIGLAFAVGYGIGKLLL |
| Ga0190268_114379752 | 3300018466 | Soil | MARATERLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL |
| Ga0190270_100218223 | 3300018469 | Soil | MARVTERLTVLAFAALLVAAIIAIAFGVGYGIGKLLL |
| Ga0190270_101617392 | 3300018469 | Soil | MARVTERLAVFAFAAIIVASIIGIAFAVGYGIGKLLL |
| Ga0190270_110394982 | 3300018469 | Soil | VARVREGLSVLAFAAVLVLAIVGIAFALGYGIGKLLL |
| Ga0190270_110556542 | 3300018469 | Soil | VIGVARTTERLAVLAFAALIVGTIIGVAFVVGYGIGKLLL |
| Ga0190274_106058212 | 3300018476 | Soil | MARVTERVTVLVFAALLVGAIIGIAFAVGYGIGKLLL |
| Ga0190274_132078541 | 3300018476 | Soil | RAGGAARVMARVTERLAVFAFAAFIVASIIGIAFAVGYGIGKLLL |
| Ga0190271_100210896 | 3300018481 | Soil | VIAVGRLLDRLTVLAFAALIVGTIIGVAFLVGYGIGKLLL |
| Ga0190271_105841012 | 3300018481 | Soil | MAKLRERLAVLAFAALIVTAIVGGSLALGYLVGKLLL |
| Ga0180114_12849182 | 3300019232 | Groundwater Sediment | VIGVARMTERLAVLAFATLIVGTIIVVAFVVGYGIGKLLL |
| Ga0173481_100984853 | 3300019356 | Soil | MARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL |
| Ga0173481_101002952 | 3300019356 | Soil | MARLTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL |
| Ga0173482_100208544 | 3300019361 | Soil | MARVGERLAVLVFAALIVAAIIGIAFAVGYGVGKLLL |
| Ga0193741_10073842 | 3300019884 | Soil | MARVTERLTVLAFAALLVAAIIGAAFAVGYGIGKLLL |
| Ga0193741_10831602 | 3300019884 | Soil | MARVTERLTVLAFAVLLVGAIIGAAFAVGYGIGKLLL |
| Ga0193741_10875932 | 3300019884 | Soil | VARVRERLSVLAFAAVLVLAIVGIAFALGYGIGKLLL |
| Ga0193696_11404222 | 3300020016 | Soil | MSRVTERLTVLAFAALIVAAIIGIAFAVGYGVGKL |
| Ga0193738_10177302 | 3300020020 | Soil | VIGVARMTERLAVFAFAALIVGTIIGVAFVVGYGIGKLLL |
| Ga0193738_11358972 | 3300020020 | Soil | MARVKERVAVLAFAALIVGSIIGLAFAVGYGIGKLLL |
| Ga0210381_104130842 | 3300021078 | Groundwater Sediment | MARVTERLAVLAFAAIIVAAIIGLAFALGYGIGKLLL |
| Ga0210380_103349612 | 3300021082 | Groundwater Sediment | MARVTERLTVLAFAALIVAAIIGIAFALGYGVGKLLL |
| Ga0210362_14394677 | 3300021329 | Estuarine | VARVTERLSVLAFAALLVAAIIGIAFALGYGIGKLLL |
| Ga0224505_104088562 | 3300022214 | Sediment | MARVTERLAVLAFAVFLVAAIVGLAFALGYAIGKALL |
| Ga0222622_106163032 | 3300022756 | Groundwater Sediment | MARVRERLAVLAFAVLVVAAIIGLAFALGYGIGKLLL |
| Ga0222622_111491942 | 3300022756 | Groundwater Sediment | MSRVTERLTVLAFAALIVAAIIGIAFAVGYGVGKLLL |
| Ga0247795_10183783 | 3300022899 | Soil | GMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL |
| Ga0247790_101824052 | 3300022915 | Soil | MARVTERLAVLAFAAVIVAAIIGIAFAVGYGIGKLLL |
| Ga0247801_10563982 | 3300023064 | Soil | MARVTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL |
| Ga0247793_10328863 | 3300023066 | Soil | CGMARVTERLAVLAFAALIVAAIIGIAFALGYGVGKLLL |
| Ga0247796_10175143 | 3300023261 | Soil | RVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL |
| Ga0209109_100117213 | 3300025160 | Soil | MARVTERLTVLAFAALLVAAIIGIAFAVGYGIGKLLL |
| Ga0209521_100454555 | 3300025164 | Soil | VARIRERLSVLAFAALLVAAIIGIAFALGYGIGKLLL |
| Ga0209108_105442282 | 3300025165 | Soil | MARVTERLTVLAFAAVLVAAIIGIAFALGYGIGKLLL |
| Ga0209642_102751743 | 3300025167 | Soil | MARVTERLAVLAFAALLVVAIIAIAFGLGYGIGKLLL |
| Ga0209172_100158305 | 3300025310 | Hot Spring Sediment | MTRAGERLSVLAFAALLVGAIVGVAFLLGYAVGKLLL |
| Ga0209172_100595692 | 3300025310 | Hot Spring Sediment | MARLTERLTVLAFAAVLVAAILGAAFALGYGIGKLLL |
| Ga0209640_100134869 | 3300025324 | Soil | VARVTERLSVLAFAALLVAAIIAIAFGLGYGIGKLLL |
| Ga0209341_104574372 | 3300025325 | Soil | MARVTERLAVLAFAALLVAAIIGIAFALGYGIGKLLL |
| Ga0210087_10544302 | 3300025559 | Natural And Restored Wetlands | MARAWERLVVFAFAALIVAAIIGIAFAVGYGIGKLLL |
| Ga0210115_10589283 | 3300025791 | Natural And Restored Wetlands | MARLTERLAVLAFAALIVATIVGLAFALGYGIGKLLL |
| Ga0207682_106391592 | 3300025893 | Miscanthus Rhizosphere | MARVWERLVVLAFAALIVAAIIGLAFAVGYGIGKLLL |
| Ga0207646_110372822 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MARVTERLAVLAFAALIVAAIIGIAFALGYGVGKLLL |
| Ga0207650_100513523 | 3300025925 | Switchgrass Rhizosphere | MARVAERLAVLAFAALIVAAIIGLAFALGYGVGKLLL |
| Ga0207687_105990873 | 3300025927 | Miscanthus Rhizosphere | RVTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL |
| Ga0207644_118138382 | 3300025931 | Switchgrass Rhizosphere | MARVTERLAVLGFAALIVVAIIGIAFALGYGVGKLLL |
| Ga0207669_103331242 | 3300025937 | Miscanthus Rhizosphere | MARVTERLAVLAFATLIVAAIIGLAFALGYGVGKLLL |
| Ga0207677_101947642 | 3300026023 | Miscanthus Rhizosphere | MARVWERFVVLAFAALIVAAIIGLAFAVGYGIGKLLL |
| Ga0208654_10011703 | 3300026062 | Natural And Restored Wetlands | MARVTERLTVLAFAALLVSAIIGIAFAVGYGIGKLLL |
| Ga0207678_102579004 | 3300026067 | Corn Rhizosphere | AFTMARVGERLAVLVFAALIVAAIIGIAFAVGYGVGKLLL |
| Ga0207648_100099181 | 3300026089 | Miscanthus Rhizosphere | GAGGAACGMARVTERLAVLAFAALIVAAIIGIAFALGYGVGKLLL |
| Ga0207648_107739221 | 3300026089 | Miscanthus Rhizosphere | MARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLL |
| Ga0256823_10254272 | 3300026350 | Sediment | MARMTERLAVLAFAALVVAAIVGVAFALGYAIGKLLL |
| Ga0207442_1051492 | 3300026815 | Soil | MARVRERLAVLAFAALIVVAIIGLAFALGYGVGKLLL |
| Ga0209875_10200642 | 3300027209 | Groundwater Sand | MARVTERLAVLAFAALVVAAIVGIAFGLGYGIGKLLL |
| Ga0208637_10250942 | 3300027401 | Soil | MARLRERLAVLAFAAIIVAAIIGLAFALGYGIGKLLL |
| Ga0207564_1082521 | 3300027438 | Soil | AGGAACGMARLTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL |
| (restricted) Ga0233416_1000001147 | 3300027799 | Sediment | MARVTERLAVLAFAALIVVAIVGLAFALGYGIGKLLL |
| (restricted) Ga0233416_100150242 | 3300027799 | Sediment | MGRVTERLAVLAFAALIVAAIIALAFALGYGIGKLLL |
| (restricted) Ga0233416_100197213 | 3300027799 | Sediment | MARVTERLAVLAFAALIVAAIIGLAFALGYGLGKLLL |
| Ga0209023_101371772 | 3300027870 | Freshwater And Sediment | MPRVTERLAVLTFAALLVLAIIGMAFALGYGIGKLLL |
| Ga0209481_100977643 | 3300027880 | Populus Rhizosphere | MARVTERLTVLAFAALLVAAIIGIAFGVGYGIGKLLL |
| Ga0209486_111268112 | 3300027886 | Agricultural Soil | VARVTERLAVFAFAAFVVASIIGIAFVVGYAIGKLLL |
| Ga0268266_114508471 | 3300028379 | Switchgrass Rhizosphere | MARVWERLVVLAFAALIVAAIIGLAFAVGYGIGKLL |
| Ga0247821_110120502 | 3300028596 | Soil | HCAAGAARGVARVTERLSVLAFAALLVGAIIAIAFGLGYGIGKLLL |
| Ga0307291_10235643 | 3300028707 | Soil | MARLKERLAVLAFAVLIVAAIIGVAFALGYGVGKLLL |
| Ga0307301_102422412 | 3300028719 | Soil | GMARVTERLAVLAFAALIVAAIIGIAFAFGYGIGKLLL |
| Ga0307292_102853111 | 3300028811 | Soil | MARVRERLAVLAFAVVVVAAIIGLAFALGYGIGKLLL |
| Ga0307310_105837182 | 3300028824 | Soil | MARLRERLAVLAFAVLIVAAIIGLAFALGYGVGKLLL |
| Ga0307308_101312154 | 3300028884 | Soil | MARVTERLAVLAFAAIIVAAIIGLAFVLGYVIGKLLL |
| Ga0247827_105397191 | 3300028889 | Soil | MARVAERLAVLAFAALIVAAIIGIAFAFGYGIGKLLL |
| Ga0299907_100200271 | 3300030006 | Soil | MARVRERLAVLAFAALIVGSIIGLAFAVGYGVGKLLL |
| Ga0308193_10676901 | 3300031096 | Soil | RTGGAACAMARLRERLAVLAFAVLIVAAIIGLAFALGYGVGKLLL |
| Ga0310886_102612722 | 3300031562 | Soil | MARVTERLAVLAFAALIVVAIIGLAFALGYGVGKLLL |
| Ga0247727_1002264611 | 3300031576 | Biofilm | GGTACRMPRVGERLSVLAFAALIVAAIVGIAFALGYLVGKLLL |
| Ga0247727_101358512 | 3300031576 | Biofilm | VARLRERLSVLAFAALLVAAIIAIAFGLGYGIGKLLL |
| Ga0247727_103198282 | 3300031576 | Biofilm | MARVTERLSVLAFAALLVAAIIGIAFALGYGIGKLLL |
| Ga0247727_106445422 | 3300031576 | Biofilm | MARVTERLSVLAFAALLVGAIIVFAFALGYGVGKLLL |
| Ga0247727_106791992 | 3300031576 | Biofilm | MPRVGERLSVLAFAALIVAAIVGIAFALGYLVGKLL |
| Ga0315291_106343671 | 3300031707 | Sediment | VARVKERLSVLAFAALLVAAIIGIAFALGYGIGKLLL |
| Ga0307473_104809262 | 3300031820 | Hardwood Forest Soil | MARVTERLAVLAFAALIVAAVIGIAFALGYGVGKLLL |
| Ga0315297_108350182 | 3300031873 | Sediment | MPRVTERLAVLAFAALLVLAIIGMAFALGYGIGKLLL |
| Ga0310900_118165642 | 3300031908 | Soil | GVAWRMARVWERLVVLAFAALIVAAIIGLAFAVGYGIGKLLL |
| Ga0326597_100232749 | 3300031965 | Soil | VARVTERLSVLAFAALLVAAIIVIAFGLGYGIGKLLL |
| Ga0310906_104296272 | 3300032013 | Soil | MARVTERLTVLAFAALLVGAIIGIAFAVGYGIGKLLL |
| Ga0310895_104826421 | 3300032122 | Soil | CGMARVTERLAVLAFAALIVAAIIGLAFALGYGVGKLLL |
| Ga0307471_1033997772 | 3300032180 | Hardwood Forest Soil | MARVTERLSVLAFAALLVGAIIAIAFALGYGIGKLLL |
| Ga0214471_101796693 | 3300033417 | Soil | MARVTERLSVLAFAALLVAAIIAIAFGLGYGIGKLLL |
| Ga0214471_110188452 | 3300033417 | Soil | MARVTERLTVLVFAALIVAAIIGIAFAVGYGIGKLLL |
| Ga0247829_101499491 | 3300033550 | Soil | ACGMARLTERLAVLAFAALIVAAIIGIAFAVGYGVGKLLL |
| Ga0247829_107507661 | 3300033550 | Soil | AACGMSQVTERLTVLAFAALIVAAIIGIAFALGYGVGKLLL |
| Ga0247829_113098242 | 3300033550 | Soil | GGAARVVARVTERLAVFAFAAFVVASIIGIAFVVGYAIGKLLL |
| Ga0247830_100892611 | 3300033551 | Soil | REGGATCVMARVTERLAVLAFAALIVAAIIGIAFAFGYGIGKLLL |
| Ga0364924_008007_1352_1465 | 3300033811 | Sediment | MARVTERLAVLVFAALLVAAIIGIAFALGYGIGKLLL |
| Ga0364924_130745_279_392 | 3300033811 | Sediment | VARVTERLSVLAFAALLVAAIVGIAFALGYGIGKLLL |
| Ga0364924_165267_30_143 | 3300033811 | Sediment | MASVRERLAVLAFAALLVAAIVGIAFALGYGIGKLLL |
| Ga0364940_0254785_110_223 | 3300034164 | Sediment | MARVRERLAVFAFAAIVVAAIVGIAFGLGYGIGKLLL |
| Ga0364931_0252737_241_354 | 3300034176 | Sediment | MARVTERLTVLVFAALIVATIIGIAFAVGYGIGKLLL |
| Ga0364943_0439000_164_277 | 3300034354 | Sediment | MARVTEKLSVLAFAALLVAAIIGIAFALGYGIGKLLL |
| ⦗Top⦘ |