Basic Information | |
---|---|
Family ID | F025280 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 202 |
Average Sequence Length | 42 residues |
Representative Sequence | MTNDTPLFFVVMGLLALTAYLIATAPKTTAQEREEMEEDWWG |
Number of Associated Samples | 117 |
Number of Associated Scaffolds | 202 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 80.31 % |
% of genes near scaffold ends (potentially truncated) | 13.86 % |
% of genes from short scaffolds (< 2000 bps) | 65.84 % |
Associated GOLD sequencing projects | 106 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.51 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Duplodnaviria (40.099 % of family members) |
NCBI Taxonomy ID | 2731341 |
Taxonomy | All Organisms → Viruses → Duplodnaviria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (25.743 % of family members) |
Environment Ontology (ENVO) | Unclassified (58.911 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (55.446 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.71% β-sheet: 0.00% Coil/Unstructured: 54.29% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.51 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 202 Family Scaffolds |
---|---|---|
PF00182 | Glyco_hydro_19 | 11.39 |
PF01612 | DNA_pol_A_exo1 | 7.92 |
PF08299 | Bac_DnaA_C | 6.93 |
PF13481 | AAA_25 | 2.97 |
PF14549 | P22_Cro | 1.49 |
PF04851 | ResIII | 1.49 |
PF10073 | DUF2312 | 1.49 |
PF15943 | YdaS_antitoxin | 1.49 |
PF11753 | DUF3310 | 0.99 |
PF09588 | YqaJ | 0.99 |
PF08774 | VRR_NUC | 0.99 |
PF01381 | HTH_3 | 0.99 |
PF00436 | SSB | 0.99 |
PF05065 | Phage_capsid | 0.50 |
PF00176 | SNF2-rel_dom | 0.50 |
PF05772 | NinB | 0.50 |
PF09967 | DUF2201 | 0.50 |
PF01510 | Amidase_2 | 0.50 |
PF05869 | Dam | 0.50 |
PF00166 | Cpn10 | 0.50 |
PF13560 | HTH_31 | 0.50 |
PF08707 | PriCT_2 | 0.50 |
PF08706 | D5_N | 0.50 |
PF00271 | Helicase_C | 0.50 |
PF03237 | Terminase_6N | 0.50 |
PF12705 | PDDEXK_1 | 0.50 |
PF13392 | HNH_3 | 0.50 |
PF10926 | DUF2800 | 0.50 |
COG ID | Name | Functional Category | % Frequency in 202 Family Scaffolds |
---|---|---|---|
COG3179 | Chitinase, GH19 family | Carbohydrate transport and metabolism [G] | 11.39 |
COG3979 | Chitodextrinase | Carbohydrate transport and metabolism [G] | 11.39 |
COG0593 | Chromosomal replication initiation ATPase DnaA | Replication, recombination and repair [L] | 6.93 |
COG0629 | Single-stranded DNA-binding protein | Replication, recombination and repair [L] | 0.99 |
COG2965 | Primosomal replication protein N | Replication, recombination and repair [L] | 0.99 |
COG0234 | Co-chaperonin GroES (HSP10) | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
COG4653 | Predicted phage phi-C31 gp36 major capsid-like protein | Mobilome: prophages, transposons [X] | 0.50 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 63.37 % |
Unclassified | root | N/A | 36.63 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002145|S2t7BSb_10173431 | Not Available | 704 | Open in IMG/M |
3300002161|JGI24766J26685_10029133 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
3300003429|JGI25914J50564_10002058 | Not Available | 6896 | Open in IMG/M |
3300004096|Ga0066177_10071255 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1277 | Open in IMG/M |
3300004125|Ga0066182_10109169 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 667 | Open in IMG/M |
3300004126|Ga0066179_10003461 | All Organisms → Viruses → Predicted Viral | 2620 | Open in IMG/M |
3300004481|Ga0069718_15955272 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
3300004481|Ga0069718_16195126 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1058 | Open in IMG/M |
3300004481|Ga0069718_16334714 | All Organisms → Viruses → Predicted Viral | 2706 | Open in IMG/M |
3300005517|Ga0070374_10245401 | Not Available | 916 | Open in IMG/M |
3300005525|Ga0068877_10120213 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1631 | Open in IMG/M |
3300005581|Ga0049081_10008050 | Not Available | 3986 | Open in IMG/M |
3300005581|Ga0049081_10029280 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2091 | Open in IMG/M |
3300005581|Ga0049081_10076706 | All Organisms → Viruses → Predicted Viral | 1256 | Open in IMG/M |
3300005581|Ga0049081_10102612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1065 | Open in IMG/M |
3300005581|Ga0049081_10212164 | Not Available | 691 | Open in IMG/M |
3300005581|Ga0049081_10243732 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 632 | Open in IMG/M |
3300005581|Ga0049081_10282104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 576 | Open in IMG/M |
3300005582|Ga0049080_10080950 | All Organisms → Viruses → Predicted Viral | 1110 | Open in IMG/M |
3300005582|Ga0049080_10137604 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 821 | Open in IMG/M |
3300005662|Ga0078894_10841838 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 800 | Open in IMG/M |
3300006037|Ga0075465_10110534 | Not Available | 613 | Open in IMG/M |
3300006484|Ga0070744_10080275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 946 | Open in IMG/M |
3300006484|Ga0070744_10081709 | Not Available | 936 | Open in IMG/M |
3300006805|Ga0075464_10483207 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. HX-7-19 | 757 | Open in IMG/M |
3300007538|Ga0099851_1204189 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
3300007549|Ga0102879_1004544 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5149 | Open in IMG/M |
3300007708|Ga0102859_1000351 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 10250 | Open in IMG/M |
3300007708|Ga0102859_1004255 | Not Available | 3360 | Open in IMG/M |
3300007708|Ga0102859_1155799 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300008113|Ga0114346_1116330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1197 | Open in IMG/M |
3300008116|Ga0114350_1025897 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2986 | Open in IMG/M |
3300008116|Ga0114350_1029325 | Not Available | 2508 | Open in IMG/M |
3300008117|Ga0114351_1089853 | Not Available | 1814 | Open in IMG/M |
3300008117|Ga0114351_1128194 | Not Available | 1433 | Open in IMG/M |
3300008259|Ga0114841_1140006 | Not Available | 1660 | Open in IMG/M |
3300008266|Ga0114363_1084959 | Not Available | 1170 | Open in IMG/M |
3300008448|Ga0114876_1128306 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
3300008450|Ga0114880_1096910 | Not Available | 1147 | Open in IMG/M |
3300009037|Ga0105093_10309226 | All Organisms → Viruses | 843 | Open in IMG/M |
3300009037|Ga0105093_10914628 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 516 | Open in IMG/M |
3300009058|Ga0102854_1234388 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas japonica | 527 | Open in IMG/M |
3300009082|Ga0105099_10197335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1151 | Open in IMG/M |
3300009082|Ga0105099_10563963 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 695 | Open in IMG/M |
3300009085|Ga0105103_10195083 | All Organisms → Viruses → Predicted Viral | 1082 | Open in IMG/M |
3300009152|Ga0114980_10015059 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4885 | Open in IMG/M |
3300009152|Ga0114980_10354914 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 845 | Open in IMG/M |
3300009152|Ga0114980_10438466 | Not Available | 747 | Open in IMG/M |
3300009159|Ga0114978_10013152 | Not Available | 6298 | Open in IMG/M |
3300009159|Ga0114978_10634565 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 614 | Open in IMG/M |
3300009169|Ga0105097_10679702 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 582 | Open in IMG/M |
3300009180|Ga0114979_10418217 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium sufflavum | 783 | Open in IMG/M |
3300009183|Ga0114974_10155140 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1429 | Open in IMG/M |
3300009194|Ga0114983_1000023 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 56219 | Open in IMG/M |
3300011184|Ga0136709_1001731 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3648 | Open in IMG/M |
3300012017|Ga0153801_1002872 | Not Available | 3357 | Open in IMG/M |
3300012017|Ga0153801_1074986 | Not Available | 594 | Open in IMG/M |
3300012352|Ga0157138_1024734 | Not Available | 961 | Open in IMG/M |
3300012663|Ga0157203_1000335 | All Organisms → cellular organisms → Bacteria | 15137 | Open in IMG/M |
3300012663|Ga0157203_1000358 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14559 | Open in IMG/M |
3300012667|Ga0157208_10033600 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 689 | Open in IMG/M |
3300012667|Ga0157208_10035595 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 671 | Open in IMG/M |
3300013004|Ga0164293_10156329 | Not Available | 1689 | Open in IMG/M |
3300013004|Ga0164293_11045437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 507 | Open in IMG/M |
3300015050|Ga0181338_1058929 | Not Available | 554 | Open in IMG/M |
3300017716|Ga0181350_1002635 | All Organisms → cellular organisms → Bacteria | 5224 | Open in IMG/M |
3300017716|Ga0181350_1007037 | All Organisms → Viruses → Predicted Viral | 3231 | Open in IMG/M |
3300017716|Ga0181350_1062518 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 969 | Open in IMG/M |
3300017722|Ga0181347_1192671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. HX-7-19 | 539 | Open in IMG/M |
3300017723|Ga0181362_1001017 | Not Available | 5815 | Open in IMG/M |
3300017723|Ga0181362_1059880 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 782 | Open in IMG/M |
3300017747|Ga0181352_1137918 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 652 | Open in IMG/M |
3300017754|Ga0181344_1002865 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6060 | Open in IMG/M |
3300017754|Ga0181344_1115827 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 774 | Open in IMG/M |
3300017754|Ga0181344_1128993 | Not Available | 727 | Open in IMG/M |
3300017754|Ga0181344_1148584 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 669 | Open in IMG/M |
3300017761|Ga0181356_1006398 | All Organisms → Viruses → Predicted Viral | 4664 | Open in IMG/M |
3300017761|Ga0181356_1180245 | Not Available | 638 | Open in IMG/M |
3300017766|Ga0181343_1070969 | Not Available | 1006 | Open in IMG/M |
3300017777|Ga0181357_1256206 | Not Available | 606 | Open in IMG/M |
3300017777|Ga0181357_1336234 | Not Available | 505 | Open in IMG/M |
3300017778|Ga0181349_1004054 | Not Available | 6225 | Open in IMG/M |
3300017778|Ga0181349_1141327 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. HX-7-19 | 872 | Open in IMG/M |
3300017780|Ga0181346_1000014 | Not Available | 66496 | Open in IMG/M |
3300017784|Ga0181348_1004441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6215 | Open in IMG/M |
3300017784|Ga0181348_1262999 | Not Available | 592 | Open in IMG/M |
3300018775|Ga0188848_1017332 | Not Available | 775 | Open in IMG/M |
3300019784|Ga0181359_1000170 | Not Available | 13251 | Open in IMG/M |
3300019784|Ga0181359_1003211 | Not Available | 4957 | Open in IMG/M |
3300019784|Ga0181359_1011393 | All Organisms → Viruses → Predicted Viral | 3194 | Open in IMG/M |
3300019784|Ga0181359_1063995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1403 | Open in IMG/M |
3300019784|Ga0181359_1069260 | All Organisms → Viruses → Predicted Viral | 1339 | Open in IMG/M |
3300019784|Ga0181359_1181801 | Not Available | 694 | Open in IMG/M |
3300019784|Ga0181359_1273043 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 501 | Open in IMG/M |
3300020048|Ga0207193_1802299 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 592 | Open in IMG/M |
3300020151|Ga0211736_10120096 | Not Available | 6836 | Open in IMG/M |
3300020151|Ga0211736_10586323 | Not Available | 35202 | Open in IMG/M |
3300020151|Ga0211736_10868843 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 669 | Open in IMG/M |
3300020159|Ga0211734_10355774 | Not Available | 3898 | Open in IMG/M |
3300020160|Ga0211733_10206727 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1554 | Open in IMG/M |
3300020160|Ga0211733_10246417 | All Organisms → Viruses → Predicted Viral | 2470 | Open in IMG/M |
3300020160|Ga0211733_10515337 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2498 | Open in IMG/M |
3300020160|Ga0211733_11194042 | Not Available | 3689 | Open in IMG/M |
3300020534|Ga0208596_1007618 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 2061 | Open in IMG/M |
3300021960|Ga0222715_10198194 | Not Available | 1203 | Open in IMG/M |
3300021961|Ga0222714_10054112 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2759 | Open in IMG/M |
3300021961|Ga0222714_10142701 | Not Available | 1448 | Open in IMG/M |
3300021961|Ga0222714_10217213 | All Organisms → Viruses → Predicted Viral | 1093 | Open in IMG/M |
3300021962|Ga0222713_10056768 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2962 | Open in IMG/M |
3300021962|Ga0222713_10299900 | Not Available | 1024 | Open in IMG/M |
3300021963|Ga0222712_10226266 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1210 | Open in IMG/M |
3300021963|Ga0222712_10323591 | Not Available | 959 | Open in IMG/M |
3300022173|Ga0181337_1019034 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium | 919 | Open in IMG/M |
3300022179|Ga0181353_1046791 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1138 | Open in IMG/M |
3300022179|Ga0181353_1116598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 642 | Open in IMG/M |
3300022190|Ga0181354_1073235 | Not Available | 1135 | Open in IMG/M |
3300022407|Ga0181351_1095654 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1157 | Open in IMG/M |
3300022407|Ga0181351_1119606 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → Rhodobacter → unclassified Rhodobacter → Rhodobacter sp. HX-7-19 | 990 | Open in IMG/M |
3300022407|Ga0181351_1260402 | Not Available | 534 | Open in IMG/M |
3300024343|Ga0244777_10539756 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingomonas → Sphingomonas japonica | 712 | Open in IMG/M |
3300024346|Ga0244775_10001701 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 25002 | Open in IMG/M |
3300024346|Ga0244775_10446543 | All Organisms → Viruses → Predicted Viral | 1060 | Open in IMG/M |
3300024346|Ga0244775_10503353 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 989 | Open in IMG/M |
3300024348|Ga0244776_10018441 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5803 | Open in IMG/M |
3300024348|Ga0244776_10148887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cellvibrionales → Cellvibrionaceae → Pseudomaricurvus → Pseudomaricurvus alkylphenolicus | 1706 | Open in IMG/M |
3300025075|Ga0209615_101797 | All Organisms → Viruses → Predicted Viral | 1415 | Open in IMG/M |
3300025091|Ga0209616_1003762 | All Organisms → Viruses → Predicted Viral | 2100 | Open in IMG/M |
3300027365|Ga0209300_1000098 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 56227 | Open in IMG/M |
3300027656|Ga0209357_1102940 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 806 | Open in IMG/M |
3300027659|Ga0208975_1024824 | Not Available | 1944 | Open in IMG/M |
3300027659|Ga0208975_1116703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 764 | Open in IMG/M |
3300027659|Ga0208975_1179800 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 575 | Open in IMG/M |
3300027679|Ga0209769_1020883 | Not Available | 2311 | Open in IMG/M |
3300027679|Ga0209769_1023549 | All Organisms → Viruses → Predicted Viral | 2164 | Open in IMG/M |
3300027679|Ga0209769_1050732 | All Organisms → Viruses → Predicted Viral | 1398 | Open in IMG/M |
3300027734|Ga0209087_1334283 | Not Available | 528 | Open in IMG/M |
3300027756|Ga0209444_10014287 | All Organisms → cellular organisms → Bacteria | 4034 | Open in IMG/M |
3300027756|Ga0209444_10100014 | Not Available | 1188 | Open in IMG/M |
3300027763|Ga0209088_10042830 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2229 | Open in IMG/M |
3300027763|Ga0209088_10155084 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1009 | Open in IMG/M |
3300027782|Ga0209500_10009497 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6049 | Open in IMG/M |
3300027797|Ga0209107_10017772 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4070 | Open in IMG/M |
3300027797|Ga0209107_10163991 | All Organisms → Viruses → Predicted Viral | 1125 | Open in IMG/M |
3300027805|Ga0209229_10041607 | All Organisms → Viruses → Predicted Viral | 2035 | Open in IMG/M |
3300027900|Ga0209253_10213117 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1536 | Open in IMG/M |
3300028025|Ga0247723_1001295 | Not Available | 14874 | Open in IMG/M |
3300028027|Ga0247722_10041324 | All Organisms → Viruses → Predicted Viral | 1813 | Open in IMG/M |
3300031539|Ga0307380_11509988 | Not Available | 500 | Open in IMG/M |
3300031673|Ga0307377_10506555 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 878 | Open in IMG/M |
3300031707|Ga0315291_10691600 | Not Available | 907 | Open in IMG/M |
3300031758|Ga0315907_10026763 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5258 | Open in IMG/M |
3300031758|Ga0315907_10403001 | All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. | 1102 | Open in IMG/M |
3300031758|Ga0315907_10644832 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 814 | Open in IMG/M |
3300031758|Ga0315907_11031338 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 591 | Open in IMG/M |
3300031758|Ga0315907_11047493 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 585 | Open in IMG/M |
3300031784|Ga0315899_10597082 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1042 | Open in IMG/M |
3300031786|Ga0315908_10876858 | Not Available | 729 | Open in IMG/M |
3300031787|Ga0315900_10294881 | Not Available | 1348 | Open in IMG/M |
3300031857|Ga0315909_10236275 | All Organisms → Viruses → Predicted Viral | 1415 | Open in IMG/M |
3300031857|Ga0315909_10287656 | All Organisms → Viruses → Predicted Viral | 1237 | Open in IMG/M |
3300031857|Ga0315909_10306372 | All Organisms → Viruses → Predicted Viral | 1184 | Open in IMG/M |
3300031857|Ga0315909_10509902 | Not Available | 828 | Open in IMG/M |
3300031857|Ga0315909_10579619 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 755 | Open in IMG/M |
3300031857|Ga0315909_10621209 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 718 | Open in IMG/M |
3300031951|Ga0315904_10043045 | Not Available | 5115 | Open in IMG/M |
3300031963|Ga0315901_10480785 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales | 973 | Open in IMG/M |
3300032050|Ga0315906_10216164 | Not Available | 1790 | Open in IMG/M |
3300032092|Ga0315905_10052125 | Not Available | 4154 | Open in IMG/M |
3300032092|Ga0315905_10696721 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS4 | 901 | Open in IMG/M |
3300032093|Ga0315902_10081317 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3578 | Open in IMG/M |
3300033994|Ga0334996_0015157 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5069 | Open in IMG/M |
3300033994|Ga0334996_0050681 | Not Available | 2575 | Open in IMG/M |
3300033996|Ga0334979_0293000 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 927 | Open in IMG/M |
3300033996|Ga0334979_0311365 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 892 | Open in IMG/M |
3300034013|Ga0334991_0124190 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1208 | Open in IMG/M |
3300034018|Ga0334985_0000276 | Not Available | 38008 | Open in IMG/M |
3300034020|Ga0335002_0110776 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1846 | Open in IMG/M |
3300034061|Ga0334987_0452502 | Not Available | 796 | Open in IMG/M |
3300034082|Ga0335020_0081578 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → unclassified Planctomycetaceae → Planctomycetaceae bacterium | 1661 | Open in IMG/M |
3300034102|Ga0335029_0364367 | Not Available | 886 | Open in IMG/M |
3300034102|Ga0335029_0718734 | Not Available | 539 | Open in IMG/M |
3300034102|Ga0335029_0743516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 525 | Open in IMG/M |
3300034104|Ga0335031_0046975 | All Organisms → Viruses → Predicted Viral | 3115 | Open in IMG/M |
3300034104|Ga0335031_0059361 | All Organisms → Viruses → Predicted Viral | 2745 | Open in IMG/M |
3300034104|Ga0335031_0156218 | Not Available | 1574 | Open in IMG/M |
3300034104|Ga0335031_0339643 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 963 | Open in IMG/M |
3300034106|Ga0335036_0009598 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 7963 | Open in IMG/M |
3300034108|Ga0335050_0122357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1465 | Open in IMG/M |
3300034117|Ga0335033_0138315 | Not Available | 1366 | Open in IMG/M |
3300034119|Ga0335054_0020516 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 4038 | Open in IMG/M |
3300034119|Ga0335054_0708395 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 539 | Open in IMG/M |
3300034272|Ga0335049_0240644 | Not Available | 1251 | Open in IMG/M |
3300034283|Ga0335007_0180304 | All Organisms → Viruses → Predicted Viral | 1485 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 25.74% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.38% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 10.89% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 6.44% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.44% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 4.95% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 3.96% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 3.96% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 3.47% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.97% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 2.97% |
Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 2.48% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 1.49% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 1.49% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 1.49% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 0.99% |
Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 0.99% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 0.99% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.99% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.99% |
Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.99% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 0.50% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.50% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.50% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.50% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.50% |
Marine | Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Marine | 0.50% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002145 | S2t7BSb (114f) | Environmental | Open in IMG/M |
3300002161 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA | Environmental | Open in IMG/M |
3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
3300004125 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (version 2) | Environmental | Open in IMG/M |
3300004126 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (version 2) | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005517 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4) | Environmental | Open in IMG/M |
3300005525 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel6S_1000h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005582 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300006037 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_DNA | Environmental | Open in IMG/M |
3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
3300006805 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008116 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA | Environmental | Open in IMG/M |
3300008117 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008259 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300008450 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - Oct 27, 2014 all contigs | Environmental | Open in IMG/M |
3300009037 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 1-3cm March2015 | Environmental | Open in IMG/M |
3300009058 | Estuarine microbial communities from the Columbia River estuary - metaG 1370A-02 | Environmental | Open in IMG/M |
3300009082 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
3300009183 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG | Environmental | Open in IMG/M |
3300009194 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300011184 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG | Environmental | Open in IMG/M |
3300012017 | Freshwater microbial communities from Central Basin Lake Erie, Ontario, Canada - Station 1208 - Top - Depth 1m | Environmental | Open in IMG/M |
3300012346 | Freshwater microbial communities from Emily Creek, Ontario, Canada - S29 | Environmental | Open in IMG/M |
3300012352 | Freshwater microbial communities from Baxter Creek, Ontario, Canada - S37 | Environmental | Open in IMG/M |
3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
3300012667 | Freshwater microbial communities from Maskinonge River, Ontario, Canada - S15 | Environmental | Open in IMG/M |
3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
3300015050 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017716 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.DCM.D | Environmental | Open in IMG/M |
3300017722 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017723 | Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N | Environmental | Open in IMG/M |
3300017747 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.S.N | Environmental | Open in IMG/M |
3300017754 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.D.D | Environmental | Open in IMG/M |
3300017761 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.S.N | Environmental | Open in IMG/M |
3300017766 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MLB.S.D | Environmental | Open in IMG/M |
3300017777 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300017778 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D | Environmental | Open in IMG/M |
3300017780 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N | Environmental | Open in IMG/M |
3300017784 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N | Environmental | Open in IMG/M |
3300018775 | Metatranscriptome of marine microbial communities from Baltic Sea - GS679_0p8 | Environmental | Open in IMG/M |
3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
3300020534 | Freshwater microbial communities from Lake Mendota, WI - 12JUL2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022173 | Freshwater viral communities from Lake Michigan, USA - Sp13.VD.MM15.D.D | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022190 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N | Environmental | Open in IMG/M |
3300022407 | Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D | Environmental | Open in IMG/M |
3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300025075 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA to study Microbial Dark Matter (Phase II) - 4B3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025091 | Freshwater bacterial and archeal communities from Indian Creek, Illinois, USA - Floc-Cal metaG (SPAdes) | Environmental | Open in IMG/M |
3300027365 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 RT (SPAdes) | Environmental | Open in IMG/M |
3300027656 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SD (SPAdes) | Environmental | Open in IMG/M |
3300027659 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes) | Environmental | Open in IMG/M |
3300027679 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027734 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
3300027805 | Freshwater and sediment microbial communities from dead zone in Sandusky Bay, Ohio, USA (SPAdes) | Environmental | Open in IMG/M |
3300027900 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - BRP12 BR (SPAdes) | Environmental | Open in IMG/M |
3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
3300031539 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-3 | Environmental | Open in IMG/M |
3300031673 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-3 | Environmental | Open in IMG/M |
3300031707 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031786 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA124 | Environmental | Open in IMG/M |
3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300031963 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA116 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300032092 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA121 | Environmental | Open in IMG/M |
3300032093 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA117 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
3300034013 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Jun2018-rr0034 | Environmental | Open in IMG/M |
3300034018 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME04Jul2014-rr0021 | Environmental | Open in IMG/M |
3300034020 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2015-rr0055 | Environmental | Open in IMG/M |
3300034061 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Sep2004-rr0028 | Environmental | Open in IMG/M |
3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034104 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME02Aug2005-rr0120 | Environmental | Open in IMG/M |
3300034106 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME23Aug2013-rr0131 | Environmental | Open in IMG/M |
3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
3300034117 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jun2014-rr0124 | Environmental | Open in IMG/M |
3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
3300034283 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME07Aug2003-rr0061 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
S2t7BSb_101734312 | 3300002145 | Marine | MTDTPLFIIIVGIVALTTYLIATAPPTTAQEREEMEDDWWE* |
JGI24766J26685_100291333 | 3300002161 | Freshwater And Sediment | MTADNWLFITIMGVIILAAYLNATKPKITEEERKEMEEEWWG* |
JGI25914J50564_100020586 | 3300003429 | Freshwater Lake | MTDTPLFIIITWLLILTAYLMATAPKTTAQERKEMEEDWWE* |
Ga0066177_100712553 | 3300004096 | Freshwater Lake | MTDTPLFIIVMGLLAFTAYLMATKPKITEQERKEMEEDWWD* |
Ga0066182_101091691 | 3300004125 | Freshwater Lake | MSNDTSLFFVILGLVALTAYLISTAPKTTAEEREKMEEDWWE* |
Ga0066179_100034613 | 3300004126 | Freshwater Lake | MSDTPLFFVVIGLLGLTAYLMATAPKTTAQEREEMEEDWWG* |
Ga0069718_159552721 | 3300004481 | Sediment | MTADNWLFILVMGVIILAAYLAATKPKITEQEREEMEEEWWG* |
Ga0069718_161951264 | 3300004481 | Sediment | MSEDTPLFVIIVGLAILTTYLIATAPKITKQEREEMEEEWWG* |
Ga0069718_163347143 | 3300004481 | Sediment | MTADNWLFMFVMGVIILAAYLAATKPKITEQERKEMEEEWWG* |
Ga0070374_102454011 | 3300005517 | Freshwater Lake | MTSDTPLFIIIVGLLILTAYLMATAPKTTAQERKEMEEDWWE* |
Ga0068877_101202134 | 3300005525 | Freshwater Lake | MNNDTPLFVIIVGLAILTTYLIATAPKTTAQERKEMEEDWWG* |
Ga0049081_100080502 | 3300005581 | Freshwater Lentic | MTADNWLFLLVISVWILTAYLIATAPDITEEERKEMEEDWWS* |
Ga0049081_100292806 | 3300005581 | Freshwater Lentic | MTENTPLFFIFIGLAILTTYRIATAPKTTAQERKEMEEDWWS* |
Ga0049081_100767063 | 3300005581 | Freshwater Lentic | MTSDNWLFITVVGLITLTAYLVATKPKITEQERKEMEEEWWD* |
Ga0049081_101026125 | 3300005581 | Freshwater Lentic | MSDTPLFFVVLGLAALTAYLFATRPPLTAEERKEMEEDWWD* |
Ga0049081_101473123 | 3300005581 | Freshwater Lentic | MSSSQLLFAIFIGVLGLTAYLIATRPTITPEERKEMEEEWWG* |
Ga0049081_102121643 | 3300005581 | Freshwater Lentic | MTSNTPLFIIIVGLLGLTSYLLVTAPKITAQEREEMEKDWWS* |
Ga0049081_102437321 | 3300005581 | Freshwater Lentic | MNDTPLFFVVIGLLALTAYLMATAPKTTAQERKEME |
Ga0049081_102821041 | 3300005581 | Freshwater Lentic | RMMTETPLFFVVLGLLALTAYLIAKAPPTTAQERKEMEEDWWE* |
Ga0049080_100809504 | 3300005582 | Freshwater Lentic | MNDTPLFFVVIGLLALTAYLMATAPKTTAQERKEM |
Ga0049080_101376043 | 3300005582 | Freshwater Lentic | MNDTPLFFVVIGLLALTAYLMATAPKTTAQERKEMEEDWWS* |
Ga0078894_108418383 | 3300005662 | Freshwater Lake | MTSDNWLFILVMGIIILTAYSAATKPKITEQERKEMEEEWW |
Ga0075465_101105342 | 3300006037 | Aqueous | MTSDTPLFIIITLLLIVTAYLMATAPKTTAQERKEMEED |
Ga0070744_100802752 | 3300006484 | Estuarine | MTDTPLFIIVMGLLALTAYLIAKAPPTTAQERKEMEEDWWD* |
Ga0070744_100817093 | 3300006484 | Estuarine | MTADNWLFLLVISVWTLTAYLIATAPPTTAQERKDMEDDWWE* |
Ga0075464_104832072 | 3300006805 | Aqueous | MTSDTPLFIIITLLLIVTAYLMATAPKTTAQERKEMEEDWWE* |
Ga0099851_12041892 | 3300007538 | Aqueous | MNDTPLLFVIIGLLAFTTYLMVTAPKTTAEERKEMEEDWWD* |
Ga0102879_100454418 | 3300007549 | Estuarine | MTADNWLFLLVISVWTLTAYLSATAPPTTAQERKDMEDDWWE* |
Ga0102859_10003517 | 3300007708 | Estuarine | MTADNWLFILVMGVVILTAYLTATAPKITEQERKEMEDEWWG* |
Ga0102859_10042553 | 3300007708 | Estuarine | MTDHSLFFVVMGLLILTAYLMATKPEITAQEREEMEEDWWG* |
Ga0102859_11557991 | 3300007708 | Estuarine | NWLFLLVTSVWVLTAYLIATAPDITEQERKEMEEDWWD* |
Ga0114346_11163302 | 3300008113 | Freshwater, Plankton | MTDKTPLFAIIIGLAALTAYLIATRPPVTAQEREEMEEDWWG* |
Ga0114350_10258973 | 3300008116 | Freshwater, Plankton | MTADNWLFLLVISVWVLTAYLIATAPDITEQERKEMEEEWWG* |
Ga0114350_10293254 | 3300008116 | Freshwater, Plankton | MDKKMTADNWLFILVMGIIILTAYLTATAPKTTAQDREEMEEEWWG* |
Ga0114351_10898532 | 3300008117 | Freshwater, Plankton | MTNDTPLFVIIVGLAILTTYLIATAPKTTAQERKEMEEDWWG* |
Ga0114351_11281944 | 3300008117 | Freshwater, Plankton | MTADNWLFILVISVWLLTAYLIVTAPDITEQDRKEMEEEWWG* |
Ga0114841_11400065 | 3300008259 | Freshwater, Plankton | MDKKMTADNWLFILVMGIIILTAYRKEMEEEWWG* |
Ga0114363_10849593 | 3300008266 | Freshwater, Plankton | MTADNWLFILVISVWLLTAYLIVTAPDITEQDREEMEEEWWG* |
Ga0114876_11283063 | 3300008448 | Freshwater Lake | MNNDTPLFVIIVGLAILTTYLIATAPKITEQEREEMEEEWWG* |
Ga0114880_10969103 | 3300008450 | Freshwater Lake | MDKKMTADNWLFILVMGIIILTAYLIVTAPDITEQDRKEMEEEWWG* |
Ga0105093_103092262 | 3300009037 | Freshwater Sediment | MTDNTPLFAIIVGLAILTTYLIATRPPITAQERKEMEEEWWG* |
Ga0105093_109146281 | 3300009037 | Freshwater Sediment | MTADNWLFITIMGIIILAAYLNATKPKITEQERKEMEEDWWG* |
Ga0102854_12343881 | 3300009058 | Estuarine | MTADNWLFLLVISVWTLTAYLIATAPDTTAQERKEMEEDWWE* |
Ga0105099_101973352 | 3300009082 | Freshwater Sediment | MMRLGFKEQQMTADNWLFITVMGVIILAAYLSATKPKITEQEREEMEEDWWG* |
Ga0105099_105639632 | 3300009082 | Freshwater Sediment | MTDNTPLFAIIIGLAALTAYLIATRPPITAQERKEMEEEWWG* |
Ga0105103_101950832 | 3300009085 | Freshwater Sediment | MTDNTPLFAIIIGLAALTAYLIATAPKITEQERKEMEEDWWG* |
Ga0114980_100150593 | 3300009152 | Freshwater Lake | MNDTPLFFVVMGLLALTTYLMATKPKITAQERKEMEEDWWG* |
Ga0114980_103549144 | 3300009152 | Freshwater Lake | MNDTPLFFVVMGLLALTAYLIATAPKTTAQEREEMEEDWWE* |
Ga0114980_104384662 | 3300009152 | Freshwater Lake | MSDTPLFFVVLGLLALTTYLIATAPKTTAQEREEMEEDWWG* |
Ga0114978_100131527 | 3300009159 | Freshwater Lake | MKDTPLLFVIMGLLAFTAYLMVTAPKTTAEERKEMEEDWWE* |
Ga0114978_106345653 | 3300009159 | Freshwater Lake | MSDTPLFFVVMGLLALTAYLMATAPKITAQERKDMEEDWWG* |
Ga0105097_106797022 | 3300009169 | Freshwater Sediment | MTDNTPLFFIVVGLLGLTAYLIATAPKITEQERKEMEDEWWG* |
Ga0114979_104182174 | 3300009180 | Freshwater Lake | MDDRALFFIVVGLLGLTAYLMATAPKITAQQRKEMEEDWWG* |
Ga0114974_101551403 | 3300009183 | Freshwater Lake | MIEHSLFFVVMGLIILTAYLIATKPKITAQERKEMEEEWWG* |
Ga0114974_101849562 | 3300009183 | Freshwater Lake | MSSNQLLFAIFIGVLGLTAYLIATRPTITPEERKEMEEDWWE* |
Ga0114983_100002322 | 3300009194 | Deep Subsurface | MTDNTPLFAVIVGLAILTTYLIATAPKTTAQEREEMEEDWWA* |
Ga0129333_113017191 | 3300010354 | Freshwater To Marine Saline Gradient | MSSNQLLFAIFIGVLGLTAYLIATRPTITPEERKEMEEEWWG* |
Ga0136709_10017318 | 3300011184 | Freshwater | MSNDTPLFFVVMGLLALTAYLMATKPKITEQERKEMEEDWWG* |
Ga0153801_10028723 | 3300012017 | Freshwater | MDKKMTADNWLFILVMGIIILTAYLTATAPKITAQERKEMEEEWWG* |
Ga0153801_10749862 | 3300012017 | Freshwater | MSSNTPLFIIVVGLLGLTAYLMATAPKITEQERKEMEEEWWG* |
Ga0157141_10053657 | 3300012346 | Freshwater | MSSNQILFAIFVGVLGLTGYLIATRPAITPEERKEMEDEWWG* |
Ga0157138_10247344 | 3300012352 | Freshwater | MTDNTPLFAIIIGLAVLTAYLIATAPKITEQERKEMEEEWWG* |
Ga0157203_100033514 | 3300012663 | Freshwater | MSNDTPLFFVVMGLLALTAYLMATKPKITAQERKEMEEDWWG* |
Ga0157203_10003583 | 3300012663 | Freshwater | MSNDTPLFFVVMGLLALTAYLMVTAPPRTAEERKEMEEDWWE* |
Ga0157208_100336003 | 3300012667 | Freshwater | MTADNWLFILVISVWLLTAYMIATAPDITQQERKEMEDEWWG* |
Ga0157208_100355952 | 3300012667 | Freshwater | MTEDTPLFFIIVGLLGLTAYLIATAPKITEQERKEMEEEWWG* |
Ga0164293_101563292 | 3300013004 | Freshwater | MTADNWLFILVMGVIILTAYLTATAPKITEQERKDMEDEWWG* |
Ga0164293_110454371 | 3300013004 | Freshwater | CPRNKGTKQMTADNWLFISIIGVIILATYLNATKPKITQQEREEMEEDWWS* |
Ga0181338_10589291 | 3300015050 | Freshwater Lake | MSDTPLFFVVLGLLALTAYLIATTPETTAQERKEMEEDWWE* |
Ga0181350_10026351 | 3300017716 | Freshwater Lake | DTSLFFVILGLVALTAYLISTAPKTTAEEREKMEEDWWE |
Ga0181350_10070378 | 3300017716 | Freshwater Lake | MSDTPLFFVVMGLLALTAYLMATAPKITAQERKEMEEDWWG |
Ga0181350_10625182 | 3300017716 | Freshwater Lake | MTNDTPLFFVVMGLLALTAYLIATAPKTTAQEREEMEEDWWG |
Ga0181347_11926712 | 3300017722 | Freshwater Lake | RYIMDDRALFFIVVGLLGLTAYLMATKPVTTAQEREEMEEDWWG |
Ga0181362_10010172 | 3300017723 | Freshwater Lake | MTNDTPLFIIITWLLILTAYLMATAPKTTAQERKEMEEDWWE |
Ga0181362_10598801 | 3300017723 | Freshwater Lake | GGMSDTPLFFVVMGLLALTAYLMATAPKITAQEREEMEEDWWG |
Ga0181352_10214134 | 3300017747 | Freshwater Lake | MTANNWLFIVVMGVLGLTGYLIATRPTITPEERKEMEEEWWG |
Ga0181352_11379182 | 3300017747 | Freshwater Lake | VTADNWLFITIMGVIILAAYLNATKPKITEEERKEMEEEWWD |
Ga0181344_100286513 | 3300017754 | Freshwater Lake | MTDNTPLFAIIVGLAILTTYLIATAPKTTAQEREEMEEDWWA |
Ga0181344_11158272 | 3300017754 | Freshwater Lake | MTADNWLFISVMGVIILAAYLNATKPKITEEERKEMEEEWWG |
Ga0181344_11289933 | 3300017754 | Freshwater Lake | MTSDNWLFILVMGIIILTAYSAATKPKITEQERKEMEEDWWE |
Ga0181344_11485843 | 3300017754 | Freshwater Lake | VTADNWLFITIMGVIILAAYLNATKPKITEQERKEMEEEWWG |
Ga0181356_10063984 | 3300017761 | Freshwater Lake | MTADNWLFLLVISVWTLTAYLIATAPETTAQERKEMEDDWWE |
Ga0181356_11802452 | 3300017761 | Freshwater Lake | MSDTPLFFVVLGLLALTAYLIATAPETTAQERKEMEEDWWE |
Ga0181343_10709693 | 3300017766 | Freshwater Lake | MTADNWLFILVMGIIILTAYSAATKPKITEQERKEMEEDWWE |
Ga0181357_12562063 | 3300017777 | Freshwater Lake | MSDTPLFFVILGLLALTAYLIATTPETTAQERKEMEEEWWE |
Ga0181357_13362341 | 3300017777 | Freshwater Lake | MSDTPLFFVVLGLLALTAYLIATAPETTAQERKEMDEEWWE |
Ga0181349_100405410 | 3300017778 | Freshwater Lake | MTDTPLFIIVMGLLAFTAYLMATKPKITEQERKEMEEDW |
Ga0181349_11413272 | 3300017778 | Freshwater Lake | MTNDTPLFIIIVGLLIVTAYLMATAPKTTAQERKEMEEDWWE |
Ga0181346_100001468 | 3300017780 | Freshwater Lake | MTADNWLFITVMGIIILAAYLAATKPKITEQERKAMEEEWWG |
Ga0181348_100444113 | 3300017784 | Freshwater Lake | DNWLFLLVISVWTLTAYLIATAPETTAQERKEMEDDWWE |
Ga0181348_12629991 | 3300017784 | Freshwater Lake | MSDTPLFFVVLGLLALTAYLIATAPETTAQERQEMEADSWA |
Ga0188848_10173322 | 3300018775 | Freshwater Lake | MTDTPLFIIIVGIVALTTYLIATAPPTTAQEREEMEDDWWE |
Ga0181359_100017016 | 3300019784 | Freshwater Lake | MSDTPLFFVVIGLLGLTAYLMATAPKTTAQEREEMEEDWWG |
Ga0181359_10032114 | 3300019784 | Freshwater Lake | MTDTPLFIIIVGLLGLAAYLMATAPKTTAQERKEMEEDWWE |
Ga0181359_10113939 | 3300019784 | Freshwater Lake | MSDTPLFFVVLGLLSLTAYLFATRPPLTAEERKEMEEDWWD |
Ga0181359_10639954 | 3300019784 | Freshwater Lake | MSNDTSLFFVILGLVALTAYLISTAPKTTAEEREKMEEDWWE |
Ga0181359_10692602 | 3300019784 | Freshwater Lake | MTADNWLFLLVISVWTLTAYLIATAPETTAQERKDMEDDWWE |
Ga0181359_11818013 | 3300019784 | Freshwater Lake | MSDTPLFFVVMGLLALTAYLMATAPKITAQEREEMEEDWWG |
Ga0181359_12730432 | 3300019784 | Freshwater Lake | MNNDTPLFVIIVGLAILTTYLIATAPKTTAQERKEMEEDWWG |
Ga0207193_18022993 | 3300020048 | Freshwater Lake Sediment | MTADNWLFLLVISVWILTAYLIATAPDITEQERKEMEEEWWS |
Ga0211736_101200967 | 3300020151 | Freshwater | MTADNWLFVLVMGVIILAAYLIATAPKITEQERKEMEEDWWG |
Ga0211736_1058632333 | 3300020151 | Freshwater | MSADNWLFLLVISVWVLTAYLIATAPDITEQERKEMEEDWWS |
Ga0211736_108688432 | 3300020151 | Freshwater | MTADNWLFILVMGIIILTAYLAATKPKITEQERKEMEEDWWG |
Ga0211734_103557746 | 3300020159 | Freshwater | MTADNWLFVLVMGVIILAAYLAATKPKITEQERKEMEEEWWG |
Ga0211733_102067275 | 3300020160 | Freshwater | MTADNWLFILVMGVIILTAYLTATAPKITEQERKEMEEEWWG |
Ga0211733_102464175 | 3300020160 | Freshwater | MTSNTPLFIIIVCLLGLTSYLLVTAPEITAQEREEMEKDWWS |
Ga0211733_105153374 | 3300020160 | Freshwater | MTADNWLFILVMGVVILTAYLTATAPKITAKDREEMEEEWWG |
Ga0211733_111940423 | 3300020160 | Freshwater | MTEDTPLFFIIVGLLGLTAYLIATAPKITQQERKEMEEEWWG |
Ga0208596_10076185 | 3300020534 | Freshwater | MTADNWLFITVIGLAALTAYLIATAPKTTAQERKEMEEEWWD |
Ga0222715_101981945 | 3300021960 | Estuarine Water | MTNDTPLFVIVVGLVILTTYLIATAPKTTAQERKEMEEDWWA |
Ga0222714_100541123 | 3300021961 | Estuarine Water | MTADNWLFILVISVWLLTAYMIVTAPATTAQERKEMEEEWWD |
Ga0222714_101427012 | 3300021961 | Estuarine Water | MTADNWLFILVMGIIILTAYSAATKPKITEQERKEMEEEWWD |
Ga0222714_102172132 | 3300021961 | Estuarine Water | MTNDTPLFVIIVGLAILTTYLIATAPKITEQERKEMEEEWWG |
Ga0222713_100567681 | 3300021962 | Estuarine Water | MTADNWLFILVMGVIILAAYLSATKPKITQQEREEMEEDWWS |
Ga0222713_102999003 | 3300021962 | Estuarine Water | LFITVMGVIILAAYLSATKPKITQQEREEMEEDWWS |
Ga0222712_102262663 | 3300021963 | Estuarine Water | MTDNTPLFAIIIGLAALTAYLIATAPKITEQEREEMEEDWWG |
Ga0222712_103235911 | 3300021963 | Estuarine Water | ADNWLFILVMGVVILTAYLTATAPKITEQERKEMEDEWWG |
Ga0181337_10190342 | 3300022173 | Freshwater Lake | GEGSMTADNWLFILVMGIIILAAYLAATKPKITEQERKEMEEDWWG |
Ga0181353_10467911 | 3300022179 | Freshwater Lake | VTGMSDTPLFFVVLGLLSLTAYLFATRPPLTAEERKEMEEDWWD |
Ga0181353_10696663 | 3300022179 | Freshwater Lake | MSSNQLLFAIFIGVLGLTAYLIATRPTITPEERKEMEEEWWS |
Ga0181353_11165984 | 3300022179 | Freshwater Lake | MSSNTPLFIIVVGLLGLTAYLMATAPKITEQERKEME |
Ga0181354_10732353 | 3300022190 | Freshwater Lake | MTSDTPLFIIIVGLLILTAYLMATAPKTTAQERKEMEEDWWE |
Ga0181351_10956544 | 3300022407 | Freshwater Lake | MTDTPLFIIVMGLLAFTAYLMATKPKITEQERKEMEEDWWD |
Ga0181351_11196061 | 3300022407 | Freshwater Lake | MTDTPLFIIIVGLLIVTAYLMATAPKTTAQERKEMEEDWWE |
Ga0181351_12604022 | 3300022407 | Freshwater Lake | MSDTPLFFVVLGLLALTAYLIATTPETTAQERKEMEEDWWE |
Ga0244777_105397561 | 3300024343 | Estuarine | MTADNWLFLLVISVWTLTAYLIATAPDTTAQERKEMEEDWWE |
Ga0244775_1000170137 | 3300024346 | Estuarine | MTADNWLFLLVISVWTLTAYLIATAPPTTAQERKDMEDDWWE |
Ga0244775_104465433 | 3300024346 | Estuarine | MNDTPLFFVVIGLLALTAYLMATAPKTTAQERKEMEEDWWS |
Ga0244775_105033533 | 3300024346 | Estuarine | MTDTPLFIIVMGLLALTAYLIAKAPPTTAQERKEMEEDWWD |
Ga0244776_100184418 | 3300024348 | Estuarine | MTADNWLFILVMGVVILTAYLTATAPKITEQERKEMEDEWWG |
Ga0244776_101488873 | 3300024348 | Estuarine | MTDHSLFFVVMGLLILTAYLMATKPEITAQEREEMEEDWWG |
Ga0209615_1017974 | 3300025075 | Freshwater | MTEDTPLFVIIVGLAILTTYLIATAPKITKQEREEMEEEWWG |
Ga0209616_10037628 | 3300025091 | Freshwater | MSNDTPLFFVVMGLLALTAYLMATKPKITEQERKEMEEDWWG |
Ga0209300_100009852 | 3300027365 | Deep Subsurface | MTDNTPLFAVIVGLAILTTYLIATAPKTTAQEREEMEEDWWA |
Ga0209357_11029403 | 3300027656 | Freshwater Lake | PLFIIIVGLLGLAAYLMATAPKTTAQERKEMEEDWWE |
Ga0208975_10248246 | 3300027659 | Freshwater Lentic | MTENTPLFFIFIGLAILTTYRIATAPKTTAQERKEMEEDWWS |
Ga0208975_11167032 | 3300027659 | Freshwater Lentic | MTSNTPLFIIIVGLLGLTSYLLVTAPKITAQEREEMEKDWWS |
Ga0208975_11798001 | 3300027659 | Freshwater Lentic | MTSDNWLFITVVGLITLTAYLVATKPKITEQERKEMEEEWWD |
Ga0209769_10208831 | 3300027679 | Freshwater Lake | MTDTPLFIIITWLLILTAYLMATAPKTTAQERKEMEEDWWE |
Ga0209769_10235494 | 3300027679 | Freshwater Lake | PLFFVVIGLLGLTAYLMATAPKTTAQEREEMEEDWWG |
Ga0209769_10507322 | 3300027679 | Freshwater Lake | MNDTPLFFVVIGLLALTAYLMATAPKTTAQERKEMEEDWWG |
Ga0209087_13342831 | 3300027734 | Freshwater Lake | MSDTPLFFVVMGLLALTAYLMATAPKITAQERKDMEEDWWG |
Ga0209444_100142871 | 3300027756 | Freshwater Lake | QMTDTPLFIIIVGLLGLAAYLMATAPKTTAQERKEMEEDWWE |
Ga0209444_101000145 | 3300027756 | Freshwater Lake | RKRGAHMTSDTPLFIIIVGLLILTAYLMATAPKTTAQERKEMEEDWWE |
Ga0209296_12268974 | 3300027759 | Freshwater Lake | MSSNQLLFAIFIGVLGLTAYLIATRPTITPEERKEMEEDWWE |
Ga0209088_100428307 | 3300027763 | Freshwater Lake | MNDTPLFFVVMGLLALTAYLIATAPKTTAQEREEMEEDWWE |
Ga0209088_101550843 | 3300027763 | Freshwater Lake | MNDTPLFFVVMGLLALTTYLMATKPKITAQERKEMEEDWWG |
Ga0209500_100094977 | 3300027782 | Freshwater Lake | MKDTPLLFVIMGLLAFTAYLMVTAPKTTAEERKEMEEDWWE |
Ga0209107_1001777210 | 3300027797 | Freshwater And Sediment | TPLFFVVMGLLAFTAYMIATAPKTTAQERKEMEEDWWE |
Ga0209107_101639912 | 3300027797 | Freshwater And Sediment | MTSNTPLFIIIVGLLGLTAYLMATAPKITAQEREEMEEDWWE |
Ga0209229_100416072 | 3300027805 | Freshwater And Sediment | MTADNWLFITIMGVIILAAYLNATKPKITEEERKEMEEEWWG |
Ga0209253_102131172 | 3300027900 | Freshwater Lake Sediment | MTDNTPLFAVIVGLAILTTYLIATRPPVTAQEREEMEEDWWG |
Ga0247723_100129510 | 3300028025 | Deep Subsurface Sediment | MSNDTPLFFVVMGLLALTAYLMATAPKTTAQERKEMEEDWWG |
Ga0247722_100413243 | 3300028027 | Deep Subsurface Sediment | MTADNWLFITVMGVIILAAYLNATKPKITEQERKEMEEDWWG |
Ga0307380_115099881 | 3300031539 | Soil | MTDTPLFIIIVGIVALTTYLLATAPPTTAQEREEMEDDWWE |
Ga0307377_105065553 | 3300031673 | Soil | MSNDTPLFFVVMGLLALTAYLMATKPKITAEERKEMEEDWWG |
Ga0315291_106916004 | 3300031707 | Sediment | MSNDTPLFFVVMGLLALTAYLMATKPKITEQERKEMEED |
Ga0315907_100267637 | 3300031758 | Freshwater | MTADNWLFILVISVWLLTAYLIVTAPDITEQDRKEMEEEWWG |
Ga0315907_104030013 | 3300031758 | Freshwater | MTNDTPLFVIIVGLAILTTYLIATAPKTTAQERKEMEEDWWG |
Ga0315907_106448323 | 3300031758 | Freshwater | VTADNWLFILVMGVVILTAYLTATAPKITAQEREEMEEEWWG |
Ga0315907_110313382 | 3300031758 | Freshwater | MTADNWLFLLVISVWVLTAYLIATAPDITEQERKEMEEEWWG |
Ga0315907_110474932 | 3300031758 | Freshwater | MTADNWLFISIIGVIILATYLNATKPKITQQEREEMEEDWWG |
Ga0315899_105970823 | 3300031784 | Freshwater | MTDKTPLFAIIIGLAALTAYLIATRPPVTAQEREEMEEDWWG |
Ga0315908_108768583 | 3300031786 | Freshwater | DNWLFILVMGIIILTAYLTATAPKTTAQDREEMEEEWWG |
Ga0315900_102948813 | 3300031787 | Freshwater | MDKKMTADNWLFILVMGIIILTAYLIVTAPDITEQDRKEMEEEWWG |
Ga0315909_102362753 | 3300031857 | Freshwater | MSDTPLFFVVLGLLSLTAYLFATRPPLTAEDRKEMEEDWWD |
Ga0315909_102870423 | 3300031857 | Freshwater | MTANNWLFIAIMGVLGLTTYLIATRPTITPEERKEMEEEWWG |
Ga0315909_102876562 | 3300031857 | Freshwater | MTADNWLFIAIMGVLGLTGYLIATRPTITPEERKEMEEEWWG |
Ga0315909_103063723 | 3300031857 | Freshwater | MSSNTPLFIIVVGLLGLTAYLMATAPKITEQERKEMEEEWWG |
Ga0315909_104295752 | 3300031857 | Freshwater | MSSNQILFAIFIGVLGLTAYLIATRPTITPEERKEMEEEWWG |
Ga0315909_105099023 | 3300031857 | Freshwater | MSDTPLFFVVLGLAALTAYLFATRPPLTAEDRKEMEEDWWD |
Ga0315909_105796192 | 3300031857 | Freshwater | MTNDTPLFVIIVGLAILTTYLIATAPKITKQEREEMEEEWWG |
Ga0315909_106212093 | 3300031857 | Freshwater | MTADNWLFITVMGVIILAAYLNATKPKITQQEREEMEEDWWG |
Ga0315904_1004304510 | 3300031951 | Freshwater | MTADNWLFILVMGIIILTAYLTATAPKTTAQDREEMEEEWWG |
Ga0315901_104807854 | 3300031963 | Freshwater | MDKKMTADNWLFILVMGIIILTAYLTATAPKTTAQDREEMEEE |
Ga0315906_102161645 | 3300032050 | Freshwater | MTADNWLFILVISVWLLTAYLIVTAPDITEQDREEMEEEWWG |
Ga0315905_100521255 | 3300032092 | Freshwater | MTADNWLFITVIGLAALTAYLIATAPKTTAQERKEMEEDWWD |
Ga0315905_106967215 | 3300032092 | Freshwater | HARLNVTDRVLFCVVVGIVLLSIYLTATAPETTAQEREEMEEDWWS |
Ga0315902_100813171 | 3300032093 | Freshwater | MTADNWLFILVMGIIILTAYLIVTAPDITEQDRKEMEEEWWG |
Ga0334996_0015157_2916_3044 | 3300033994 | Freshwater | MTSDNWLFMFVMGIIILAAYLAATKPKITEQERKEMEEEWWG |
Ga0334996_0050681_1208_1366 | 3300033994 | Freshwater | MMKLDFKEQQMTADNWLFITVMGVIILAAYLTATAPKITKQERKEMEEEWWG |
Ga0334979_0293000_722_847 | 3300033996 | Freshwater | MNDTPLLFVIIGLLAFTTYLMVTAPKTTAEERKEMEEDWWD |
Ga0334979_0311365_99_227 | 3300033996 | Freshwater | MTADNWLFILVMGVIILTAYLTATAPKITEQERKDMEDEWWG |
Ga0334991_0124190_75_203 | 3300034013 | Freshwater | MTADNWLFLLVISVWVLTAYLIATAPDITEQERREMEKDWWS |
Ga0334985_0000276_11316_11474 | 3300034018 | Freshwater | MMKLDFKEQQMTADNWLFITVMGVIILAAYLTATAPKITEQERKEMEEEWWG |
Ga0335002_0110776_34_162 | 3300034020 | Freshwater | MTDNTPLFAIIIGLAVLTAYLIATAPKITEQERKEMEEEWWG |
Ga0334987_0452502_673_795 | 3300034061 | Freshwater | DNTPLFAIIIGLAVLTAYLIATAPKITEQERKEMEEEWWG |
Ga0335020_0081578_3_113 | 3300034082 | Freshwater | LFAIIIGLAVLTAYLIATAPKITEQERKEMEEEWWG |
Ga0335029_0364367_703_831 | 3300034102 | Freshwater | MTADNWLFLLVISIWLLTAYLIATAPDITEQERKEMEDEWWT |
Ga0335029_0718734_111_239 | 3300034102 | Freshwater | MSSDTPLFFVVMGLLALTAYLMATAPKTTAQERKEMEEDWWE |
Ga0335029_0743516_10_135 | 3300034102 | Freshwater | MNDTPLLFVIMGLLAFTAYLMVTAPKTTAEERKEMEEDWWE |
Ga0335031_0046975_1407_1535 | 3300034104 | Freshwater | VTADNWLFITVMGVIILAAYLSATKPKITEQEREEMEEEWWG |
Ga0335031_0059361_2501_2629 | 3300034104 | Freshwater | MTDNTPLFAIIIGLAALTAYLIATKPPVTAQEREEMEEDWWG |
Ga0335031_0156218_46_204 | 3300034104 | Freshwater | MMKLDFKEQQMTADNWLFITVMGVIILATYLNATKPKITQQEREEMEEDWWS |
Ga0335031_0339643_518_646 | 3300034104 | Freshwater | MNNDTPLFVIIVGLAILTTYLIATKPKITEQERKEMEEDWWG |
Ga0335036_0009598_7480_7632 | 3300034106 | Freshwater | MRLDFKEQQMSDTPLFFVVLGLAALTAYLFATRPPLTAEDRKEMEEDWWD |
Ga0335050_0122357_1343_1465 | 3300034108 | Freshwater | ADNWLFLLVISVWVLTAYLIATAPDITEQERKEMEEEWWG |
Ga0335033_0138315_2_112 | 3300034117 | Freshwater | LFLLVISVWVLTAYLIATAPDITEQERKEMEEEWWG |
Ga0335054_0020516_3761_3889 | 3300034119 | Freshwater | MTDNTPLFAIIVGLAILTTYLIATAPKTTAQEREEMEEEWWG |
Ga0335054_0708395_109_237 | 3300034119 | Freshwater | MTDNTPLFAIIVGLAILTTYLIATAPKTTAQEREEMEEDWWG |
Ga0335049_0240644_97_225 | 3300034272 | Freshwater | MTADNWLFISIIGVIILATYLNATKPKITQQEREEMEEDWWS |
Ga0335007_0180304_1262_1390 | 3300034283 | Freshwater | MTNDTPLFFVLLGVVALATYLIVTAPKITEQERKEMEEDWWG |
⦗Top⦘ |