| Basic Information | |
|---|---|
| Family ID | F025245 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 202 |
| Average Sequence Length | 42 residues |
| Representative Sequence | FVLTMTPKQMDSEHRSFYAEEDGVIHGDDQKAADANSPKVK |
| Number of Associated Samples | 171 |
| Number of Associated Scaffolds | 202 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.51 % |
| % of genes near scaffold ends (potentially truncated) | 95.54 % |
| % of genes from short scaffolds (< 2000 bps) | 85.64 % |
| Associated GOLD sequencing projects | 165 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.44 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (96.535 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (11.386 % of family members) |
| Environment Ontology (ENVO) | Unclassified (26.733 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.564 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 4.35% β-sheet: 14.49% Coil/Unstructured: 81.16% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.44 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 202 Family Scaffolds |
|---|---|---|
| PF13520 | AA_permease_2 | 5.45 |
| PF01883 | FeS_assembly_P | 5.45 |
| PF00578 | AhpC-TSA | 3.47 |
| PF00849 | PseudoU_synth_2 | 2.97 |
| PF00795 | CN_hydrolase | 2.48 |
| PF04191 | PEMT | 2.48 |
| PF03576 | Peptidase_S58 | 1.98 |
| PF14317 | YcxB | 0.99 |
| PF02308 | MgtC | 0.99 |
| PF00675 | Peptidase_M16 | 0.99 |
| PF05163 | DinB | 0.99 |
| PF00196 | GerE | 0.99 |
| PF13365 | Trypsin_2 | 0.50 |
| PF02597 | ThiS | 0.50 |
| PF07726 | AAA_3 | 0.50 |
| PF13380 | CoA_binding_2 | 0.50 |
| PF05985 | EutC | 0.50 |
| PF02517 | Rce1-like | 0.50 |
| PF02321 | OEP | 0.50 |
| PF01161 | PBP | 0.50 |
| PF13517 | FG-GAP_3 | 0.50 |
| PF06537 | DHOR | 0.50 |
| PF01361 | Tautomerase | 0.50 |
| PF14542 | Acetyltransf_CG | 0.50 |
| PF04055 | Radical_SAM | 0.50 |
| PF13432 | TPR_16 | 0.50 |
| PF03462 | PCRF | 0.50 |
| PF01597 | GCV_H | 0.50 |
| PF13564 | DoxX_2 | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 202 Family Scaffolds |
|---|---|---|---|
| COG3191 | L-aminopeptidase/D-esterase | Amino acid transport and metabolism [E] | 3.96 |
| COG0564 | Pseudouridine synthase RluA, 23S rRNA- or tRNA-specific | Translation, ribosomal structure and biogenesis [J] | 2.97 |
| COG1187 | Pseudouridylate synthase RsuA, specific for 16S rRNA U516 and 23S rRNA U2605 | Translation, ribosomal structure and biogenesis [J] | 2.97 |
| COG1285 | Magnesium uptake protein YhiD/SapB, involved in acid resistance | Inorganic ion transport and metabolism [P] | 0.99 |
| COG1538 | Outer membrane protein TolC | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG3174 | Membrane component of predicted Mg2+ transport system, contains DUF4010 domain | Inorganic ion transport and metabolism [P] | 0.99 |
| COG2318 | Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB) | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.99 |
| COG1942 | Phenylpyruvate tautomerase PptA, 4-oxalocrotonate tautomerase family | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.50 |
| COG4449 | Predicted protease, Abi (CAAX) family | General function prediction only [R] | 0.50 |
| COG4302 | Ethanolamine ammonia-lyase, small subunit | Amino acid transport and metabolism [E] | 0.50 |
| COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.50 |
| COG2104 | Sulfur carrier protein ThiS (thiamine biosynthesis) | Coenzyme transport and metabolism [H] | 0.50 |
| COG1977 | Molybdopterin synthase sulfur carrier subunit MoaD | Coenzyme transport and metabolism [H] | 0.50 |
| COG0216 | Protein chain release factor RF1 | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG1881 | Uncharacterized conserved protein, phosphatidylethanolamine-binding protein (PEBP) family | General function prediction only [R] | 0.50 |
| COG1266 | Membrane protease YdiL, CAAX protease family | Posttranslational modification, protein turnover, chaperones [O] | 0.50 |
| COG1186 | Protein chain release factor PrfB | Translation, ribosomal structure and biogenesis [J] | 0.50 |
| COG0509 | Glycine cleavage system protein H (lipoate-binding) | Amino acid transport and metabolism [E] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 96.53 % |
| Unclassified | root | N/A | 3.47 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000364|INPhiseqgaiiFebDRAFT_104032989 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300000550|F24TB_13984456 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 530 | Open in IMG/M |
| 3300001154|JGI12636J13339_1050894 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 512 | Open in IMG/M |
| 3300001867|JGI12627J18819_10018749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 2809 | Open in IMG/M |
| 3300002560|JGI25383J37093_10137762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 660 | Open in IMG/M |
| 3300002911|JGI25390J43892_10088328 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 695 | Open in IMG/M |
| 3300005171|Ga0066677_10249063 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
| 3300005174|Ga0066680_10765902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 585 | Open in IMG/M |
| 3300005435|Ga0070714_101706860 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300005436|Ga0070713_101789689 | All Organisms → cellular organisms → Bacteria | 596 | Open in IMG/M |
| 3300005437|Ga0070710_10300226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1048 | Open in IMG/M |
| 3300005454|Ga0066687_10055809 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1860 | Open in IMG/M |
| 3300005454|Ga0066687_10361962 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 833 | Open in IMG/M |
| 3300005538|Ga0070731_10079977 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2167 | Open in IMG/M |
| 3300005542|Ga0070732_10093181 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1770 | Open in IMG/M |
| 3300005568|Ga0066703_10823401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 530 | Open in IMG/M |
| 3300005569|Ga0066705_10292896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1032 | Open in IMG/M |
| 3300005602|Ga0070762_10109697 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1608 | Open in IMG/M |
| 3300005764|Ga0066903_105862738 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 645 | Open in IMG/M |
| 3300005764|Ga0066903_108984461 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 506 | Open in IMG/M |
| 3300005995|Ga0066790_10151841 | All Organisms → cellular organisms → Bacteria | 992 | Open in IMG/M |
| 3300005995|Ga0066790_10494138 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300006046|Ga0066652_102058825 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
| 3300006052|Ga0075029_100006441 | All Organisms → cellular organisms → Bacteria | 6480 | Open in IMG/M |
| 3300006059|Ga0075017_100266154 | All Organisms → cellular organisms → Bacteria | 1258 | Open in IMG/M |
| 3300006059|Ga0075017_100979788 | All Organisms → cellular organisms → Bacteria | 658 | Open in IMG/M |
| 3300006102|Ga0075015_100118656 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 1347 | Open in IMG/M |
| 3300006162|Ga0075030_100869999 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300006755|Ga0079222_12512974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300006893|Ga0073928_11140250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 527 | Open in IMG/M |
| 3300007258|Ga0099793_10027679 | All Organisms → cellular organisms → Bacteria | 2383 | Open in IMG/M |
| 3300007788|Ga0099795_10497909 | All Organisms → cellular organisms → Bacteria | 568 | Open in IMG/M |
| 3300009038|Ga0099829_10145757 | All Organisms → cellular organisms → Bacteria | 1886 | Open in IMG/M |
| 3300009038|Ga0099829_10337298 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1240 | Open in IMG/M |
| 3300009038|Ga0099829_11576012 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
| 3300009089|Ga0099828_10424783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1198 | Open in IMG/M |
| 3300009089|Ga0099828_10577250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1013 | Open in IMG/M |
| 3300009090|Ga0099827_10245883 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1502 | Open in IMG/M |
| 3300009518|Ga0116128_1196016 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 568 | Open in IMG/M |
| 3300009521|Ga0116222_1383434 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 611 | Open in IMG/M |
| 3300009522|Ga0116218_1084447 | Not Available | 1447 | Open in IMG/M |
| 3300009552|Ga0116138_1120203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 727 | Open in IMG/M |
| 3300009630|Ga0116114_1096418 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300009640|Ga0116126_1077982 | All Organisms → cellular organisms → Bacteria | 1221 | Open in IMG/M |
| 3300009665|Ga0116135_1024600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2059 | Open in IMG/M |
| 3300009760|Ga0116131_1088069 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300009792|Ga0126374_10298649 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1078 | Open in IMG/M |
| 3300010048|Ga0126373_10293349 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1619 | Open in IMG/M |
| 3300010159|Ga0099796_10313605 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300010341|Ga0074045_10632045 | All Organisms → cellular organisms → Bacteria | 682 | Open in IMG/M |
| 3300010358|Ga0126370_11492614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 642 | Open in IMG/M |
| 3300010371|Ga0134125_11195534 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 831 | Open in IMG/M |
| 3300010376|Ga0126381_101848997 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 871 | Open in IMG/M |
| 3300010376|Ga0126381_104442314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 542 | Open in IMG/M |
| 3300010379|Ga0136449_100718816 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1671 | Open in IMG/M |
| 3300010379|Ga0136449_100988666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 1356 | Open in IMG/M |
| 3300010379|Ga0136449_101817093 | All Organisms → cellular organisms → Bacteria | 911 | Open in IMG/M |
| 3300011119|Ga0105246_12492362 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 509 | Open in IMG/M |
| 3300011270|Ga0137391_10991400 | All Organisms → cellular organisms → Bacteria | 684 | Open in IMG/M |
| 3300011271|Ga0137393_10192579 | All Organisms → cellular organisms → Bacteria | 1717 | Open in IMG/M |
| 3300012203|Ga0137399_10467752 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1055 | Open in IMG/M |
| 3300012205|Ga0137362_10381304 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1221 | Open in IMG/M |
| 3300012208|Ga0137376_11145368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 665 | Open in IMG/M |
| 3300012349|Ga0137387_10405635 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300012685|Ga0137397_10062698 | All Organisms → cellular organisms → Bacteria | 2683 | Open in IMG/M |
| 3300012918|Ga0137396_10500121 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300012923|Ga0137359_10031570 | All Organisms → cellular organisms → Bacteria | 4549 | Open in IMG/M |
| 3300012930|Ga0137407_10329761 | All Organisms → cellular organisms → Bacteria | 1401 | Open in IMG/M |
| 3300012944|Ga0137410_11648346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 563 | Open in IMG/M |
| 3300012944|Ga0137410_11957164 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300014152|Ga0181533_1334326 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300014162|Ga0181538_10337582 | All Organisms → cellular organisms → Bacteria | 812 | Open in IMG/M |
| 3300014162|Ga0181538_10619084 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300014169|Ga0181531_10329293 | All Organisms → cellular organisms → Bacteria | 936 | Open in IMG/M |
| 3300014199|Ga0181535_10113506 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1732 | Open in IMG/M |
| 3300014502|Ga0182021_13598088 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300015373|Ga0132257_100428131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1613 | Open in IMG/M |
| 3300016750|Ga0181505_10635788 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1741 | Open in IMG/M |
| 3300017822|Ga0187802_10010300 | All Organisms → cellular organisms → Bacteria → environmental samples → uncultured bacterium | 3003 | Open in IMG/M |
| 3300017925|Ga0187856_1336954 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300017938|Ga0187854_10302524 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 683 | Open in IMG/M |
| 3300017938|Ga0187854_10375216 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidicapsa → Acidicapsa acidisoli | 599 | Open in IMG/M |
| 3300017943|Ga0187819_10079104 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1961 | Open in IMG/M |
| 3300017946|Ga0187879_10146815 | All Organisms → cellular organisms → Bacteria | 1336 | Open in IMG/M |
| 3300017946|Ga0187879_10210189 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1090 | Open in IMG/M |
| 3300017955|Ga0187817_10024831 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3592 | Open in IMG/M |
| 3300017955|Ga0187817_10437938 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 834 | Open in IMG/M |
| 3300017955|Ga0187817_10836715 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
| 3300017955|Ga0187817_11142501 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 500 | Open in IMG/M |
| 3300017961|Ga0187778_10202743 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1264 | Open in IMG/M |
| 3300017961|Ga0187778_10825164 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 634 | Open in IMG/M |
| 3300017975|Ga0187782_10214560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1442 | Open in IMG/M |
| 3300017988|Ga0181520_10108753 | All Organisms → cellular organisms → Bacteria | 2352 | Open in IMG/M |
| 3300018003|Ga0187876_1094603 | All Organisms → cellular organisms → Bacteria | 1120 | Open in IMG/M |
| 3300018006|Ga0187804_10215110 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
| 3300018015|Ga0187866_1256705 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300018017|Ga0187872_10069808 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1822 | Open in IMG/M |
| 3300018030|Ga0187869_10495272 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300018033|Ga0187867_10124284 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1493 | Open in IMG/M |
| 3300018033|Ga0187867_10347371 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
| 3300018034|Ga0187863_10316879 | All Organisms → cellular organisms → Bacteria | 867 | Open in IMG/M |
| 3300018035|Ga0187875_10010169 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5983 | Open in IMG/M |
| 3300018040|Ga0187862_10417638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 820 | Open in IMG/M |
| 3300018040|Ga0187862_10515391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 717 | Open in IMG/M |
| 3300018046|Ga0187851_10853290 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 512 | Open in IMG/M |
| 3300018047|Ga0187859_10067972 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1877 | Open in IMG/M |
| 3300018047|Ga0187859_10299655 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 870 | Open in IMG/M |
| 3300018062|Ga0187784_10513327 | All Organisms → cellular organisms → Bacteria | 965 | Open in IMG/M |
| 3300018085|Ga0187772_10821620 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales | 672 | Open in IMG/M |
| 3300018085|Ga0187772_10964724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 621 | Open in IMG/M |
| 3300018085|Ga0187772_11493960 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300018086|Ga0187769_10049554 | All Organisms → cellular organisms → Bacteria | 2914 | Open in IMG/M |
| 3300018088|Ga0187771_11270490 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
| 3300019275|Ga0187798_1489467 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300019787|Ga0182031_1102901 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1684 | Open in IMG/M |
| 3300019787|Ga0182031_1460803 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2463 | Open in IMG/M |
| 3300020002|Ga0193730_1020909 | All Organisms → cellular organisms → Bacteria | 1888 | Open in IMG/M |
| 3300020018|Ga0193721_1011238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2349 | Open in IMG/M |
| 3300020579|Ga0210407_10907225 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300021088|Ga0210404_10577497 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 638 | Open in IMG/M |
| 3300021168|Ga0210406_10665069 | All Organisms → cellular organisms → Bacteria | 806 | Open in IMG/M |
| 3300021168|Ga0210406_10809158 | All Organisms → cellular organisms → Bacteria | 712 | Open in IMG/M |
| 3300021170|Ga0210400_10579911 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 925 | Open in IMG/M |
| 3300021377|Ga0213874_10307413 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 598 | Open in IMG/M |
| 3300021402|Ga0210385_10593139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 844 | Open in IMG/M |
| 3300021405|Ga0210387_10397475 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1221 | Open in IMG/M |
| 3300021407|Ga0210383_10131776 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2118 | Open in IMG/M |
| 3300021420|Ga0210394_10210353 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1697 | Open in IMG/M |
| 3300021420|Ga0210394_10922855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300021433|Ga0210391_10812878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 730 | Open in IMG/M |
| 3300021559|Ga0210409_10338963 | All Organisms → cellular organisms → Bacteria | 1352 | Open in IMG/M |
| 3300021560|Ga0126371_10581397 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1269 | Open in IMG/M |
| 3300021860|Ga0213851_1271920 | All Organisms → cellular organisms → Bacteria | 640 | Open in IMG/M |
| 3300022731|Ga0224563_1021918 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300024295|Ga0224556_1096281 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300025444|Ga0208189_1018934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1502 | Open in IMG/M |
| 3300025500|Ga0208686_1038504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1158 | Open in IMG/M |
| 3300025500|Ga0208686_1101223 | All Organisms → cellular organisms → Bacteria | 613 | Open in IMG/M |
| 3300025915|Ga0207693_10102508 | All Organisms → cellular organisms → Bacteria | 2244 | Open in IMG/M |
| 3300025929|Ga0207664_11985295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300026088|Ga0207641_11040864 | Not Available | 816 | Open in IMG/M |
| 3300026294|Ga0209839_10175220 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 698 | Open in IMG/M |
| 3300026322|Ga0209687_1176542 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300026325|Ga0209152_10450498 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300026333|Ga0209158_1030815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2321 | Open in IMG/M |
| 3300026538|Ga0209056_10388212 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 875 | Open in IMG/M |
| 3300026552|Ga0209577_10400591 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300027174|Ga0207948_1032507 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 626 | Open in IMG/M |
| 3300027521|Ga0209524_1015642 | All Organisms → cellular organisms → Bacteria | 1549 | Open in IMG/M |
| 3300027576|Ga0209003_1013560 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1257 | Open in IMG/M |
| 3300027729|Ga0209248_10126059 | All Organisms → cellular organisms → Bacteria | 768 | Open in IMG/M |
| 3300027729|Ga0209248_10171487 | All Organisms → cellular organisms → Bacteria | 644 | Open in IMG/M |
| 3300027846|Ga0209180_10438206 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300027869|Ga0209579_10659545 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 567 | Open in IMG/M |
| 3300027903|Ga0209488_10912961 | All Organisms → cellular organisms → Bacteria | 615 | Open in IMG/M |
| 3300028020|Ga0265351_1025401 | All Organisms → cellular organisms → Bacteria | 527 | Open in IMG/M |
| 3300028777|Ga0302290_10006113 | All Organisms → cellular organisms → Bacteria | 2885 | Open in IMG/M |
| 3300028779|Ga0302266_10102575 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1167 | Open in IMG/M |
| 3300028785|Ga0302201_10124569 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
| 3300029952|Ga0311346_10386613 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
| 3300029955|Ga0311342_10112917 | All Organisms → cellular organisms → Bacteria | 2842 | Open in IMG/M |
| 3300029989|Ga0311365_10708560 | All Organisms → cellular organisms → Bacteria | 872 | Open in IMG/M |
| 3300029999|Ga0311339_10093886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3740 | Open in IMG/M |
| 3300030503|Ga0311370_10048515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6275 | Open in IMG/M |
| 3300030519|Ga0302193_10273881 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 901 | Open in IMG/M |
| 3300030618|Ga0311354_10593148 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1078 | Open in IMG/M |
| 3300030706|Ga0310039_10190870 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 811 | Open in IMG/M |
| 3300031028|Ga0302180_10318343 | All Organisms → cellular organisms → Bacteria | 797 | Open in IMG/M |
| 3300031232|Ga0302323_101288706 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300031233|Ga0302307_10228092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 958 | Open in IMG/M |
| 3300031236|Ga0302324_101243813 | All Organisms → cellular organisms → Bacteria | 988 | Open in IMG/M |
| 3300031239|Ga0265328_10020673 | All Organisms → cellular organisms → Bacteria | 2518 | Open in IMG/M |
| 3300031247|Ga0265340_10145116 | All Organisms → cellular organisms → Bacteria | 1084 | Open in IMG/M |
| 3300031247|Ga0265340_10413854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300031715|Ga0307476_10170739 | All Organisms → cellular organisms → Bacteria | 1569 | Open in IMG/M |
| 3300031718|Ga0307474_10772825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 759 | Open in IMG/M |
| 3300031720|Ga0307469_10551943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300031736|Ga0318501_10869143 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
| 3300031740|Ga0307468_102002105 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 555 | Open in IMG/M |
| 3300031823|Ga0307478_10352927 | All Organisms → cellular organisms → Bacteria | 1212 | Open in IMG/M |
| 3300031890|Ga0306925_10673675 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300031890|Ga0306925_11437003 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 678 | Open in IMG/M |
| 3300031945|Ga0310913_10844694 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300032001|Ga0306922_10010759 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8952 | Open in IMG/M |
| 3300032001|Ga0306922_10626051 | All Organisms → cellular organisms → Bacteria | 1138 | Open in IMG/M |
| 3300032010|Ga0318569_10572933 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 526 | Open in IMG/M |
| 3300032174|Ga0307470_10137574 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1472 | Open in IMG/M |
| 3300032180|Ga0307471_103609815 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 547 | Open in IMG/M |
| 3300032783|Ga0335079_10139357 | All Organisms → cellular organisms → Bacteria | 2727 | Open in IMG/M |
| 3300032805|Ga0335078_11692018 | All Organisms → cellular organisms → Bacteria | 694 | Open in IMG/M |
| 3300032892|Ga0335081_11960210 | All Organisms → cellular organisms → Bacteria | 627 | Open in IMG/M |
| 3300032954|Ga0335083_11115021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 616 | Open in IMG/M |
| 3300033412|Ga0310810_10805382 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 847 | Open in IMG/M |
| 3300033486|Ga0316624_12138578 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300033755|Ga0371489_0095415 | All Organisms → cellular organisms → Bacteria | 1756 | Open in IMG/M |
| 3300033826|Ga0334847_001775 | All Organisms → cellular organisms → Bacteria | 1955 | Open in IMG/M |
| 3300033982|Ga0371487_0094740 | All Organisms → cellular organisms → Bacteria | 1585 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 11.39% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 9.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.92% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 5.94% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 4.46% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.47% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.47% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 3.47% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 3.47% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 3.47% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 2.97% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.97% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.48% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 1.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 1.49% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.99% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.99% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.99% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.99% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.99% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.50% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.50% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.50% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.50% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.50% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.50% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.50% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.50% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.50% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.50% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000550 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU amended with acetate total DNA F2.4 TB clc assemly | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001867 | Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705) | Environmental | Open in IMG/M |
| 3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
| 3300002911 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm | Environmental | Open in IMG/M |
| 3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005454 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
| 3300005569 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_154 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
| 3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
| 3300009521 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
| 3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009760 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100 | Environmental | Open in IMG/M |
| 3300009792 | Tropical forest soil microbial communities from Panama - MetaG Plot_12 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
| 3300012205 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaG | Environmental | Open in IMG/M |
| 3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
| 3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
| 3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014199 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaG | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
| 3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
| 3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
| 3300018017 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40 | Environmental | Open in IMG/M |
| 3300018030 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
| 3300018040 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300019275 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020002 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1 | Environmental | Open in IMG/M |
| 3300020018 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2s2 | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Host-Associated | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022731 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU4 | Environmental | Open in IMG/M |
| 3300024295 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 1-5 | Environmental | Open in IMG/M |
| 3300025444 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025500 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
| 3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
| 3300026552 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 (SPAdes) | Environmental | Open in IMG/M |
| 3300027174 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF040 (SPAdes) | Environmental | Open in IMG/M |
| 3300027521 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027576 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027846 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028020 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE4 | Environmental | Open in IMG/M |
| 3300028777 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N1_3 | Environmental | Open in IMG/M |
| 3300028779 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2 | Environmental | Open in IMG/M |
| 3300028785 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2 | Environmental | Open in IMG/M |
| 3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
| 3300029955 | II_Bog_E2 coassembly | Environmental | Open in IMG/M |
| 3300029989 | III_Fen_N1 coassembly | Environmental | Open in IMG/M |
| 3300029992 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_3 | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030042 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E1_1 | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030518 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N2_2 | Environmental | Open in IMG/M |
| 3300030519 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E3_3 | Environmental | Open in IMG/M |
| 3300030618 | II_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Host-Associated | Open in IMG/M |
| 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Host-Associated | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
| 3300032805 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.2 | Environmental | Open in IMG/M |
| 3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
| 3300032954 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033486 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_A | Environmental | Open in IMG/M |
| 3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
| 3300033826 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 1-5 | Environmental | Open in IMG/M |
| 3300033982 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fraction | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| INPhiseqgaiiFebDRAFT_1040329892 | 3300000364 | Soil | TPRQMDSDHRSFYAEEDGVIHADDQKAADQTSPKIK* |
| F24TB_139844561 | 3300000550 | Soil | GYVLTMTPKNLDAEHRSFYADEDGVIRGDETKAADASSPKVK* |
| JGI12636J13339_10508942 | 3300001154 | Forest Soil | DRPDHDGFVLTMTPKQMDTEHRSFYAEEDGAIHADDQKAADMDSPKVK* |
| JGI12627J18819_100187494 | 3300001867 | Forest Soil | LMMTPKNLDAQHRSFYAEEDGVIHADDTKAADASSPKLK* |
| JGI25383J37093_101377622 | 3300002560 | Grasslands Soil | QLALTPKQMDATHRSFYADEDGVIHADEEKAANENSPTVK* |
| JGI25390J43892_100883282 | 3300002911 | Grasslands Soil | YTVSFRTNKDGYVLVMTPKQLDSEHRSFYAEEDNIIHADDQKAADASSPRVK* |
| Ga0066677_102490631 | 3300005171 | Soil | GFRTHKDGFILVVTPKQMDAEHRSFYAEEDSIIHGDDQKPADASSPRVK* |
| Ga0066680_107659021 | 3300005174 | Soil | GKKDNYVLTMTPKNVDAEHRSFYADEDGVIHADETKAADASSPKVK* |
| Ga0070714_1017068602 | 3300005435 | Agricultural Soil | NDDDGFVLTMTPKQMDAEHRSFYSEEDGVIHADDQKPADQDSPKVK* |
| Ga0070713_1017896891 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | ILTMTPKQLDAEHRSFYAEEDGVMHADDTKPADESSPKIK* |
| Ga0070710_103002261 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | KDSYVLMMTPKNVDADHRSFYADEDGVIHGDETKAADASSPKVK* |
| Ga0066687_100558091 | 3300005454 | Soil | HKDGFVLVMTPKQMDAEHRSFYAEEDSIIHGDDQKPADASSPRVK* |
| Ga0066687_103619621 | 3300005454 | Soil | VSFRTNKDGYVLVMTPKQLDSEHRSFYAEEDNIIHADDQKAADASSPRVK* |
| Ga0070731_100799771 | 3300005538 | Surface Soil | LTMTPKQMDADHRSFYAKDDGIIHADETKAADENSPKIK* |
| Ga0070732_100931813 | 3300005542 | Surface Soil | TMTPKNVDAEHRSFYADEDGVIHADETKAADASSPKVK* |
| Ga0066703_108234012 | 3300005568 | Soil | VMTPKQMDAEHRSFYAEEDSIIHGDEQKPADASSPRVK* |
| Ga0066705_102928963 | 3300005569 | Soil | DSYTLTMTPKNLDPEHRSFYADEDGVIHGDETKAADASSPKVK* |
| Ga0070762_101096972 | 3300005602 | Soil | FVLTMTPKQMDSEHRSFYAEDDMVIHGDDQKAADEDSPKVK* |
| Ga0066903_1058627381 | 3300005764 | Tropical Forest Soil | AMTPKNLDAQHRSFYAEEDGIIHADEEKAATENSPKVK* |
| Ga0066903_1089844611 | 3300005764 | Tropical Forest Soil | LALTPKQLDPEHRSFYAKEDGVIHADEEKAASESSPRVK* |
| Ga0066790_101518411 | 3300005995 | Soil | GPNHDGFVLSMTPKQMDSEHRSFYAEDDGAIHADDQKAADLDSPKVK* |
| Ga0066790_104941382 | 3300005995 | Soil | DGFVLTMTPKQMDSERRSFYAEEDGVIHGDDSKVADMDSPKVK* |
| Ga0066652_1020588251 | 3300006046 | Soil | DYMVGFKSQKDGFILTMTPKQMDSEHRSFYAEEDGVIHGDDQKPADQSSPKVK* |
| Ga0075029_1000064411 | 3300006052 | Watersheds | FRSHKDGFVLTMTPKQLDADHRSFYAEDDGVIHGDDQKPADEDSPKVK* |
| Ga0075017_1002661543 | 3300006059 | Watersheds | TPKNLDAEHRSFYAEEDGVIHADETKPADASSPKVK* |
| Ga0075017_1009797882 | 3300006059 | Watersheds | TMTPKQLDQEHRSFYAEEDGVIHADDQKAADPSSPKIK* |
| Ga0075015_1001186561 | 3300006102 | Watersheds | NHDGFVLTMTPKQLDSEHRSFYAEEDGAIHADDQKPADRDSPKVR* |
| Ga0075030_1008699991 | 3300006162 | Watersheds | VSFKSHHDGFVLTMTPKQLDAEHRSFYAEEDGAIHADDQKAADLASPKIK* |
| Ga0079222_125129741 | 3300006755 | Agricultural Soil | MTPKNMDATHRSFYADEDSVIHADEEKPASPDSPKVK* |
| Ga0073928_111402502 | 3300006893 | Iron-Sulfur Acid Spring | SPKQVDAEHRSFYANEDAVMHADEQKAADENSPTVK* |
| Ga0099793_100276792 | 3300007258 | Vadose Zone Soil | DGFVLTMTPKQMDSEHRSFYAEEDGVIHGDDQKAADMDSPKVK* |
| Ga0099795_104979091 | 3300007788 | Vadose Zone Soil | FVLTMTPKQMDSEHRSFYAEEDGVIHGDDQKAADANSPKVK* |
| Ga0099829_101457571 | 3300009038 | Vadose Zone Soil | KQMDSEHRSFYAEEDGAIHGDDQKPADLESPRVK* |
| Ga0099829_103372981 | 3300009038 | Vadose Zone Soil | PNHDGFVLTMTPKQMDSEHRSFYAEEDGAIHGDDQKAADLDSPKVK* |
| Ga0099829_115760122 | 3300009038 | Vadose Zone Soil | TPKQMDATHRSFYADEDGVIHADEEKAANENSPTVK* |
| Ga0099828_104247831 | 3300009089 | Vadose Zone Soil | TMTPKQMDAQHRSFYADEDGVIHANEEGPADEKSPVVK* |
| Ga0099828_105772501 | 3300009089 | Vadose Zone Soil | MTPKQMDSEHRSFYAEEDGAIHGDDQKAADLDSPKVK* |
| Ga0099827_102458833 | 3300009090 | Vadose Zone Soil | DYTVGFRPRKDGFILMMTPKQLDSEHRSFYAEEDGIIHGDDQKAADANSRRVK* |
| Ga0116128_11960162 | 3300009518 | Peatland | MTPKQMDSEHRSFYAEEDGVIHADDQKPADVDSPKVQ* |
| Ga0116222_13834341 | 3300009521 | Peatlands Soil | TMTPKQMDSEHRSFYAEEDGAIHADDQKAADLDSPKIH* |
| Ga0116218_10844471 | 3300009522 | Peatlands Soil | PHKDGFVLTMTPKQMDGEHRSFYAEEDGVIHADDQKSADLDSPKVQ* |
| Ga0116138_11202031 | 3300009552 | Peatland | TMTPKQLDSEHRSFYAEEDGAIHADDQKAADLDSPKVR* |
| Ga0116114_10964181 | 3300009630 | Peatland | TPKQMDSEHRSFYAEEDGVIHADEQKPADLDSPKVQ* |
| Ga0116126_10779821 | 3300009640 | Peatland | KQMDSEHRSFYAEEDGVIHADDQKPADVDSPKVQ* |
| Ga0116135_10246004 | 3300009665 | Peatland | QHLDAEHRSFYAEDDGKIHADEEKPADENSPVVK* |
| Ga0116131_10880692 | 3300009760 | Peatland | PKQMDSEHRSFYAEEDGAIHADDQKPADMDSPKVQ* |
| Ga0126374_102986491 | 3300009792 | Tropical Forest Soil | KKDSYVLTMTPKNIDAEHRSFYADEDGIIHGDETKAADASSPKVK* |
| Ga0126373_102933494 | 3300010048 | Tropical Forest Soil | ELALTPKQLDPEHRSFYAKEDGVIHADEEKAASESSPRVK* |
| Ga0099796_103136052 | 3300010159 | Vadose Zone Soil | DRPNHDDFVLTMTPKQMDSEHRSFYAEEDGVIHGDDQKAADIDSPRVK* |
| Ga0074045_106320452 | 3300010341 | Bog Forest Soil | TLTPKHLDSEHRSFYAEEDGVIHADDQKAADRDSPKVR* |
| Ga0126370_114926142 | 3300010358 | Tropical Forest Soil | TIGFRSHKDGYILTATPKQMDDNHRSFYAEEDGIIHADDQKAADSNSPRLK* |
| Ga0134125_111955341 | 3300010371 | Terrestrial Soil | KQVDAEHRSFYAEEDGVIHAEEDKAADSNSPKLK* |
| Ga0126381_1018489972 | 3300010376 | Tropical Forest Soil | KKDGYVLIMTPKNLDADHRSFYTGEDGAIRADDTKAADASSPKLK* |
| Ga0126381_1044423141 | 3300010376 | Tropical Forest Soil | MTPKQMDAEHRSFYAEEDGVIHGDDQKAADASSAKVR* |
| Ga0136449_1007188161 | 3300010379 | Peatlands Soil | KDGFVLTMTPKQMDSEHRSFYAEEDGVIHADDQKPADLDSPKVQ* |
| Ga0136449_1009886661 | 3300010379 | Peatlands Soil | HKDGFVLTMTPKQMDSEHRSFYAEDDGVIHADDQKPADMESPKVQ* |
| Ga0136449_1018170932 | 3300010379 | Peatlands Soil | PHHDGFVLTMTPKQMDSEHRSFYAEEDGVIHADDQKPADVDSPKVQ* |
| Ga0105246_124923621 | 3300011119 | Miscanthus Rhizosphere | QRGDYSIGFRSQKEGYMLTATPKQVDPEHRSFYAEEDGVIHADEEKAADSNSPSIK* |
| Ga0137391_109914001 | 3300011270 | Vadose Zone Soil | MTPKQMDSEHRSFYAEEDGAIHGDDQKPADLESPRVK* |
| Ga0137393_101925792 | 3300011271 | Vadose Zone Soil | HKDGFVLTMTPKQMDSEHRSFYAEEDGAIHGDDQKPADLDSPKVK* |
| Ga0137399_104677521 | 3300012203 | Vadose Zone Soil | TLTMGPKNLDAAHRSFYAEEDGVIHGDDTKAADSSSPKVK* |
| Ga0137362_103813042 | 3300012205 | Vadose Zone Soil | KNVDAEHRSFYADEDGVIHADETKAADASSPKVK* |
| Ga0137376_111453681 | 3300012208 | Vadose Zone Soil | LAMTPKQMDAQHRSFYSDEDGVIHASEEGPADEKSAVVK* |
| Ga0137387_104056351 | 3300012349 | Vadose Zone Soil | FRSQKDGFILAMTPKQMDSEHRSFYAEEDGAIHADDQKAADQNSPRIK* |
| Ga0137397_100626981 | 3300012685 | Vadose Zone Soil | LSQKDGFILTMTPKQVDSEHRSFYAEEDGIIHADDQKAADQSSPRIK* |
| Ga0137396_105001211 | 3300012918 | Vadose Zone Soil | KDGYVLVMTPKQLDSEHRSFYAEEDNIIHADDQKAADASSPRVK* |
| Ga0137359_100315701 | 3300012923 | Vadose Zone Soil | QKDGFILAMTPKQMDSEHRSFYAEEDGAIHADDQKAADQNSPRIK* |
| Ga0137407_103297612 | 3300012930 | Vadose Zone Soil | LAMTPKQMDSEHRSFYAEEDGAIHADDQKAADQNSPRIK* |
| Ga0137410_116483461 | 3300012944 | Vadose Zone Soil | PKQLDSTHRSFYADEDGVIHAEEDKAASETSPTVK* |
| Ga0137410_119571642 | 3300012944 | Vadose Zone Soil | FILTMTPKQMDSEHRSFYAEEDGVIHGDDQKPADQSSPKVK* |
| Ga0126369_125811891 | 3300012971 | Tropical Forest Soil | KNLDAQHRSFYAEEDGIIHADEEKAATENSPKVK* |
| Ga0181533_13343261 | 3300014152 | Bog | MTPKQMDSEHRSFYAEENGVIHADDQKPADLDSPKVQ* |
| Ga0181538_103375822 | 3300014162 | Bog | YTASFRSHHDGFVLTMTPKQMDSEHRSFYAEEDGAIHADDQKPADMDSPKVQ* |
| Ga0181538_106190842 | 3300014162 | Bog | LTLTPKHLDDEHRSFYAEEDGAIHADDQKAADLDSPKVR* |
| Ga0181531_103292931 | 3300014169 | Bog | SDTEGFVLTMTPKKLDGEHRSFYAEDDGVIHADDQKAADAESPKLR* |
| Ga0181535_101135061 | 3300014199 | Bog | KQMDSEHRSFYAEDDGVIHAEDQKPADLDSPKVQ* |
| Ga0182021_135980882 | 3300014502 | Fen | ASFRTHKDGFVLTMTPKLMDREHRSFYAEEDGVIHGDDQKPADEDSPKVK* |
| Ga0132257_1004281311 | 3300015373 | Arabidopsis Rhizosphere | IMTPKNMDATHRSFYADEDGVIHADEEKPASPDSPKVK* |
| Ga0181505_106357881 | 3300016750 | Peatland | HHAGPNHDGFVLTMTPKQLDSEHRSFYAEEDGAIHADDQKAADLDSPKVR |
| Ga0187802_100103001 | 3300017822 | Freshwater Sediment | TPKQMDSEHRSFYAEDDGAIHADDQKAADLDSPKVR |
| Ga0187856_13369541 | 3300017925 | Peatland | MTPKQMDSEHRSFYAEENGVIHADDQKPADLDSPKVQ |
| Ga0187854_103025242 | 3300017938 | Peatland | FVLAMTPKQLDSEHRSFYAEDDGAIHADDQKAADLNSPKVR |
| Ga0187854_103752162 | 3300017938 | Peatland | FRPHKDGFVLTMTPKQMDSEHRSFYAEDDGVIHADDQKPADLESPKVQ |
| Ga0187819_100791043 | 3300017943 | Freshwater Sediment | FRPHKDGFVLTMTPKQMDSEHRSLYAEEDGVIHADDQKPADLDSPKVQ |
| Ga0187879_101468152 | 3300017946 | Peatland | GFVLTLTPKHLDSEHRSFYAEEDGGIHADDQKPADMDSPKVR |
| Ga0187879_102101891 | 3300017946 | Peatland | MLTMTPKQLDAEHRSFYAEDDGAIHADDQKPADLDSPKVK |
| Ga0187817_100248311 | 3300017955 | Freshwater Sediment | HKDGFVLTMTPKQMDSEHRSFYAEEDGVIHADDQKPADLDSPKVQ |
| Ga0187817_104379381 | 3300017955 | Freshwater Sediment | DGYELALTPKQLDADHRSFFANEDGVIHADDQKAADENSPKIK |
| Ga0187817_108367151 | 3300017955 | Freshwater Sediment | DGFVLTMTPKQMDSEHRSFYAEDDGAIHADDQKPADLDSPRVK |
| Ga0187817_111425012 | 3300017955 | Freshwater Sediment | YTVGFRPHKDGFVLTMTPKQMDSEHRSFYAEEDGVIHADDQKPADLDSPKVQ |
| Ga0187778_102027431 | 3300017961 | Tropical Peatland | PKQQDPDHRSFYANEDGVIHADDTKAADENSPKLK |
| Ga0187778_108251641 | 3300017961 | Tropical Peatland | LMLNPKLQVGPEHRSFYAKDDGVIHADETKTADADSPKVK |
| Ga0187782_102145602 | 3300017975 | Tropical Peatland | MTPKQMDADHRSFYANEKGAIHGDDQKTATEDSPVLKR |
| Ga0181520_101087533 | 3300017988 | Bog | GGDKEGFILTMTPKQLGADHRSFYAEEDGVIHGDDQKAADADSPKVK |
| Ga0187876_10946032 | 3300018003 | Peatland | TMTPKQMDSEHRSFYAEEDGVIHADDQKPADVDSPKVQ |
| Ga0187804_102151101 | 3300018006 | Freshwater Sediment | PKQMDSEHRSFYAEDDGVIHGDDQKPADSDSPKVR |
| Ga0187866_12567052 | 3300018015 | Peatland | FTLTPKQMDSEHRSFYAEEDGAIHADDQKAADLSSPKIR |
| Ga0187872_100698081 | 3300018017 | Peatland | MTPKQMDSEHRSFYAEEDGVIHADDQKPADVDSPKVQ |
| Ga0187869_104952721 | 3300018030 | Peatland | MTPKQMDSEHRSFYAEDDGAIHADDQKAADLDSPKVK |
| Ga0187867_101242843 | 3300018033 | Peatland | TPKQLDAEHRAFYANEDGVMHADETKAADENSPAVK |
| Ga0187867_103473711 | 3300018033 | Peatland | PDHEGFVLTLTPKHLDSEHRSFYAEEDGAIHADDQKPADLDSPKVR |
| Ga0187863_103168792 | 3300018034 | Peatland | PHRDTHNRDSHAGDHDGFVLTMTPKQLDNEHRSFYAEDDGVIHADDSKPADQDSPKVK |
| Ga0187875_100101691 | 3300018035 | Peatland | RHEGPDHEGFVLTLTPKHLDSEHRSFYAEEDGAIHADDQKPADLDSPKVR |
| Ga0187862_104176382 | 3300018040 | Peatland | FRPHKDGFVLTMTPKQMDSEHRSFYAEEDGVIHADERKTADLDSPKVQ |
| Ga0187862_105153912 | 3300018040 | Peatland | FRPHKDGFVLTMTPKQMDSEHRSFYAEEDGVIHADEQKPADLDSPKVQ |
| Ga0187851_108532901 | 3300018046 | Peatland | RRESPDREQFALTMTPKHLDSSHRSFFAEEDGAIHADDQKPASLDSPKVR |
| Ga0187859_100679722 | 3300018047 | Peatland | DSHAGDHDGFVLTMTPKQLDNEHRSFYAEDDGVIHADDSKPADQDSPKVK |
| Ga0187859_102996551 | 3300018047 | Peatland | HDGFVFTMTPQHMDSEHRSFYAEDDGVIHADDQKAADLDSPKVR |
| Ga0187784_105133271 | 3300018062 | Tropical Peatland | EKGKDEEGFILTMTPKQMDADHRSFYAEEDGVIHADDQKAADADSPKIH |
| Ga0187772_108216201 | 3300018085 | Tropical Peatland | PRQQDAEHRSFYANEDGAIHADEAKTADEDSPKVK |
| Ga0187772_109647242 | 3300018085 | Tropical Peatland | KQLDADHRSFYANEKGAIHGDDQKAATEDSPVIKK |
| Ga0187772_114939602 | 3300018085 | Tropical Peatland | YTVSFRPRKDGFVLTMTPKQMDAEHRSFYAEEDGVIHADDQKPADLDSPKVQ |
| Ga0187769_100495541 | 3300018086 | Tropical Peatland | KDGFELTMTPKQMDADHRSFYANEKGAIHGDDQKTATEDSPVLKR |
| Ga0187771_112704902 | 3300018088 | Tropical Peatland | FILTLTPKQMDTEHRSFYAEDDGAIHADDQKAADLDSPKIK |
| Ga0187798_14894671 | 3300019275 | Peatland | PHKENDKEGFILTLTPKQLDAEHRSFYAEDDGAIHADDQKAADLDSPKIK |
| Ga0182031_11029013 | 3300019787 | Bog | MTPKQLDNEHRSFYAEEDGAIHADEQKAADLDSPKVK |
| Ga0182031_14608033 | 3300019787 | Bog | VLTMTPKQLDNEHRSFYAEEDGAIHADEQKAADLDSPKVK |
| Ga0193730_10209091 | 3300020002 | Soil | LTPKQMDSAHRSFYADEDGVIHAEEDKAASDTSPTVK |
| Ga0193721_10112385 | 3300020018 | Soil | RPNKDGFDLTMTPKQLDTEHRSFYAAEDGVIRGDDQGPANEKSPVVK |
| Ga0210407_109072252 | 3300020579 | Soil | TPKNLDAEHRSFYAEEDGVIHADETKPAEASSPKVK |
| Ga0210401_102145451 | 3300020583 | Soil | TPNHLDAEHRSFYAEDDGKIHADEEKPADASSPIVK |
| Ga0210404_105774971 | 3300021088 | Soil | YFLTMTPKNVDAEHRSFYADEDGVIHGDETKAADASSPKVK |
| Ga0210406_106650692 | 3300021168 | Soil | FVLTMTPKNMDAEHRSFYAEEDGVIHGDDQKAADLESPKVK |
| Ga0210406_108091581 | 3300021168 | Soil | ASFRPNHDRPNHDGFVLTMTPKQMDSEHRSFYAEEDGVIHGDDQKAADLDSPRVK |
| Ga0210400_105799111 | 3300021170 | Soil | GFVLTLTPKHLDNEHRSFYAEEDGGIHADDQKAADMDSPKIR |
| Ga0213874_103074131 | 3300021377 | Plant Roots | MTPKNLDAQHRSFYAEEDGVIRADETKAADASSPKLK |
| Ga0210385_105931392 | 3300021402 | Soil | DSYILTMTPKQLDAEHRSFYAEDDGKIHADEEKPADAKSPVVK |
| Ga0210387_103974751 | 3300021405 | Soil | PHKDGFDLLLTPKQIGPDHRSFYAGEDGVIHGDAEKPATANSPPLK |
| Ga0210383_101317761 | 3300021407 | Soil | KDSYVLTLTPRNLDAEHRSFYAEDDGKIHADETKAADADSPFLK |
| Ga0210394_102103534 | 3300021420 | Soil | LMPKHQDPEHRSFWAKEDGVIRGDEEKAADENSPKVK |
| Ga0210394_109228551 | 3300021420 | Soil | PKQLDADHRSFYSTEDGVIHADDQKAADAKSPVVK |
| Ga0210391_108128781 | 3300021433 | Soil | PKQLDAEHRSFYAEDDGKIHADEEKPADAKSPVVK |
| Ga0210409_103389631 | 3300021559 | Soil | PKQEDAEHRSFYADEDGIIHGDEQKAADENSPVVK |
| Ga0126371_105813971 | 3300021560 | Tropical Forest Soil | VLTMTPKTIDPEHRSFYADEDGIIHGDEAKAADSSSPKVK |
| Ga0213851_12719201 | 3300021860 | Watersheds | TMTPKHMDAEHRSFYAEEDGVIHGDDQKAADAESPKVK |
| Ga0224563_10219181 | 3300022731 | Soil | AHKDGFVLTMTPNHMDNEHRSFYAEDDLIIHADDQKAADIDSPKVK |
| Ga0224556_10962811 | 3300024295 | Soil | DGYELSLTPKQLDADHRSFYATDDGIIHGDDQKAADENSPKVK |
| Ga0208189_10189343 | 3300025444 | Peatland | GPDHDGFVFTLTPKQMDSEHRSFYAEEDGAIHADDQKAADLSSPKIR |
| Ga0208686_10385041 | 3300025500 | Peatland | TMTPKQLDSEHRSLYAEEDGAIHADDQKPADLDSPKVQ |
| Ga0208686_11012231 | 3300025500 | Peatland | GFQTHHDGFALTMTPKQMDSEHRSFYAEENGVIHADDQKPADLDSPKVQ |
| Ga0207693_101025083 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | KGKKDNYVLTMTPKNVDAEHRSFYADEDGVIHADETKAADASSPKVK |
| Ga0207664_119852952 | 3300025929 | Agricultural Soil | KKDNYVLTMTPKNVDAEHRSFYADEDGVIHADETKAADASSPKVK |
| Ga0207641_110408642 | 3300026088 | Switchgrass Rhizosphere | RSQKDGYMLTATPKQVDPEHRSFYAEEDGVIHADEEKAADQNSPRIK |
| Ga0209839_101752202 | 3300026294 | Soil | FRPHHDGFVLTMTPKQLDAEHRSFYAEDDGAIHADDQKAADLESPKIH |
| Ga0209687_11765421 | 3300026322 | Soil | NKDGYVLVMTPKQLDSEHRSFYAEEDNIIHADDQKAADASSPRVK |
| Ga0209152_104504982 | 3300026325 | Soil | GFVLTMTPKQMDADHRSFYAEEDGVIHGDDQKAADLDSPKVK |
| Ga0209158_10308151 | 3300026333 | Soil | TNKDGYVLVMTPKQLDSEHRSFYAEEDNIIHADDQKAADASSPRVK |
| Ga0209056_103882121 | 3300026538 | Soil | YTVSFRTNKDGYVLVMTPKQLDSEHRSFYAEEDNIIHADDQKAADASSPRVK |
| Ga0209577_104005912 | 3300026552 | Soil | PNRDGFVLTMTPKQMDSEHRSFYAEEDGVIHGDDQKAADLDSPKVK |
| Ga0207948_10325072 | 3300027174 | Forest Soil | GFKGKKDNYVLTMTPKNVDAEHRSFYADEDGVIHADEAKAADENSPSVK |
| Ga0209524_10156422 | 3300027521 | Forest Soil | DRPNHDGFVLTMTPKQMDSEHRSFYAEEDGVIHGDDQKAADLDSPKVK |
| Ga0209003_10135601 | 3300027576 | Forest Soil | MTPKNVDAEHRSFYAEEDGVIHGDETKAADASSPKVK |
| Ga0209248_101260592 | 3300027729 | Bog Forest Soil | QDGFIFTMTPTHMDSEHRSFYAEDDMVIHADDQKAADLSSPKVK |
| Ga0209248_101714872 | 3300027729 | Bog Forest Soil | SYKPHKDGFVFTMTPKQMDSEHRSFYAEDDMVMHADDQKAADLESPKVK |
| Ga0209180_104382061 | 3300027846 | Vadose Zone Soil | FILMMTPKQLDSEHRSFYAEEDGIIHGDDQKAADANSRRVK |
| Ga0209579_106595452 | 3300027869 | Surface Soil | LTMTPKQMDADHRSFYAKDDGIIHADETKAADENSPKIK |
| Ga0209488_109129611 | 3300027903 | Vadose Zone Soil | KDGFILIMTPKQMDSEHRSFYAEEDGVIHGDDQKAADANSPKVK |
| Ga0265351_10254012 | 3300028020 | Soil | PHQMDGEHRSFYAEDDMIIHADDQKAADGDSPKVK |
| Ga0302290_100061131 | 3300028777 | Fen | VGFRTNKDGFILAMTPKQMDTEHRSFYAEEDGVIHADDQKAADLNSPKVK |
| Ga0302266_101025753 | 3300028779 | Bog | HHDGFVLTMTPNKMDSEHRSFYAEDDGVIHADDEKAADADSPKIH |
| Ga0302201_101245691 | 3300028785 | Bog | YTASFRSHHDGFVLTMTPNKMDSEHRSFYAEDDGVIHADDEKAADADSPKIH |
| Ga0311346_103866133 | 3300029952 | Bog | TPNKMDSEHRSFYAEDDGVIHADDQKAADAESPKVR |
| Ga0311342_101129171 | 3300029955 | Bog | VLTMTPNKMDSEHRSFYAEDDGVIHADDEKAADADSPKIH |
| Ga0311365_107085602 | 3300029989 | Fen | KDGFVFTMTPKQMDADHRSFYAEDDGIIHGDDQKPADLSSPKVK |
| Ga0302276_104732941 | 3300029992 | Bog | LTPKHLDAEHRSFYAEDDGKIHADEEKPADASSPVVK |
| Ga0311339_100938862 | 3300029999 | Palsa | MTPKHLDSEHRSFYAEDDAVIHADDQKAADEDSPKVK |
| Ga0302300_11278331 | 3300030042 | Palsa | FILTMTPQHLDAEHRSFYAEDDGKIHADEEKPADASSPVVK |
| Ga0311370_100485156 | 3300030503 | Palsa | YTVSFRVHKDGYVLTMTPKHMDSEHRSFYAEDDGVIHADDQKPADEDSPKLTA |
| Ga0302275_103232601 | 3300030518 | Bog | TPKHLDAEHRSFYAEDDGKIHADEEKPADASSPVVK |
| Ga0302193_102738811 | 3300030519 | Bog | LTMTPNKMDSEHRSFYAEDDGVIHADDEKAADADSPKIH |
| Ga0311354_105931483 | 3300030618 | Palsa | KGEKDKFVLTMTPQHLDSEHRSFYAEDDGKIHADENKPADADSPVVK |
| Ga0310039_101908701 | 3300030706 | Peatlands Soil | YTVSFRPHKDGFVLTMTPKQMDSEHRSFYAEEDGVIHADDQKPADLDSPKVQ |
| Ga0302180_103183431 | 3300031028 | Palsa | DVHDHDLNHEGFVLTMTPKHLDSEHRSLYAEDDGVIHADDQKPADPDSPKVK |
| Ga0302323_1012887062 | 3300031232 | Fen | PKQLAADRRSFYAEDDGAIHADELKAADLSSPKIK |
| Ga0302307_102280921 | 3300031233 | Palsa | HKDGYVLTMTPKHMDSEHRSFYAEDDGVIHADDQKPADEDSPKLTA |
| Ga0302324_1012438132 | 3300031236 | Palsa | LTMTPKHLDSEHRSFYAEDDAVIHADDQKAADEDSPKVK |
| Ga0265328_100206731 | 3300031239 | Rhizosphere | TPKQLDAEHRSFYAEDDGVIHGDDQKAADLESPKVK |
| Ga0265340_101451161 | 3300031247 | Rhizosphere | RAHKDGFVLTMTPKHMDSEHRSFYAEDNGVIHADDQKAADLDSPKVQ |
| Ga0265340_104138542 | 3300031247 | Rhizosphere | HQDGFVLTLTPKHMDSEHRSFYAEDDGVIHADDSKAADADSPRVK |
| Ga0307476_101707391 | 3300031715 | Hardwood Forest Soil | FVFTMTPNHMDSEHRSFYAEEDGVIHADDQKPADMSSPKIR |
| Ga0307474_107728252 | 3300031718 | Hardwood Forest Soil | MTPKNLDGQHRSFYAEDDGVIHADDAKAADASSPKLK |
| Ga0307469_105519431 | 3300031720 | Hardwood Forest Soil | KPNKDGFDLTMTPKQMDAEHRSFYAAEDGVIHGDDQEPANEKSPVVK |
| Ga0318501_108691432 | 3300031736 | Soil | YELTLTPKQQDPDHRSFYANEDGVIHADDTKAADENSPKLK |
| Ga0307468_1020021052 | 3300031740 | Hardwood Forest Soil | HKDGFDLLLTPKQIAPDHRSFYAKEDGVIHGDEAKTADENSPKVK |
| Ga0307478_103529272 | 3300031823 | Hardwood Forest Soil | DHDGFVLTMTPKQMDSEHRSFYAEEDGAIHGDDQKAADKDSPKVK |
| Ga0306925_106736753 | 3300031890 | Soil | YQVGFKTHKEGYILTLTPKQLDAEHRSFYAEEDGVMHGDETKAADASSPKVK |
| Ga0306925_114370031 | 3300031890 | Soil | EYHVGFKGKKDGYVLILTPKQMDAQHRSFYAEEDGVIRADEEKPASPESPKVK |
| Ga0310913_108446941 | 3300031945 | Soil | PDGYELTLTPKQQDPDHRSFYANEDGVIHADDTKAADENSPKLK |
| Ga0306922_100107591 | 3300032001 | Soil | KGKKDGYVLILTPKQMDAQHRSFYAEEDGVIRADEEKPASPESPKVK |
| Ga0306922_106260511 | 3300032001 | Soil | GYILTLTPKQLDAEHRSFYAEEDGVMHGDETKAADASSPKVK |
| Ga0318569_105729331 | 3300032010 | Soil | GFKGKKDGYVLILTPKQMDAQHRSFYAEEDGVIRADEEKPASPQSPKVK |
| Ga0307470_101375743 | 3300032174 | Hardwood Forest Soil | GKKDGYSLTMTPKNLDAQHRSFYAEEDGVIHGDEAKAADSSSPKVK |
| Ga0307471_1036098152 | 3300032180 | Hardwood Forest Soil | PKQMDSAHRSFYADEDGVIHAEEDKAASETSPTVK |
| Ga0335079_101393576 | 3300032783 | Soil | PKQAIAPDHRSFYATEDGVIHGDETKTADEDSPKVK |
| Ga0335078_116920182 | 3300032805 | Soil | SDEAGFVLTMTPKHMDADHRSFYAEEDGVIRGDDQKAADAESPKVR |
| Ga0335081_119602101 | 3300032892 | Soil | EGFVLTMTPKQLDAEHRSFYAEEDGVIHGDDQKAADADSPKVK |
| Ga0335083_111150212 | 3300032954 | Soil | AQVDAQHRSFYAEEDGKIHAEEDKAAGPDSPVVGKAYA |
| Ga0310810_108053822 | 3300033412 | Soil | TATPKQVDAEHRSFYAEEDGVIHAEEDKAADSNSPKLK |
| Ga0316624_121385781 | 3300033486 | Soil | PKQMDSEHRSFYAEDDGAIHADDQKAADLDSPKVR |
| Ga0371489_0095415_1590_1754 | 3300033755 | Peat Soil | SFRYRRESPNREQFALTMTPKHMDSEHRSFYAEDDGVIHADDSKAADMDSPKVQ |
| Ga0334847_001775_5_118 | 3300033826 | Soil | MTPKQMDSERRSFYAEEDGVIHGDDSKVADMDSPKVK |
| Ga0371487_0094740_2_109 | 3300033982 | Peat Soil | PKQLDADHRSFYAEDDGAIHADDQKAADAASPQIR |
| ⦗Top⦘ |