| Basic Information | |
|---|---|
| Family ID | F025234 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 202 |
| Average Sequence Length | 44 residues |
| Representative Sequence | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAALTSAAALQ |
| Number of Associated Samples | 141 |
| Number of Associated Scaffolds | 202 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 90.34 % |
| % of genes near scaffold ends (potentially truncated) | 11.39 % |
| % of genes from short scaffolds (< 2000 bps) | 46.04 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.52 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (56.436 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil (13.861 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.752 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (52.475 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 56.34% β-sheet: 0.00% Coil/Unstructured: 43.66% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.52 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 202 Family Scaffolds |
|---|---|---|
| PF05532 | CsbD | 18.81 |
| PF13502 | AsmA_2 | 14.36 |
| PF04972 | BON | 9.90 |
| PF00196 | GerE | 3.47 |
| PF00072 | Response_reg | 1.98 |
| PF14417 | MEDS | 1.98 |
| PF02922 | CBM_48 | 1.98 |
| PF07730 | HisKA_3 | 1.98 |
| PF11752 | DUF3309 | 1.49 |
| PF11821 | ActD | 0.99 |
| PF00563 | EAL | 0.99 |
| PF00924 | MS_channel | 0.99 |
| PF05974 | DUF892 | 0.50 |
| PF00528 | BPD_transp_1 | 0.50 |
| PF05227 | CHASE3 | 0.50 |
| PF10091 | Glycoamylase | 0.50 |
| PF03600 | CitMHS | 0.50 |
| PF12836 | HHH_3 | 0.50 |
| PF02518 | HATPase_c | 0.50 |
| PF02574 | S-methyl_trans | 0.50 |
| PF04366 | Ysc84 | 0.50 |
| PF03699 | UPF0182 | 0.50 |
| PF13524 | Glyco_trans_1_2 | 0.50 |
| PF13185 | GAF_2 | 0.50 |
| PF13517 | FG-GAP_3 | 0.50 |
| PF08450 | SGL | 0.50 |
| PF13714 | PEP_mutase | 0.50 |
| PF11154 | DUF2934 | 0.50 |
| PF00982 | Glyco_transf_20 | 0.50 |
| PF08545 | ACP_syn_III | 0.50 |
| PF02965 | Met_synt_B12 | 0.50 |
| PF13493 | DUF4118 | 0.50 |
| PF01523 | PmbA_TldD | 0.50 |
| PF00534 | Glycos_transf_1 | 0.50 |
| PF14698 | ASL_C2 | 0.50 |
| PF00149 | Metallophos | 0.50 |
| PF02358 | Trehalose_PPase | 0.50 |
| COG ID | Name | Functional Category | % Frequency in 202 Family Scaffolds |
|---|---|---|---|
| COG3237 | Uncharacterized conserved protein YjbJ, UPF0337 family | Function unknown [S] | 18.81 |
| COG4585 | Signal transduction histidine kinase ComP | Signal transduction mechanisms [T] | 1.98 |
| COG4564 | Signal transduction histidine kinase | Signal transduction mechanisms [T] | 1.98 |
| COG3851 | Signal transduction histidine kinase UhpB, glucose-6-phosphate specific | Signal transduction mechanisms [T] | 1.98 |
| COG3850 | Signal transduction histidine kinase NarQ, nitrate/nitrite-specific | Signal transduction mechanisms [T] | 1.98 |
| COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG5001 | Cyclic di-GMP metabolism protein, combines GGDEF and EAL domains with a 6TM membrane domain | Signal transduction mechanisms [T] | 0.99 |
| COG4943 | Redox-sensing c-di-GMP phosphodiesterase, contains CSS-motif and EAL domains | Signal transduction mechanisms [T] | 0.99 |
| COG3434 | c-di-GMP phosphodiesterase YuxH/PdeH, contains EAL and HDOD domains | Signal transduction mechanisms [T] | 0.99 |
| COG2200 | EAL domain, c-di-GMP-specific phosphodiesterase class I (or its enzymatically inactive variant) | Signal transduction mechanisms [T] | 0.99 |
| COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG2930 | Lipid-binding SYLF domain, Ysc84/FYVE family | Lipid transport and metabolism [I] | 0.50 |
| COG0312 | Zn-dependent protease PmbA/TldA or its inactivated homolog | General function prediction only [R] | 0.50 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.50 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.50 |
| COG2040 | Homocysteine/selenocysteine methylase (S-methylmethionine-dependent) | Amino acid transport and metabolism [E] | 0.50 |
| COG3685 | Ferritin-like metal-binding protein YciE | Inorganic ion transport and metabolism [P] | 0.50 |
| COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.50 |
| COG1615 | Uncharacterized membrane protein, UPF0182 family | Function unknown [S] | 0.50 |
| COG1410 | Methionine synthase I, cobalamin-binding domain | Amino acid transport and metabolism [E] | 0.50 |
| COG0646 | Methionine synthase I (cobalamin-dependent), methyltransferase domain | Amino acid transport and metabolism [E] | 0.50 |
| COG0380 | Trehalose-6-phosphate synthase, GT20 family | Carbohydrate transport and metabolism [G] | 0.50 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 56.44 % |
| Unclassified | root | N/A | 43.56 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001131|JGI12631J13338_1000295 | All Organisms → cellular organisms → Bacteria | 15748 | Open in IMG/M |
| 3300001137|JGI12637J13337_1001983 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
| 3300001137|JGI12637J13337_1003620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1285 | Open in IMG/M |
| 3300001154|JGI12636J13339_1002603 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3013 | Open in IMG/M |
| 3300001593|JGI12635J15846_10120528 | All Organisms → cellular organisms → Bacteria | 1853 | Open in IMG/M |
| 3300001593|JGI12635J15846_10273713 | All Organisms → cellular organisms → Bacteria | 1070 | Open in IMG/M |
| 3300001593|JGI12635J15846_10788485 | Not Available | 545 | Open in IMG/M |
| 3300001661|JGI12053J15887_10048860 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2368 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100220053 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1791 | Open in IMG/M |
| 3300002906|JGI25614J43888_10000151 | All Organisms → cellular organisms → Bacteria | 19516 | Open in IMG/M |
| 3300002917|JGI25616J43925_10059043 | All Organisms → cellular organisms → Bacteria | 1642 | Open in IMG/M |
| 3300002917|JGI25616J43925_10333883 | Not Available | 562 | Open in IMG/M |
| 3300004080|Ga0062385_10006513 | All Organisms → cellular organisms → Bacteria | 3723 | Open in IMG/M |
| 3300004082|Ga0062384_100670425 | All Organisms → cellular organisms → Bacteria | 711 | Open in IMG/M |
| 3300004092|Ga0062389_101379866 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 889 | Open in IMG/M |
| 3300004152|Ga0062386_100124411 | All Organisms → cellular organisms → Bacteria | 1997 | Open in IMG/M |
| 3300004152|Ga0062386_100159966 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300004152|Ga0062386_100877260 | Not Available | 741 | Open in IMG/M |
| 3300004635|Ga0062388_100337391 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1278 | Open in IMG/M |
| 3300005167|Ga0066672_10109334 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1696 | Open in IMG/M |
| 3300005174|Ga0066680_10082669 | All Organisms → cellular organisms → Bacteria | 1940 | Open in IMG/M |
| 3300005445|Ga0070708_100724260 | Not Available | 936 | Open in IMG/M |
| 3300005518|Ga0070699_100096260 | All Organisms → cellular organisms → Bacteria | 2592 | Open in IMG/M |
| 3300005538|Ga0070731_10003107 | All Organisms → cellular organisms → Bacteria | 15158 | Open in IMG/M |
| 3300005554|Ga0066661_10216594 | All Organisms → cellular organisms → Bacteria | 1187 | Open in IMG/M |
| 3300005557|Ga0066704_10921495 | Not Available | 540 | Open in IMG/M |
| 3300005586|Ga0066691_10216972 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
| 3300005591|Ga0070761_10000051 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 78842 | Open in IMG/M |
| 3300005591|Ga0070761_10006667 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6657 | Open in IMG/M |
| 3300005591|Ga0070761_10026703 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 3222 | Open in IMG/M |
| 3300005610|Ga0070763_10778329 | Not Available | 564 | Open in IMG/M |
| 3300006059|Ga0075017_100044647 | All Organisms → cellular organisms → Bacteria | 2961 | Open in IMG/M |
| 3300006162|Ga0075030_100480908 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 988 | Open in IMG/M |
| 3300006800|Ga0066660_10079510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2254 | Open in IMG/M |
| 3300006893|Ga0073928_10000989 | All Organisms → cellular organisms → Bacteria | 57989 | Open in IMG/M |
| 3300006893|Ga0073928_10310762 | All Organisms → cellular organisms → Bacteria | 1180 | Open in IMG/M |
| 3300006893|Ga0073928_10436652 | Not Available | 950 | Open in IMG/M |
| 3300006893|Ga0073928_10623877 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 759 | Open in IMG/M |
| 3300007258|Ga0099793_10119726 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1230 | Open in IMG/M |
| 3300007258|Ga0099793_10243138 | Not Available | 868 | Open in IMG/M |
| 3300009088|Ga0099830_11416476 | All Organisms → cellular organisms → Bacteria | 578 | Open in IMG/M |
| 3300009143|Ga0099792_10061874 | All Organisms → cellular organisms → Bacteria | 1860 | Open in IMG/M |
| 3300009143|Ga0099792_10117862 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1421 | Open in IMG/M |
| 3300009143|Ga0099792_11105276 | All Organisms → cellular organisms → Bacteria | 534 | Open in IMG/M |
| 3300009520|Ga0116214_1093630 | All Organisms → cellular organisms → Bacteria | 1103 | Open in IMG/M |
| 3300010343|Ga0074044_10198242 | All Organisms → cellular organisms → Bacteria | 1334 | Open in IMG/M |
| 3300010379|Ga0136449_100267407 | All Organisms → cellular organisms → Bacteria | 3155 | Open in IMG/M |
| 3300011120|Ga0150983_14971883 | Not Available | 509 | Open in IMG/M |
| 3300011269|Ga0137392_11549950 | Not Available | 521 | Open in IMG/M |
| 3300011270|Ga0137391_10413894 | All Organisms → cellular organisms → Bacteria | 1151 | Open in IMG/M |
| 3300011271|Ga0137393_10083951 | All Organisms → cellular organisms → Bacteria | 2568 | Open in IMG/M |
| 3300012202|Ga0137363_10112943 | All Organisms → cellular organisms → Bacteria | 2084 | Open in IMG/M |
| 3300012202|Ga0137363_10551547 | All Organisms → cellular organisms → Bacteria | 971 | Open in IMG/M |
| 3300012211|Ga0137377_10326666 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
| 3300012351|Ga0137386_10305372 | Not Available | 1145 | Open in IMG/M |
| 3300012363|Ga0137390_10634491 | All Organisms → cellular organisms → Bacteria | 1034 | Open in IMG/M |
| 3300012363|Ga0137390_10998657 | All Organisms → cellular organisms → Bacteria | 789 | Open in IMG/M |
| 3300012582|Ga0137358_10884420 | Not Available | 587 | Open in IMG/M |
| 3300012683|Ga0137398_10056786 | All Organisms → cellular organisms → Bacteria | 2341 | Open in IMG/M |
| 3300012685|Ga0137397_10152141 | All Organisms → cellular organisms → Bacteria | 1714 | Open in IMG/M |
| 3300012927|Ga0137416_10546645 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1003 | Open in IMG/M |
| 3300014164|Ga0181532_10005456 | All Organisms → cellular organisms → Bacteria | 10790 | Open in IMG/M |
| 3300014165|Ga0181523_10357033 | All Organisms → cellular organisms → Bacteria | 818 | Open in IMG/M |
| 3300014492|Ga0182013_10012398 | All Organisms → cellular organisms → Bacteria | 8599 | Open in IMG/M |
| 3300014501|Ga0182024_10000228 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 137393 | Open in IMG/M |
| 3300014502|Ga0182021_10162309 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2604 | Open in IMG/M |
| 3300017822|Ga0187802_10035006 | All Organisms → cellular organisms → Bacteria | 1798 | Open in IMG/M |
| 3300017823|Ga0187818_10070842 | Not Available | 1501 | Open in IMG/M |
| 3300017946|Ga0187879_10410466 | Not Available | 750 | Open in IMG/M |
| 3300017966|Ga0187776_11315333 | Not Available | 547 | Open in IMG/M |
| 3300018001|Ga0187815_10006096 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 5451 | Open in IMG/M |
| 3300018034|Ga0187863_10164848 | All Organisms → cellular organisms → Bacteria | 1236 | Open in IMG/M |
| 3300019887|Ga0193729_1009163 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4531 | Open in IMG/M |
| 3300019887|Ga0193729_1274275 | Not Available | 517 | Open in IMG/M |
| 3300019888|Ga0193751_1000239 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 48309 | Open in IMG/M |
| 3300019888|Ga0193751_1003407 | All Organisms → cellular organisms → Bacteria | 9353 | Open in IMG/M |
| 3300019888|Ga0193751_1005766 | All Organisms → cellular organisms → Bacteria | 6918 | Open in IMG/M |
| 3300020199|Ga0179592_10262456 | All Organisms → cellular organisms → Bacteria | 773 | Open in IMG/M |
| 3300020579|Ga0210407_10011022 | All Organisms → cellular organisms → Bacteria | 6734 | Open in IMG/M |
| 3300020579|Ga0210407_10104787 | All Organisms → cellular organisms → Bacteria | 2151 | Open in IMG/M |
| 3300020581|Ga0210399_10006531 | All Organisms → cellular organisms → Bacteria | 9104 | Open in IMG/M |
| 3300020581|Ga0210399_10021325 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 5131 | Open in IMG/M |
| 3300020581|Ga0210399_11413496 | Not Available | 543 | Open in IMG/M |
| 3300020583|Ga0210401_10906972 | Not Available | 740 | Open in IMG/M |
| 3300021168|Ga0210406_10010045 | All Organisms → cellular organisms → Bacteria | 9364 | Open in IMG/M |
| 3300021170|Ga0210400_10000157 | All Organisms → cellular organisms → Bacteria | 91264 | Open in IMG/M |
| 3300021171|Ga0210405_10095420 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2347 | Open in IMG/M |
| 3300022557|Ga0212123_10000471 | All Organisms → cellular organisms → Bacteria | 132141 | Open in IMG/M |
| 3300022557|Ga0212123_10003224 | All Organisms → cellular organisms → Bacteria | 34986 | Open in IMG/M |
| 3300022557|Ga0212123_10010183 | All Organisms → cellular organisms → Bacteria | 13379 | Open in IMG/M |
| 3300023056|Ga0233357_1049461 | Not Available | 543 | Open in IMG/M |
| 3300023259|Ga0224551_1001384 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4092 | Open in IMG/M |
| 3300024330|Ga0137417_1370893 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 724 | Open in IMG/M |
| 3300025910|Ga0207684_11438018 | Not Available | 563 | Open in IMG/M |
| 3300026304|Ga0209240_1008932 | All Organisms → cellular organisms → Bacteria | 3794 | Open in IMG/M |
| 3300026309|Ga0209055_1068419 | Not Available | 1487 | Open in IMG/M |
| 3300026309|Ga0209055_1093757 | All Organisms → cellular organisms → Bacteria | 1216 | Open in IMG/M |
| 3300026335|Ga0209804_1110723 | All Organisms → cellular organisms → Bacteria | 1254 | Open in IMG/M |
| 3300026551|Ga0209648_10215172 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1453 | Open in IMG/M |
| 3300026557|Ga0179587_10437022 | All Organisms → cellular organisms → Bacteria | 855 | Open in IMG/M |
| 3300027546|Ga0208984_1085426 | Not Available | 682 | Open in IMG/M |
| 3300027562|Ga0209735_1003432 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2838 | Open in IMG/M |
| 3300027570|Ga0208043_1168014 | Not Available | 565 | Open in IMG/M |
| 3300027591|Ga0209733_1022636 | All Organisms → cellular organisms → Bacteria | 1694 | Open in IMG/M |
| 3300027609|Ga0209221_1045279 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1169 | Open in IMG/M |
| 3300027643|Ga0209076_1035259 | All Organisms → cellular organisms → Bacteria | 1400 | Open in IMG/M |
| 3300027645|Ga0209117_1027403 | All Organisms → cellular organisms → Bacteria | 1800 | Open in IMG/M |
| 3300027645|Ga0209117_1160197 | Not Available | 584 | Open in IMG/M |
| 3300027674|Ga0209118_1008439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 3650 | Open in IMG/M |
| 3300027674|Ga0209118_1042677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1359 | Open in IMG/M |
| 3300027678|Ga0209011_1211435 | Not Available | 525 | Open in IMG/M |
| 3300027681|Ga0208991_1009556 | All Organisms → cellular organisms → Bacteria | 2895 | Open in IMG/M |
| 3300027812|Ga0209656_10223082 | All Organisms → cellular organisms → Bacteria | 903 | Open in IMG/M |
| 3300027825|Ga0209039_10186445 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
| 3300027869|Ga0209579_10000094 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 164006 | Open in IMG/M |
| 3300027882|Ga0209590_10363349 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 933 | Open in IMG/M |
| 3300027894|Ga0209068_10936374 | Not Available | 513 | Open in IMG/M |
| 3300027903|Ga0209488_10058446 | All Organisms → cellular organisms → Bacteria | 2846 | Open in IMG/M |
| 3300027903|Ga0209488_10086265 | All Organisms → cellular organisms → Bacteria | 2340 | Open in IMG/M |
| 3300027903|Ga0209488_10606890 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 793 | Open in IMG/M |
| 3300027911|Ga0209698_10418910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1045 | Open in IMG/M |
| 3300028047|Ga0209526_10211579 | All Organisms → cellular organisms → Bacteria | 1339 | Open in IMG/M |
| 3300028047|Ga0209526_10318588 | All Organisms → cellular organisms → Bacteria | 1049 | Open in IMG/M |
| 3300028776|Ga0302303_10074128 | All Organisms → cellular organisms → Bacteria | 1280 | Open in IMG/M |
| 3300030007|Ga0311338_10906654 | All Organisms → cellular organisms → Bacteria | 866 | Open in IMG/M |
| 3300031231|Ga0170824_107162104 | Not Available | 1264 | Open in IMG/M |
| 3300031234|Ga0302325_10157979 | All Organisms → cellular organisms → Bacteria | 4031 | Open in IMG/M |
| 3300031236|Ga0302324_100150953 | All Organisms → cellular organisms → Bacteria | 3808 | Open in IMG/M |
| 3300031715|Ga0307476_10581086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 831 | Open in IMG/M |
| 3300031718|Ga0307474_10026219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4258 | Open in IMG/M |
| 3300031720|Ga0307469_11011678 | Not Available | 777 | Open in IMG/M |
| 3300031753|Ga0307477_10000026 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 253079 | Open in IMG/M |
| 3300031754|Ga0307475_10033347 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3761 | Open in IMG/M |
| 3300031754|Ga0307475_10441765 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1045 | Open in IMG/M |
| 3300031754|Ga0307475_10528359 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 947 | Open in IMG/M |
| 3300031754|Ga0307475_10995604 | Not Available | 659 | Open in IMG/M |
| 3300031754|Ga0307475_11386603 | Not Available | 542 | Open in IMG/M |
| 3300031820|Ga0307473_10983056 | Not Available | 615 | Open in IMG/M |
| 3300031823|Ga0307478_10114744 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2103 | Open in IMG/M |
| 3300031962|Ga0307479_10388236 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300031962|Ga0307479_10712628 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
| 3300032160|Ga0311301_11088449 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1042 | Open in IMG/M |
| 3300032180|Ga0307471_101170047 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 934 | Open in IMG/M |
| 3300033433|Ga0326726_10150226 | All Organisms → cellular organisms → Bacteria | 2123 | Open in IMG/M |
| 3300034124|Ga0370483_0011765 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2484 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 13.86% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.37% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 8.42% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 8.42% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 7.92% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.93% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.95% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.46% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 3.47% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 3.47% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.47% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 2.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.48% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.48% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 1.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 1.49% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.49% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 0.99% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.50% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.50% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.50% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.50% |
| Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 0.50% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.50% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.50% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.50% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.50% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.50% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001131 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O1 | Environmental | Open in IMG/M |
| 3300001137 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 | Environmental | Open in IMG/M |
| 3300001154 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300002906 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_60cm | Environmental | Open in IMG/M |
| 3300002917 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_100cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300004080 | Coassembly of ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300004082 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3 | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
| 3300004635 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
| 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005557 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_153 | Environmental | Open in IMG/M |
| 3300005586 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 | Environmental | Open in IMG/M |
| 3300005591 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 | Environmental | Open in IMG/M |
| 3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
| 3300005610 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006800 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
| 3300009520 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG | Environmental | Open in IMG/M |
| 3300009623 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 | Environmental | Open in IMG/M |
| 3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
| 3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
| 3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011269 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaG | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014165 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014492 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2M metaG | Environmental | Open in IMG/M |
| 3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
| 3300016750 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017946 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300017988 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
| 3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
| 3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300019888 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1c2 | Environmental | Open in IMG/M |
| 3300020199 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
| 3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300023056 | Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2 | Environmental | Open in IMG/M |
| 3300023259 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P3 20-24 | Environmental | Open in IMG/M |
| 3300024330 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026557 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal | Environmental | Open in IMG/M |
| 3300027432 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027546 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027562 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027609 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027674 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027812 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027903 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028776 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_1 | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031233 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031962 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515 | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034124 | Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14 | Environmental | Open in IMG/M |
| 3300034282 | Peat soil microbial communities from wetlands in Alaska, United States - Eight_mile_03D_16 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12631J13338_100029511 | 3300001131 | Forest Soil | MRRVELLKRDELMKADLLSEIVLLGSGVAVVVAFLIVVLAALTSAASMQ* |
| JGI12637J13337_10019833 | 3300001137 | Forest Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVLVAALSSAAAVLQ* |
| JGI12637J13337_10036201 | 3300001137 | Forest Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAAISS |
| JGI12636J13339_10026033 | 3300001154 | Forest Soil | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAAISSAAAVLQ* |
| JGI12635J15846_101205283 | 3300001593 | Forest Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAAISSAAAVLQ* |
| JGI12635J15846_102278351 | 3300001593 | Forest Soil | MRRDELMSRDELMKPDLLSEIVLLGSGLAIVVAVIMVVVAACASAALQ* |
| JGI12635J15846_102737132 | 3300001593 | Forest Soil | MRKNENVCRKDELMKADLFSEILLLGSGVAIAVALGMVVVAAITSAAALR* |
| JGI12635J15846_107884852 | 3300001593 | Forest Soil | MRKDDLMKADLFSEILLLGSGVAIAVTLGMVVLAAVTSAVSFQ* |
| JGI12053J15887_100488602 | 3300001661 | Forest Soil | MRKDDLMKADLLSEILLLGSGVAIAVTLGMVVLAALTSAVSFQ* |
| JGIcombinedJ26739_1002200533 | 3300002245 | Forest Soil | MRKDELMNADLFSEILLLGSGVAIVVALGMVVVAAISSAAAVLQ* |
| JGI25614J43888_1000015118 | 3300002906 | Grasslands Soil | MRKDDLMNADLFSEILLLGSGVAIAVTLVMVIVAAVTSAAALLQ* |
| JGI25616J43925_100590433 | 3300002917 | Grasslands Soil | MRQDDLMNADLFSKILLLGSGVAIVVALVMVVVAAATSAAAFLQ* |
| JGI25616J43925_103338831 | 3300002917 | Grasslands Soil | MRKDELMNADLFSEILLLGSGVAVALALGMVVVAALTSAAALQ* |
| JGIcombinedJ51221_101782132 | 3300003505 | Forest Soil | MVRGHMRRDERMKADVLSEIVLLGSGVAVVVAFLIVIVAALTSAGAAMQ* |
| Ga0062385_100024174 | 3300004080 | Bog Forest Soil | MRRDEVLKQSELMKADVLSEIILLGSGVAVLLAFLIVVVAAITSAAAMQMQ* |
| Ga0062385_100065134 | 3300004080 | Bog Forest Soil | VQRDELIKADLLSEIVLLGTGVAILVAFVMVLVTALTSAALQ* |
| Ga0062385_100180052 | 3300004080 | Bog Forest Soil | MRRDELMKADLLSEIVLLGSGAAVVIALLIVVLASLTSAAAMQ* |
| Ga0062385_106882011 | 3300004080 | Bog Forest Soil | MRRDELMKPDLLSEIILLGSGVAVLVAFFLVVIAAVGSAATMQ* |
| Ga0062384_10000050014 | 3300004082 | Bog Forest Soil | MRQDELITRDQVMKADLLSEIVLLGGGVAILVALVMVVVAALTSAVGA* |
| Ga0062384_1006704251 | 3300004082 | Bog Forest Soil | MRKDELMKSDVLSEIILLGSGVAIVVAFLIVLMAALTSAAAMQ* |
| Ga0062387_1002050333 | 3300004091 | Bog Forest Soil | MRRDELMKAGMLREIVFLGSGVAVVIALLIVVVAALTSAAAMQ* |
| Ga0062389_1013798662 | 3300004092 | Bog Forest Soil | MRRDELMKADVLSEIVLLGSGVAILVAFVMVVVASLKSAAMQ* |
| Ga0062386_1001244113 | 3300004152 | Bog Forest Soil | MRKDELLKADLLSEIVLIVSGVAIMVTLGIVVVAALTSASMAMQ* |
| Ga0062386_1001599663 | 3300004152 | Bog Forest Soil | MRRDEVLKTDLLSEILLLGSGVAILVTLVMVVAAAVTSAVIPQ* |
| Ga0062386_1008772602 | 3300004152 | Bog Forest Soil | MRKDELLKADLLSEIVLIVSGVAILVTVGIVVVAALTSATGAMQ* |
| Ga0062388_1003373913 | 3300004635 | Bog Forest Soil | MRRDELVKAGLLSEIVVVGTGVAILVAFGMVLAAALTSAVFP* |
| Ga0062388_1014943292 | 3300004635 | Bog Forest Soil | MRTDETMKRDELMKADLLSEIVLLGSGVAVIVAFLIVVVAALTSAAAAMQ* |
| Ga0066672_101093343 | 3300005167 | Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALSSAAAVLQ* |
| Ga0066680_100826693 | 3300005174 | Soil | MRKDELMNADLFSEILLLGSGVAIALALGMVVVAALTSAAALQ* |
| Ga0070708_1007242602 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAALTSAASLQ* |
| Ga0070699_1000962603 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKEELMKADLFSEILLLGSGVAIAVALGMVVVAAISSAAALQ* |
| Ga0070731_1000310710 | 3300005538 | Surface Soil | MRKDELMKPDLLSEIILLGSGVAVLVAFFLVVIAAVGSAATMQ* |
| Ga0066661_102165943 | 3300005554 | Soil | EGERMRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALSSAAAVLQ* |
| Ga0066704_109214952 | 3300005557 | Soil | EGERMRKDELMNADLFSEILLLGSGVAIALALGMVVVAALTSAAALQ* |
| Ga0066691_102169723 | 3300005586 | Soil | MRKDELMKADLFSEILLLGSGVAIALALGMVVVAALTSAAALQ* |
| Ga0070761_1000005113 | 3300005591 | Soil | VQRDETIKRDELMKADLLSEIVLLGSGVAVTVAFLIVVVVAVTSAVAMQ* |
| Ga0070761_100066678 | 3300005591 | Soil | MRRDELTKADLLSEIVFLGGGVAVVIALLIVVVATLTSATAMQ* |
| Ga0070761_100267034 | 3300005591 | Soil | MRRVELLRKDELMKADLLSEIVLLGSGVAIVVAFLIVVLAALTSAASMQ* |
| Ga0070761_106977312 | 3300005591 | Soil | MRRVELMNRDQLMKADLLSEIILLSSGVAVLVAFLIVAAAVLTSAAAAMQ* |
| Ga0070762_100062507 | 3300005602 | Soil | MRANETMRRDDLMKADLLSEIVLLSGGVAVLIALLIVVVAACTSAAAAMQ* |
| Ga0070762_101350271 | 3300005602 | Soil | SNNNEELEMRRVELMNRDQLMKADLLSEIILLSSGVAVLVAFLIVAAAVLTSAAAAMQ* |
| Ga0070762_102046942 | 3300005602 | Soil | MVRGHMRRDERVKADVLSEIVLLGSGVAVVVAFLIVIVAALTSAGAAMQ* |
| Ga0070763_107783292 | 3300005610 | Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAAISSAAAALQ* |
| Ga0070764_100031581 | 3300005712 | Soil | MRANETMRRDDLMKADLLSEIVLLSGGVAVLIALLIVVVAACTSAA |
| Ga0070764_100043215 | 3300005712 | Soil | MRRVELMNRDQLMKADLLSEIVLLSSGVAVLVAFLIVAAAVLTSAAAAMQ* |
| Ga0070764_100264643 | 3300005712 | Soil | MRRDELMKADLLSEIVLLGSGVAVVVSFLIVVVAAFTSATTAMQ* |
| Ga0075017_1000446472 | 3300006059 | Watersheds | MRRDELMKADLVSEIVLFGSGVAILVALAMVVVVALASAPALQ* |
| Ga0075017_1001524773 | 3300006059 | Watersheds | MRRGELVKRDDLLKPDLLSEIVLLGSGIAILVALVVVVVAALTSAAAG* |
| Ga0075030_1002042622 | 3300006162 | Watersheds | MRRGELLKRDKLLKPDLLSEIVLLGSGVAILVALAMVVVVALTNAAAG* |
| Ga0075030_1004809082 | 3300006162 | Watersheds | MRRDELMKADLVSEIVLFGSGVAILVALAMVVVVALASA |
| Ga0066660_100795103 | 3300006800 | Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALSSVAAVLQ* |
| Ga0073928_1000098916 | 3300006893 | Iron-Sulfur Acid Spring | MRKDELMKADLFSEILLLGSGVAIVVALGMVVLAAISSAAAVLQ* |
| Ga0073928_103107623 | 3300006893 | Iron-Sulfur Acid Spring | MRRDDLMKADLFSEILLLGSGVAIAVALVMVVVAVLTGAAALQ* |
| Ga0073928_104366523 | 3300006893 | Iron-Sulfur Acid Spring | MRKDDLMKADLFSEILLLGSGVAIAVALLMVVVAALTSAAALQ* |
| Ga0073928_106238773 | 3300006893 | Iron-Sulfur Acid Spring | MRKDDLMKADLFSEILLLGSGVAIAIALLMVVVAALTSAAALQ* |
| Ga0099793_101197263 | 3300007258 | Vadose Zone Soil | RKDELMKADLFSEIVLLCSGVAIALALGMVVVAALTSAAALQ* |
| Ga0099793_102431381 | 3300007258 | Vadose Zone Soil | MRKDDLMKADLFSEIVLLGVGVAIAVTLVMVVMAALTSAAALQ* |
| Ga0099830_114164762 | 3300009088 | Vadose Zone Soil | MRKKENVCRKDELMKADLFSEILLLGSGVAIAVALGMVLVAAITSAAALH* |
| Ga0099792_100618743 | 3300009143 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAALTSAGSLQ* |
| Ga0099792_101178622 | 3300009143 | Vadose Zone Soil | MRKDDLMKADLFSEIVLPGVGVAIAVTLVMVVMAALTSAAALQ* |
| Ga0099792_111052761 | 3300009143 | Vadose Zone Soil | GSEGKRMRKKENVCRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALTSAAAMQ* |
| Ga0116214_10936302 | 3300009520 | Peatlands Soil | MRRDELLKADLLSEILLLSSGVAILATFVMVVVASLASAAAAQ* |
| Ga0116133_10116013 | 3300009623 | Peatland | MQGNELIKRDELMKSDLLSEIVLLGTSVAIAVAFVMVVVAAVASAAATP* |
| Ga0116125_10892751 | 3300009628 | Peatland | MHANELIKRDELMKSDLLSEIVLLGTSVAIVVAFVMVVVAAVASAAATP* |
| Ga0116134_10037904 | 3300009764 | Peatland | MSENDLIKRDELLKSDLLSEIVLLGSGVAIMVAFVIVVVAALASAAATP* |
| Ga0074044_101982423 | 3300010343 | Bog Forest Soil | MRRDELLKADLLSEILLLGSGVAMLVTFVMVVVASLASAAAAQ* |
| Ga0136449_1002674073 | 3300010379 | Peatlands Soil | MRKEELLKADLLSEILLLGSGVAILVTFVMVVLASLASATAPP* |
| Ga0150983_149718831 | 3300011120 | Forest Soil | MRKDELMKPDLFSEILLLGSGVAIAVALGMVVVAAITSAASLR* |
| Ga0137392_115499501 | 3300011269 | Vadose Zone Soil | KADLFSEILLLGSGVAIVVALGMVVVAALSSAAAVLQ* |
| Ga0137391_104138943 | 3300011270 | Vadose Zone Soil | MRKKENVCRKDELMKADLFSEILLLSSGVAIAVALGMVLVAAITSAAALH* |
| Ga0137393_100839514 | 3300011271 | Vadose Zone Soil | MRKKENVCRKDELMKADLFSEILLLGSGVAIAVALGMVVVAALTSAASLQ* |
| Ga0137363_101129432 | 3300012202 | Vadose Zone Soil | MRKDDLMKADLFSEILLVGSGVAIAVALGMVVVAALTSAASLQ* |
| Ga0137363_105515471 | 3300012202 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAALSSAAALQ* |
| Ga0137377_103266662 | 3300012211 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALSS |
| Ga0137386_103053721 | 3300012351 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAA |
| Ga0137390_106344912 | 3300012363 | Vadose Zone Soil | MRKKENVCRKDELMKADLFSEILLLSSGVAIAVALGMVVVAALTSAASLQ* |
| Ga0137390_109986572 | 3300012363 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAAISSAAALQ* |
| Ga0137358_108844202 | 3300012582 | Vadose Zone Soil | MRKQENVCRKDELMKADLFSEILLLSSAVAIAVALGMILVAAITSAAALH* |
| Ga0137398_100567863 | 3300012683 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALTSAAALQ* |
| Ga0137397_101521413 | 3300012685 | Vadose Zone Soil | MRKDDLMKADLFSEILLLGSGVAIVVALGMVVVAALSSAAAVLQ* |
| Ga0137416_105466452 | 3300012927 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALSSAA |
| Ga0181532_1000545612 | 3300014164 | Bog | MRRDELRNADLLSEIVFLGSGVAVVIALLIVVVAALTSAAAMQ* |
| Ga0181523_101349733 | 3300014165 | Bog | MREDELIKRDELMKSDLLSEIVLLGSGVAIIVAFVMVVVTALASAAAP* |
| Ga0181523_103570332 | 3300014165 | Bog | MRRDELLKADLLSEILLLGSGVAMLVTFVMVVVASLASAAAA |
| Ga0181531_104663152 | 3300014169 | Bog | MRGDKLITKDQVMKADLLSEIVLLSSGVAILAALVIAAVAALTSAGVV* |
| Ga0181531_105902611 | 3300014169 | Bog | MRRDELMRADLLSEIILLGSGVAVVIAFFIVIAAALLSPLFS* |
| Ga0182013_100123986 | 3300014492 | Bog | MRKDELLKADLLSEVVLIVSGVAILVTLGIVVVAALTSAAGTM* |
| Ga0182024_1000022890 | 3300014501 | Permafrost | MRRSDLMKRDDLMKADLPSEIVLLGSGVAILVTLAMVVLAALTSAATA* |
| Ga0182021_101623093 | 3300014502 | Fen | MRKDELMRADLLSEIILLGSGVAILIAFVMAVAAALTSAAMMQ* |
| Ga0181522_107133661 | 3300014657 | Bog | MRQDDLMKADLLSEIVLVGSGIAMFVWILLVVVAAITRTAAPR* |
| Ga0181505_110721814 | 3300016750 | Peatland | MRRDELRNADLLSEIVFLGSGVAVVIALLIVVVAALTSAAAMQ |
| Ga0187802_100350062 | 3300017822 | Freshwater Sediment | MRRDELLKADLLSEILLLGSGVAILLTFVMVVVASLASAAAQ |
| Ga0187818_100708423 | 3300017823 | Freshwater Sediment | SQGEAMRRDELIKADLVSEIVLLGSGVAILVALAMVVVAALVSAPALQ |
| Ga0187879_104104661 | 3300017946 | Peatland | MRRDELLKADLLSEILLLGSGVAMLVTFVMVVVASLASAAAAQ |
| Ga0187847_1000177311 | 3300017948 | Peatland | MQGNELIKRDELMKSDLLSEIVLLGTSVAIAVAFVMVVVAAVASAAATP |
| Ga0187847_107421631 | 3300017948 | Peatland | MHRDETIKRDELMKADLLSEIVLLGSGVAVIVAFLIVVVVSLASAAAAMQ |
| Ga0187776_113153331 | 3300017966 | Tropical Peatland | MRRDELMKADLLSEILLLGGSVAILVALAIVVVAALASAAALQ |
| Ga0181520_107538711 | 3300017988 | Bog | MRQDDLMKADLLSEIVLVGSGIAMFVWILLVVVAAITRTAAPR |
| Ga0187815_100060962 | 3300018001 | Freshwater Sediment | MRRDELIKADLVSEIVLLGSGVAILVALAMVVVAALVSAPALQ |
| Ga0187880_11293282 | 3300018016 | Peatland | MSENDLIKRDELLKSDLLSEIVLLGSGVAIMVAFVIVVVAALASAAATP |
| Ga0187863_101648482 | 3300018034 | Peatland | MRRDELLKTDLLSEIVLLGSSVAILVSFALVVVAALTSTALQ |
| Ga0187871_101094453 | 3300018042 | Peatland | MRREELMKADLLSEIVLLGSGVAVVIALLIVVVAAVTSAAAVQ |
| Ga0187871_103717671 | 3300018042 | Peatland | MQGNELIKRDELMKSDLLSEIVLLGTSVAIAVTFVMVVVAAVASAAATP |
| Ga0187887_101817893 | 3300018043 | Peatland | MHRDETIKRDELMKADLLSEIVLLGSGVAVIVAFLIVVVVALASAAAAMQ |
| Ga0187859_105918992 | 3300018047 | Peatland | MHANELIKRDELMKSDLLSEIVLLGTSVAIVVAFVMVVVAAVASAAATP |
| Ga0193729_10091632 | 3300019887 | Soil | MRKDELMKADLFSEILLLGSGVAIVVALGVVVVAAISSAAAVLQ |
| Ga0193729_12742752 | 3300019887 | Soil | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAALTSAAALH |
| Ga0193751_100023933 | 3300019888 | Soil | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAALTSAASLQ |
| Ga0193751_10034076 | 3300019888 | Soil | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAAISSAAALQ |
| Ga0193751_10057666 | 3300019888 | Soil | MRKDELMKADLFSEILLLGSGVAIVVALAMVVVAAISSAAAVLQ |
| Ga0179592_102624562 | 3300020199 | Vadose Zone Soil | MRKDDLMKADLFSEILLVGSGVAIAVALGMVVVAALTSAASLQ |
| Ga0210407_100110226 | 3300020579 | Soil | MRKDELMKPDLFSEILLLGSGVAIAVALGMVVVAAITSAASLR |
| Ga0210407_101047873 | 3300020579 | Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAAISSAAAVLQ |
| Ga0210399_100065318 | 3300020581 | Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAAISSAAAALQ |
| Ga0210399_100213253 | 3300020581 | Soil | MRKDELLNADLFSEILLLGSGVAIVVALGMVVLAAISSAAAVLQ |
| Ga0210399_114134961 | 3300020581 | Soil | MRKQENVCRRDELMKADLFSEILLLSSAVAIAVALGMVLVAAITSAAALH |
| Ga0210395_105681762 | 3300020582 | Soil | MRRVELMNRDQLMKADLLSEIILLSSGVAVLVAFLIVAAAVLTSAAAAMQ |
| Ga0210401_109069722 | 3300020583 | Soil | MRKDELMNADLFSEILLLGSGVAIAVALGMVVLAAISSAAAVLQ |
| Ga0210406_100100452 | 3300021168 | Soil | MRKDELMKADLFSEILLLGSGVAIALALGMVVVAAISSAAAVLQ |
| Ga0210400_1000015732 | 3300021170 | Soil | MRKDDLMKADLFSEIVLLGVGVAIAVTLVMVVMAALTSAAAFQ |
| Ga0210400_114794282 | 3300021170 | Soil | MVRGHMRRDERMKADVLSEIVLLGSGVAVVVAFLIVIVAALTSAGAAMQ |
| Ga0210405_100954202 | 3300021171 | Soil | MRKDELMNADLFSEILLLGSGVAIVVALGMVVVAAISSAAAVLQ |
| Ga0210388_100459933 | 3300021181 | Soil | MRANETMRRDDLMKADLLSEIVLLSGGVAVLIALLIVVVAACTSAAAAMQ |
| Ga0210388_102251083 | 3300021181 | Soil | MRRDELMKADLLSEIVLLGSGVAVVVSFLIVVVAAFTSATTAMQ |
| Ga0210385_1000010429 | 3300021402 | Soil | MRRDERMKADVLSEIVLLGSGVAVVVAFLIVIVAALTSAGAAMQ |
| Ga0210390_109292971 | 3300021474 | Soil | MHGHETMKRDELMKADLLSEIVLLSGGVAVVVAFLIVVVAAFTSAAAA |
| Ga0212123_1000047152 | 3300022557 | Iron-Sulfur Acid Spring | MRKDELMKADLFSEILLLGSGVAIVVALGMVVLAAISSAAAVLQ |
| Ga0212123_1000322432 | 3300022557 | Iron-Sulfur Acid Spring | MRRDDLMKADLFSEILLLGSGVAIAVALVMVVVAVLTGAAALQ |
| Ga0212123_1001018312 | 3300022557 | Iron-Sulfur Acid Spring | MRKDDLMKADLFSEILLLGSGVAIAVALLMVVVAALTSAAALQ |
| Ga0224569_1146681 | 3300022732 | Rhizosphere | MRRLELMKRDELMKADLLSEIVLLGSGVAIMVAFLLVVVAVLTSAAGMQ |
| Ga0233357_10494612 | 3300023056 | Soil | MRKDDLMKADLFSEILLLGSGVAIAVTLVMVVLAALTSAASLQ |
| Ga0224551_10013843 | 3300023259 | Soil | MRRSDLMKRDDLMKADLPSEIVLLGSGVAILVTLAMVVLAALTSAATA |
| Ga0137417_13708931 | 3300024330 | Vadose Zone Soil | DELMKADLFSEILLLGSGVAIVVALGMVVVAALSSAAAVLQ |
| Ga0207684_114380181 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRKEELMKADLFSEILLLGSGVAIAVALGMVVVAAISSAAALQ |
| Ga0209240_10089325 | 3300026304 | Grasslands Soil | MRKDDLMNADLFSEILLLGSGVAIAVTLVMVIVAAVTSAAALLQ |
| Ga0209055_10684192 | 3300026309 | Soil | MRKDELMNADLFSEILLLGSGVAIALALGMVVVAALTSAAALQ |
| Ga0209055_10937572 | 3300026309 | Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALSSAAAVLQ |
| Ga0209804_11107231 | 3300026335 | Soil | GERMRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALSSAAAVLQ |
| Ga0209648_102151723 | 3300026551 | Grasslands Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALSSAAA |
| Ga0179587_104370222 | 3300026557 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAALTSAAALQ |
| Ga0209421_10016872 | 3300027432 | Forest Soil | MRRDELLKADLLSEIVLLGTGVATLVAFAVAVVAALTSTALQ |
| Ga0209332_10758862 | 3300027439 | Forest Soil | MRRDELMSRDELMKPDLLSEIVLLGSGLAIVVAVIMVVVAACASAALQ |
| Ga0208984_10854262 | 3300027546 | Forest Soil | MRKDDLMKADLLSEILLLGSGVAIAVTLGMVVLAALTSAVSFQ |
| Ga0209735_10034324 | 3300027562 | Forest Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVLVAALSSAAAVLQ |
| Ga0208043_11680141 | 3300027570 | Peatlands Soil | MRRDELLKADLLSEILLLSSGVAILATFVMVVVASLASAAAAQ |
| Ga0209733_10226362 | 3300027591 | Forest Soil | MRKDELMKADLFSEILLLGTGVAIAVALGMVVVAAISSAAALQ |
| Ga0209221_10002179 | 3300027609 | Forest Soil | MRRVELLKRDELMKADLLSEIVLLGSGVAVVVAFLIVVLAALTSAASMQ |
| Ga0209221_10452793 | 3300027609 | Forest Soil | MHRVELLKRDELMKADLFSEIVLLGSGVAIMVAFLIVVLAAVTSAAAMR |
| Ga0209076_10352592 | 3300027643 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIALALGMVVVAALTSAAALQ |
| Ga0209117_10274032 | 3300027645 | Forest Soil | MRKDDLMKADLFSEILLLGSGVAIAVTLGMVVLGALTSAVSFQ |
| Ga0209117_11601971 | 3300027645 | Forest Soil | LMKADLFSEILLLGSGVAIVVALGMVVVAAISSAAAVLQ |
| Ga0209118_10084392 | 3300027674 | Forest Soil | MRRDDLMKADLFSEILLLGSGVAIAVTLGMVVLAALTSAMSFQ |
| Ga0209118_10426772 | 3300027674 | Forest Soil | MRKDELMKADLFSEILLLGSGVAIAVALGMVVVAAISSAAAVLQ |
| Ga0209011_12114351 | 3300027678 | Forest Soil | MRKDDLMKADLFSEILLLGSGVAIAVTLGMVVLAAVTSAVSFQ |
| Ga0208991_10095563 | 3300027681 | Forest Soil | MRKDDLMKADLLSEILLLGSGVAIAVTLGMVVVAALTSAVSFQ |
| Ga0209248_100785953 | 3300027729 | Bog Forest Soil | MRRDELMKADLLSEIVLLGSGAAVVIALLIVVLASLTSAAAMQ |
| Ga0209038_100309993 | 3300027737 | Bog Forest Soil | MRQDELITRDQVMKADLLSEIVLLGGGVAILVALVMVVVAALTSAVGA |
| Ga0209656_102230822 | 3300027812 | Bog Forest Soil | MRKDELLKADLLSEIVLIVSGVAILVTVGIVVVAALTSATGAMQ |
| Ga0209039_101864452 | 3300027825 | Bog Forest Soil | MRRDEVLKTDLLSEILLLGSGVAILVTLVMVVAAAVTSAVIPQ |
| Ga0209274_1000089319 | 3300027853 | Soil | MKADLLSEIVLLGSGVAVTVAFLIVVVVAVTSAVAMQ |
| Ga0209274_100795313 | 3300027853 | Soil | MRRVELLRKDELMKADLLSEIVLLGSGVAIVVAFLIVVLAALTSAASMQ |
| Ga0209274_104100291 | 3300027853 | Soil | MRRDELTKADLLSEIVFLGGGVAVVIALLIVVVATLTSATAMQ |
| Ga0209579_1000009467 | 3300027869 | Surface Soil | MRKDELMKPDLLSEIILLGSGVAVLVAFFLVVIAAVGSAATMQ |
| Ga0209169_1000029113 | 3300027879 | Soil | MRRVELMNRDQLMKADLLSEIVLLSSGVAVLVAFLIVAAAVLTSAAAAMQ |
| Ga0209169_104082481 | 3300027879 | Soil | KADLLSEIVLLGSGVAVVVSFLIVVVAAFTSATTAMQ |
| Ga0209590_103633492 | 3300027882 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIALALGMVVVAALTSAAA |
| Ga0209275_102377812 | 3300027884 | Soil | VKCSSNNNEELEMRRVELMNRDQLMKADLLSEIILLSSGVAVLVAFLIVAAAVLTSAAAAMQ |
| Ga0209068_109363741 | 3300027894 | Watersheds | MRKDELMKADLLSEIVLVSSGVAILVALLMVVGAALASAAVW |
| Ga0209488_100584465 | 3300027903 | Vadose Zone Soil | MRKDDLMKADLFSEIVLLGVGVAIAVTLVMVVMAALTSAAALQ |
| Ga0209488_100862653 | 3300027903 | Vadose Zone Soil | MRKDELMKADLFSEILLLGSGVAIVVALGMVVVAALTSAAALQ |
| Ga0209488_106068902 | 3300027903 | Vadose Zone Soil | ADLFSEILLLGSGVAIVVALGMVVVAALSSAAAVLQ |
| Ga0209698_102687122 | 3300027911 | Watersheds | MRRGELLKRDKLLKPDLLSEIVLLGSGVAILVALAMVVVVALTNAAAG |
| Ga0209698_104189101 | 3300027911 | Watersheds | MRRDELMKADLVSEIVLFGSGVAILVALAMVVVVALASAPALQ |
| Ga0209526_102115792 | 3300028047 | Forest Soil | MRKEDLMKADLFSEILLLGSGVAIAVTLGMVVLAAVTSAVSFQ |
| Ga0209526_103185882 | 3300028047 | Forest Soil | MRKDDLMKADLFSEILLLGSGVAIAVTLGMVVLAALSSAVSFQ |
| Ga0209526_107601121 | 3300028047 | Forest Soil | MRGHEVIKRDELMRTDLLSEIVLIGSGVAILVALVMVVMAALTSAVTA |
| Ga0302303_100741283 | 3300028776 | Palsa | MRRSEMMKRDDLMKADVLSEIVLLGSGVAILVALVMVLVAALTSAATA |
| Ga0311338_109066542 | 3300030007 | Palsa | VQRDELIKADLLSEIVLLGTGVAILVAFVMVLVTALTSAALQ |
| Ga0170824_1071621042 | 3300031231 | Forest Soil | VRKDELMNADLFSEILLLGSGIAIAVALGMVVVAALTSAASLQ |
| Ga0302307_107079851 | 3300031233 | Palsa | MRRSEMMKRDDLMKADVLSEIVLLGSGVAILVALVMVLVA |
| Ga0302325_101579791 | 3300031234 | Palsa | MQRGELLKADLLTEIVLLGTGVAILVAFAIVVVTALTSAALQ |
| Ga0302324_10000210415 | 3300031236 | Palsa | MRGDKLITKDQVMKADLLSEIVLLSSGVAILAALVIAAVAALTSAGVV |
| Ga0302324_1001509531 | 3300031236 | Palsa | MQRDELLKADLLSEILLLSTGLAILVAFVMVVVAALTSTVLQ |
| Ga0307476_105810862 | 3300031715 | Hardwood Forest Soil | MRKDELMKPDVLSEIILLGSGVAVLVAFFLVVIAAVGSAATMQ |
| Ga0307474_100262193 | 3300031718 | Hardwood Forest Soil | MRKDELMKADLISEIVLLCSGVAIAVALGMVVVAALTSAAALQ |
| Ga0307469_110116782 | 3300031720 | Hardwood Forest Soil | MRKDELLKSDLLSEIVLLGSGVAILVALVMVVAAALAGAVTPQ |
| Ga0307477_10000026189 | 3300031753 | Hardwood Forest Soil | MRRDDLMKADLFSEILLLGSGVAIAVALVVVVVAALTSAAGLQ |
| Ga0307475_100333473 | 3300031754 | Hardwood Forest Soil | MRRDDLMKADLFSEILLLGSGVAIAVALVMVVVAVLTSAAALQ |
| Ga0307475_104417653 | 3300031754 | Hardwood Forest Soil | KDELMKADLFSEILLLGSGVAIAVALAMVVVAALTSATSLQ |
| Ga0307475_105283593 | 3300031754 | Hardwood Forest Soil | MRNDELMKADLFSEILLLGSGVAIAVALGMVVVAALTSAASLQ |
| Ga0307475_109956042 | 3300031754 | Hardwood Forest Soil | MRKDELMKADLFSEILLLGSGVAIALALGMVVVAAMSSAAAVLQ |
| Ga0307475_113866032 | 3300031754 | Hardwood Forest Soil | LMKADLFSEILLLGSGVAIAVALVLVVVAALTSAAALQ |
| Ga0307473_109830561 | 3300031820 | Hardwood Forest Soil | MKADLFSEILLLSSGIAIAVALGMVLVAAITSAAALH |
| Ga0307478_101147442 | 3300031823 | Hardwood Forest Soil | MRRDDLMKADLFSEILLLGSGVAIAVALVMVVVAALTSAAGLQ |
| Ga0307479_103882363 | 3300031962 | Hardwood Forest Soil | MRKDELMKADLISEIVLLCSGVTIAVALGMVVVAALTSAAALQ |
| Ga0307479_107126282 | 3300031962 | Hardwood Forest Soil | MRKDELMKADLFSEILLLGSGVAIAVALAMVVVAALTSATSLQ |
| Ga0311301_110884491 | 3300032160 | Peatlands Soil | MRKEELLKADLLSEILLLGSGVAILVTFVMVVLASLASATAPP |
| Ga0307471_1011700471 | 3300032180 | Hardwood Forest Soil | MRKDELMKPDLFSEILLLGSGVAIAVALGMVVVAAITSAASLQ |
| Ga0335073_1000193315 | 3300033134 | Soil | MRQDDLMKADLLSEIVLVGSGIAMFVWILLIVVAAITRTAAPR |
| Ga0326726_101502262 | 3300033433 | Peat Soil | MRRDELMKADLLSGVVLFGSGVAILVALAMVVVVALASAPALQ |
| Ga0370483_0011765_74_202 | 3300034124 | Untreated Peat Soil | MSRDELLKADLFSEIVLLATGVAIVVALLMVVAAAASAAILQ |
| Ga0370492_0109835_794_922 | 3300034282 | Untreated Peat Soil | MSRDELLKADVLSEIVLLGTGVAIVVALLLVVAAAASAAVLQ |
| ⦗Top⦘ |