Basic Information | |
---|---|
Family ID | F025183 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 203 |
Average Sequence Length | 46 residues |
Representative Sequence | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGATPVR |
Number of Associated Samples | 144 |
Number of Associated Scaffolds | 203 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 29.06 % |
% of genes near scaffold ends (potentially truncated) | 25.62 % |
% of genes from short scaffolds (< 2000 bps) | 81.28 % |
Associated GOLD sequencing projects | 128 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.55 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (95.074 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil (23.645 % of family members) |
Environment Ontology (ENVO) | Unclassified (38.916 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (50.739 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 43.84% β-sheet: 0.00% Coil/Unstructured: 56.16% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.55 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 203 Family Scaffolds |
---|---|---|
PF00296 | Bac_luciferase | 41.38 |
PF02803 | Thiolase_C | 23.15 |
PF10604 | Polyketide_cyc2 | 4.43 |
PF02771 | Acyl-CoA_dh_N | 2.46 |
PF12867 | DinB_2 | 0.99 |
PF13508 | Acetyltransf_7 | 0.99 |
PF13458 | Peripla_BP_6 | 0.49 |
PF13304 | AAA_21 | 0.49 |
PF07589 | PEP-CTERM | 0.49 |
PF00782 | DSPc | 0.49 |
PF00108 | Thiolase_N | 0.49 |
PF01636 | APH | 0.49 |
COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
---|---|---|---|
COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 41.38 |
COG0183 | Acetyl-CoA acetyltransferase | Lipid transport and metabolism [I] | 23.65 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 2.46 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 97.04 % |
Unclassified | root | N/A | 2.96 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001359|A3035W6_1055917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 777 | Open in IMG/M |
3300002560|JGI25383J37093_10091402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 904 | Open in IMG/M |
3300002912|JGI25386J43895_10197919 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
3300004156|Ga0062589_101852865 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → unclassified Burkholderiales → Burkholderiales bacterium | 607 | Open in IMG/M |
3300005166|Ga0066674_10008282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4211 | Open in IMG/M |
3300005166|Ga0066674_10130144 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1181 | Open in IMG/M |
3300005167|Ga0066672_10037966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2688 | Open in IMG/M |
3300005171|Ga0066677_10354275 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 840 | Open in IMG/M |
3300005171|Ga0066677_10557848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 655 | Open in IMG/M |
3300005171|Ga0066677_10634257 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
3300005172|Ga0066683_10228163 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1152 | Open in IMG/M |
3300005172|Ga0066683_10495143 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 747 | Open in IMG/M |
3300005174|Ga0066680_10009156 | All Organisms → cellular organisms → Bacteria | 4995 | Open in IMG/M |
3300005174|Ga0066680_10063473 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2198 | Open in IMG/M |
3300005175|Ga0066673_10362824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 845 | Open in IMG/M |
3300005175|Ga0066673_10366749 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 840 | Open in IMG/M |
3300005176|Ga0066679_10023981 | All Organisms → cellular organisms → Bacteria | 3275 | Open in IMG/M |
3300005176|Ga0066679_10517282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 778 | Open in IMG/M |
3300005179|Ga0066684_10461350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 854 | Open in IMG/M |
3300005181|Ga0066678_10883820 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 586 | Open in IMG/M |
3300005186|Ga0066676_10074901 | All Organisms → cellular organisms → Bacteria | 1996 | Open in IMG/M |
3300005294|Ga0065705_10316204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1020 | Open in IMG/M |
3300005406|Ga0070703_10251111 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 717 | Open in IMG/M |
3300005440|Ga0070705_100501809 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 921 | Open in IMG/M |
3300005444|Ga0070694_100195362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1505 | Open in IMG/M |
3300005445|Ga0070708_100382775 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1327 | Open in IMG/M |
3300005446|Ga0066686_10091624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1943 | Open in IMG/M |
3300005446|Ga0066686_10116587 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1737 | Open in IMG/M |
3300005447|Ga0066689_10673182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 649 | Open in IMG/M |
3300005447|Ga0066689_11038059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 504 | Open in IMG/M |
3300005450|Ga0066682_10497501 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 772 | Open in IMG/M |
3300005450|Ga0066682_10932202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 516 | Open in IMG/M |
3300005451|Ga0066681_10940223 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 517 | Open in IMG/M |
3300005458|Ga0070681_11880679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 526 | Open in IMG/M |
3300005467|Ga0070706_100192133 | All Organisms → cellular organisms → Bacteria | 1907 | Open in IMG/M |
3300005467|Ga0070706_101380751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 645 | Open in IMG/M |
3300005468|Ga0070707_100008693 | All Organisms → cellular organisms → Bacteria | 9417 | Open in IMG/M |
3300005471|Ga0070698_101495897 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 626 | Open in IMG/M |
3300005518|Ga0070699_100396925 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Mucoromycotina → Endogonomycetes → Endogonales → Endogonaceae → Jimgerdemannia → Jimgerdemannia flammicorona | 1247 | Open in IMG/M |
3300005536|Ga0070697_100266207 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1468 | Open in IMG/M |
3300005546|Ga0070696_101334079 | Not Available | 610 | Open in IMG/M |
3300005553|Ga0066695_10092314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1850 | Open in IMG/M |
3300005553|Ga0066695_10233754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1158 | Open in IMG/M |
3300005555|Ga0066692_10212184 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300005555|Ga0066692_10773715 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 591 | Open in IMG/M |
3300005556|Ga0066707_10138206 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1535 | Open in IMG/M |
3300005556|Ga0066707_10324832 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1007 | Open in IMG/M |
3300005568|Ga0066703_10170839 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1312 | Open in IMG/M |
3300005568|Ga0066703_10421328 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 801 | Open in IMG/M |
3300005578|Ga0068854_100058205 | All Organisms → cellular organisms → Bacteria | 2789 | Open in IMG/M |
3300006046|Ga0066652_100133537 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2057 | Open in IMG/M |
3300006791|Ga0066653_10061350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1598 | Open in IMG/M |
3300006794|Ga0066658_10240055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 967 | Open in IMG/M |
3300006796|Ga0066665_10585662 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 900 | Open in IMG/M |
3300006797|Ga0066659_10585293 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 905 | Open in IMG/M |
3300006854|Ga0075425_100533335 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1351 | Open in IMG/M |
3300006854|Ga0075425_102230398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 610 | Open in IMG/M |
3300006876|Ga0079217_10870442 | Not Available | 638 | Open in IMG/M |
3300007076|Ga0075435_100397724 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1185 | Open in IMG/M |
3300007255|Ga0099791_10474733 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 606 | Open in IMG/M |
3300007258|Ga0099793_10320413 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 755 | Open in IMG/M |
3300009012|Ga0066710_100263779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2500 | Open in IMG/M |
3300009012|Ga0066710_100286067 | All Organisms → cellular organisms → Bacteria | 2407 | Open in IMG/M |
3300009012|Ga0066710_100327463 | All Organisms → cellular organisms → Bacteria | 2256 | Open in IMG/M |
3300009012|Ga0066710_101285180 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1135 | Open in IMG/M |
3300009012|Ga0066710_101486606 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1046 | Open in IMG/M |
3300009012|Ga0066710_102827294 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 685 | Open in IMG/M |
3300009038|Ga0099829_11257586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 612 | Open in IMG/M |
3300009088|Ga0099830_11236350 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 620 | Open in IMG/M |
3300009089|Ga0099828_10257282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1566 | Open in IMG/M |
3300009090|Ga0099827_10101320 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2290 | Open in IMG/M |
3300009090|Ga0099827_10129763 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2041 | Open in IMG/M |
3300009137|Ga0066709_100120004 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3282 | Open in IMG/M |
3300009147|Ga0114129_10563105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1481 | Open in IMG/M |
3300009147|Ga0114129_10615117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1406 | Open in IMG/M |
3300009162|Ga0075423_10959932 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 907 | Open in IMG/M |
3300010323|Ga0134086_10243375 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 683 | Open in IMG/M |
3300010326|Ga0134065_10060210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1190 | Open in IMG/M |
3300010336|Ga0134071_10427066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 677 | Open in IMG/M |
3300010337|Ga0134062_10180491 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 953 | Open in IMG/M |
3300010399|Ga0134127_10887692 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 946 | Open in IMG/M |
3300010399|Ga0134127_11760977 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 695 | Open in IMG/M |
3300010401|Ga0134121_10475368 | All Organisms → cellular organisms → Bacteria | 1145 | Open in IMG/M |
3300011271|Ga0137393_10726244 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 850 | Open in IMG/M |
3300012003|Ga0120163_1085689 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 704 | Open in IMG/M |
3300012010|Ga0120118_1032491 | All Organisms → cellular organisms → Bacteria | 1368 | Open in IMG/M |
3300012096|Ga0137389_10656099 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 902 | Open in IMG/M |
3300012096|Ga0137389_10709974 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 864 | Open in IMG/M |
3300012189|Ga0137388_10459767 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1181 | Open in IMG/M |
3300012189|Ga0137388_11681890 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
3300012198|Ga0137364_10092182 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2117 | Open in IMG/M |
3300012198|Ga0137364_10418666 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1003 | Open in IMG/M |
3300012200|Ga0137382_10925399 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 628 | Open in IMG/M |
3300012202|Ga0137363_10359855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1206 | Open in IMG/M |
3300012203|Ga0137399_10019095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4437 | Open in IMG/M |
3300012203|Ga0137399_10058194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2842 | Open in IMG/M |
3300012203|Ga0137399_10144783 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1892 | Open in IMG/M |
3300012206|Ga0137380_10137704 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2227 | Open in IMG/M |
3300012207|Ga0137381_10558623 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Mucoromycotina → Endogonomycetes → Endogonales → Endogonaceae → Jimgerdemannia → Jimgerdemannia flammicorona | 998 | Open in IMG/M |
3300012208|Ga0137376_10047822 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3485 | Open in IMG/M |
3300012209|Ga0137379_10759855 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 874 | Open in IMG/M |
3300012210|Ga0137378_11003998 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 748 | Open in IMG/M |
3300012211|Ga0137377_10186797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1990 | Open in IMG/M |
3300012211|Ga0137377_11277967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 664 | Open in IMG/M |
3300012211|Ga0137377_11607805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 574 | Open in IMG/M |
3300012362|Ga0137361_10826514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 842 | Open in IMG/M |
3300012918|Ga0137396_10026972 | All Organisms → cellular organisms → Bacteria | 3758 | Open in IMG/M |
3300012918|Ga0137396_10041442 | All Organisms → cellular organisms → Bacteria | 3113 | Open in IMG/M |
3300012918|Ga0137396_10536664 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 866 | Open in IMG/M |
3300012918|Ga0137396_11011663 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 601 | Open in IMG/M |
3300012922|Ga0137394_10787237 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 797 | Open in IMG/M |
3300012923|Ga0137359_10813474 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 809 | Open in IMG/M |
3300012925|Ga0137419_10929744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 717 | Open in IMG/M |
3300012927|Ga0137416_11644823 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 585 | Open in IMG/M |
3300012930|Ga0137407_10440688 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1211 | Open in IMG/M |
3300012944|Ga0137410_10457419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1037 | Open in IMG/M |
3300012976|Ga0134076_10414612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 602 | Open in IMG/M |
3300013765|Ga0120172_1157521 | Not Available | 535 | Open in IMG/M |
3300013766|Ga0120181_1003232 | All Organisms → cellular organisms → Bacteria | 5805 | Open in IMG/M |
3300015356|Ga0134073_10199106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 664 | Open in IMG/M |
3300017654|Ga0134069_1352807 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 529 | Open in IMG/M |
3300017657|Ga0134074_1082357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1099 | Open in IMG/M |
3300017659|Ga0134083_10047626 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1607 | Open in IMG/M |
3300018027|Ga0184605_10006899 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 4193 | Open in IMG/M |
3300018027|Ga0184605_10010276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3557 | Open in IMG/M |
3300018027|Ga0184605_10099008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1285 | Open in IMG/M |
3300018027|Ga0184605_10503130 | Not Available | 527 | Open in IMG/M |
3300018028|Ga0184608_10305185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 700 | Open in IMG/M |
3300018028|Ga0184608_10372202 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 624 | Open in IMG/M |
3300018051|Ga0184620_10145157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 764 | Open in IMG/M |
3300018061|Ga0184619_10491130 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 543 | Open in IMG/M |
3300018431|Ga0066655_10122648 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1496 | Open in IMG/M |
3300018431|Ga0066655_10187071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1268 | Open in IMG/M |
3300018433|Ga0066667_11655504 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 572 | Open in IMG/M |
3300018468|Ga0066662_10147208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1774 | Open in IMG/M |
3300018468|Ga0066662_10169217 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1682 | Open in IMG/M |
3300018482|Ga0066669_10287821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1325 | Open in IMG/M |
3300018482|Ga0066669_11202324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 684 | Open in IMG/M |
3300018482|Ga0066669_12399907 | Not Available | 505 | Open in IMG/M |
3300019879|Ga0193723_1066615 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1043 | Open in IMG/M |
3300019883|Ga0193725_1106747 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 656 | Open in IMG/M |
3300019885|Ga0193747_1025445 | All Organisms → cellular organisms → Bacteria | 1464 | Open in IMG/M |
3300020001|Ga0193731_1006105 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3075 | Open in IMG/M |
3300020022|Ga0193733_1079263 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 921 | Open in IMG/M |
3300021080|Ga0210382_10127019 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Mucoromycotina → Endogonomycetes → Endogonales → Endogonaceae → Jimgerdemannia → Jimgerdemannia flammicorona | 1080 | Open in IMG/M |
3300021080|Ga0210382_10203252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 861 | Open in IMG/M |
3300021080|Ga0210382_10405242 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 603 | Open in IMG/M |
3300021344|Ga0193719_10072356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1496 | Open in IMG/M |
3300021344|Ga0193719_10237997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 772 | Open in IMG/M |
3300021418|Ga0193695_1052738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 883 | Open in IMG/M |
3300022534|Ga0224452_1011939 | All Organisms → Viruses → Predicted Viral | 2293 | Open in IMG/M |
3300022694|Ga0222623_10084844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 1229 | Open in IMG/M |
3300022756|Ga0222622_11377653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 519 | Open in IMG/M |
3300025885|Ga0207653_10256046 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 672 | Open in IMG/M |
3300025910|Ga0207684_10086826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2664 | Open in IMG/M |
3300025910|Ga0207684_10251604 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1524 | Open in IMG/M |
3300025910|Ga0207684_10506836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1034 | Open in IMG/M |
3300025910|Ga0207684_11183254 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 633 | Open in IMG/M |
3300025922|Ga0207646_10005251 | All Organisms → cellular organisms → Bacteria | 13665 | Open in IMG/M |
3300025922|Ga0207646_10010602 | All Organisms → cellular organisms → Bacteria | 8979 | Open in IMG/M |
3300025922|Ga0207646_11109210 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 696 | Open in IMG/M |
3300025949|Ga0207667_10868374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 896 | Open in IMG/M |
3300026296|Ga0209235_1027680 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2956 | Open in IMG/M |
3300026300|Ga0209027_1009179 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3730 | Open in IMG/M |
3300026300|Ga0209027_1117971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 930 | Open in IMG/M |
3300026300|Ga0209027_1122347 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 907 | Open in IMG/M |
3300026310|Ga0209239_1108161 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1171 | Open in IMG/M |
3300026317|Ga0209154_1090531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1311 | Open in IMG/M |
3300026318|Ga0209471_1336973 | Not Available | 500 | Open in IMG/M |
3300026322|Ga0209687_1166408 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 701 | Open in IMG/M |
3300026325|Ga0209152_10056208 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1393 | Open in IMG/M |
3300026327|Ga0209266_1027924 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 3025 | Open in IMG/M |
3300026328|Ga0209802_1037227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2504 | Open in IMG/M |
3300026335|Ga0209804_1064868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1745 | Open in IMG/M |
3300026343|Ga0209159_1004189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 9382 | Open in IMG/M |
3300026524|Ga0209690_1218510 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 601 | Open in IMG/M |
3300026529|Ga0209806_1227162 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 634 | Open in IMG/M |
3300026536|Ga0209058_1098455 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1486 | Open in IMG/M |
3300026538|Ga0209056_10274345 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1183 | Open in IMG/M |
3300026542|Ga0209805_1046564 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2174 | Open in IMG/M |
3300026542|Ga0209805_1121507 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1233 | Open in IMG/M |
3300026550|Ga0209474_10015077 | All Organisms → cellular organisms → Bacteria | 6104 | Open in IMG/M |
3300026550|Ga0209474_10504475 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 613 | Open in IMG/M |
3300027587|Ga0209220_1040582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1245 | Open in IMG/M |
3300027738|Ga0208989_10122986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 879 | Open in IMG/M |
3300027862|Ga0209701_10245784 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1048 | Open in IMG/M |
3300027875|Ga0209283_10512189 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 771 | Open in IMG/M |
3300027882|Ga0209590_10082842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1878 | Open in IMG/M |
3300028536|Ga0137415_10223952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1694 | Open in IMG/M |
3300028536|Ga0137415_10442084 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1106 | Open in IMG/M |
3300028536|Ga0137415_10621701 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 892 | Open in IMG/M |
3300028713|Ga0307303_10040643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 962 | Open in IMG/M |
3300028718|Ga0307307_10030559 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1528 | Open in IMG/M |
3300028796|Ga0307287_10306420 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 600 | Open in IMG/M |
3300028824|Ga0307310_10066966 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1534 | Open in IMG/M |
3300028828|Ga0307312_10737831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 652 | Open in IMG/M |
3300028881|Ga0307277_10019995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2619 | Open in IMG/M |
3300028881|Ga0307277_10077612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1386 | Open in IMG/M |
3300031421|Ga0308194_10028960 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1286 | Open in IMG/M |
3300031720|Ga0307469_10111940 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1950 | Open in IMG/M |
3300032180|Ga0307471_100176386 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 2101 | Open in IMG/M |
3300032180|Ga0307471_100441531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1439 | Open in IMG/M |
3300032180|Ga0307471_102395503 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 667 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 23.65% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 21.67% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 10.84% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 9.36% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 7.88% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 4.43% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 3.94% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.96% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.46% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.46% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.97% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 1.48% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.48% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.48% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.99% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.49% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.49% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001359 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A30-35cm)- 6 month illumina | Environmental | Open in IMG/M |
3300002560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm | Environmental | Open in IMG/M |
3300002912 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005166 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_123 | Environmental | Open in IMG/M |
3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005172 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 | Environmental | Open in IMG/M |
3300005174 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 | Environmental | Open in IMG/M |
3300005175 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 | Environmental | Open in IMG/M |
3300005176 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 | Environmental | Open in IMG/M |
3300005179 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_133 | Environmental | Open in IMG/M |
3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
3300005186 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_125 | Environmental | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005446 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_135 | Environmental | Open in IMG/M |
3300005447 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 | Environmental | Open in IMG/M |
3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
3300005553 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 | Environmental | Open in IMG/M |
3300005555 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_141 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005568 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 | Environmental | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
3300006797 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300010323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300010336 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_5_09082015 | Environmental | Open in IMG/M |
3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
3300012003 | Permafrost microbial communities from Nunavut, Canada - A20_80cm_0.25M | Environmental | Open in IMG/M |
3300012010 | Permafrost microbial communities from Nunavut, Canada - A7_35cm_12M | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012206 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_100_16 metaG | Environmental | Open in IMG/M |
3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012925 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012976 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_5_0_1 metaG | Environmental | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300013766 | Permafrost microbial communities from Nunavut, Canada - A26_65cm_6M | Environmental | Open in IMG/M |
3300015356 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300017654 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
3300017659 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_5_24_1 metaG | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019885 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1m2 | Environmental | Open in IMG/M |
3300020001 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a2 | Environmental | Open in IMG/M |
3300020022 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1s2 | Environmental | Open in IMG/M |
3300021080 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_coex redo | Environmental | Open in IMG/M |
3300021344 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a2 | Environmental | Open in IMG/M |
3300021418 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3s2 | Environmental | Open in IMG/M |
3300022534 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_b1 | Environmental | Open in IMG/M |
3300022694 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coex | Environmental | Open in IMG/M |
3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026300 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_27_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026310 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_2_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026317 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 (SPAdes) | Environmental | Open in IMG/M |
3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
3300026322 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_136 (SPAdes) | Environmental | Open in IMG/M |
3300026325 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 (SPAdes) | Environmental | Open in IMG/M |
3300026327 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes) | Environmental | Open in IMG/M |
3300026328 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129 (SPAdes) | Environmental | Open in IMG/M |
3300026335 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 (SPAdes) | Environmental | Open in IMG/M |
3300026343 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_144 (SPAdes) | Environmental | Open in IMG/M |
3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
3300026529 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152 (SPAdes) | Environmental | Open in IMG/M |
3300026536 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_147 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300026542 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_148 (SPAdes) | Environmental | Open in IMG/M |
3300026550 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 (SPAdes) | Environmental | Open in IMG/M |
3300027587 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027738 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027862 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027875 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300027882 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes) | Environmental | Open in IMG/M |
3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
3300028713 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184 | Environmental | Open in IMG/M |
3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
3300028796 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_141 | Environmental | Open in IMG/M |
3300028824 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028881 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116 | Environmental | Open in IMG/M |
3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
A3035W6_10559172 | 3300001359 | Permafrost | PSLARLRAQMEKRPVDLGTRDSTLVFAVLLLGIAAISASVLIVILVVTGATSVR* |
JGI25383J37093_100914022 | 3300002560 | Grasslands Soil | MKKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSASSTVR* |
JGI25386J43895_101979191 | 3300002912 | Grasslands Soil | AQITKLRGQMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSASSTVR* |
Ga0062589_1018528652 | 3300004156 | Soil | MEKRPVDLGTRDGTLVFTVLLLGIFAISASVLIVILVVSAAAPPR* |
Ga0066674_100082825 | 3300005166 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGATPVR* |
Ga0066674_101301442 | 3300005166 | Soil | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVILVVTGVTSVR* |
Ga0066672_100379663 | 3300005167 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSASTTVR* |
Ga0066677_103542752 | 3300005171 | Soil | MEKRPIDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSGATLVR* |
Ga0066677_105578481 | 3300005171 | Soil | PYMEKRPIDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGATPVR* |
Ga0066677_106342572 | 3300005171 | Soil | MGDLPHEITKLRGHMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSASTTVR* |
Ga0066683_102281631 | 3300005172 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLFVVLVVSG |
Ga0066683_104951432 | 3300005172 | Soil | MEKRPVDLGTRDSAVVFSVLLLGIFAISASVLIVILVVTGATSVR* |
Ga0066680_100091564 | 3300005174 | Soil | MEKRPVDLGSRDGTLVFTVLLLGIFAISASVLFVVLVVSGATPVR* |
Ga0066680_100634731 | 3300005174 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSAS |
Ga0066673_103628242 | 3300005175 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGAAPPR* |
Ga0066673_103667491 | 3300005175 | Soil | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVILLVSGANPIR* |
Ga0066679_100239815 | 3300005176 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVILVVSGATPVR* |
Ga0066679_105172822 | 3300005176 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLFVVLVVSGGTPVR* |
Ga0066684_104613501 | 3300005179 | Soil | MGYLLSLIGTLRAQMEKRPVDLGTRDSALVFAVLLLGIFAISASVLIVILVVSGANPIR* |
Ga0066678_108838202 | 3300005181 | Soil | MEKRPVDLGSRDGTLVFAVLLLGIFAISASVLFVVLVVSGATPVR* |
Ga0066676_100749013 | 3300005186 | Soil | IDRLRAQMEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVVLVVSGASPVR* |
Ga0065705_103162042 | 3300005294 | Switchgrass Rhizosphere | MEKRPVDLGTRDSTVVFAVLLLGIFAISASVLIVILVVTGATSVR* |
Ga0070703_102511113 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVSGSTPVR* |
Ga0070705_1005018091 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDGTLVFTVLLLGIFAISASVLIVILVVSAANPPR* |
Ga0070694_1001953621 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | VEKRPVDLGTRDGTVVFAVLLLGIFTISASVLVVILVVNGAAPVR* |
Ga0070708_1003827752 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | CPYMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGATPVR* |
Ga0066686_100916241 | 3300005446 | Soil | TPPDGGLASRISRLRGRMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSAGTTVR* |
Ga0066686_101165873 | 3300005446 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLFVVLVVSGATPVR* |
Ga0066689_106731821 | 3300005447 | Soil | MEKRPIDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGATPVR* |
Ga0066689_110380591 | 3300005447 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSAGTTVR* |
Ga0066682_104975012 | 3300005450 | Soil | LRKASVDFGPQMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSGAAPPR* |
Ga0066682_109322021 | 3300005450 | Soil | MGRLRAQMEKRPVDPGTRDSAVVFAVLLLGIFAISASVLIVVL |
Ga0066681_109402232 | 3300005451 | Soil | MISRLRAHMEKRPVDLGSRDSAVVFAVLLLGIFAISASVLIVILVVTGVTSVR* |
Ga0070681_118806791 | 3300005458 | Corn Rhizosphere | DLGTRDGTLVFTVLLLGIFAISASVLIVILVVSAAAPPR* |
Ga0070706_1001921333 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | VEKRPVDLGTRDGTVVFAVLLLGIFTISASVLVVILVVNAAAPVR* |
Ga0070706_1013807512 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDGTLVFAVLLLGIAAISASVLIVILVVSAGTTVR* |
Ga0070707_1000086939 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLTVILVVSGSTTVR* |
Ga0070698_1014958972 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | GQMEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVSGSTTVR* |
Ga0070699_1003969251 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | IGRLRAQMEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILAVTTATSVR* |
Ga0070697_1002662072 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVSGSTTVR* |
Ga0070696_1013340792 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDGTVVFAILLLGIFAISASVLVVILVVTSGLRVAH* |
Ga0066695_100923143 | 3300005553 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVS |
Ga0066695_102337541 | 3300005553 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLFVVLVVSGAT |
Ga0066692_102121841 | 3300005555 | Soil | RPVDLGTRDSAVVFAVLLLGIFAISASVLIVVLVVSGASPVR* |
Ga0066692_107737152 | 3300005555 | Soil | RDGTLVFAVLLLGIFAISASVLIVVLVVSASSTVR* |
Ga0066707_101382061 | 3300005556 | Soil | MEKRPVDLGSRDGTLVFAVLLLGIFAISASVLVVILVVSGATPVR* |
Ga0066707_103248322 | 3300005556 | Soil | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVVLVVSGASPVR* |
Ga0066703_101708392 | 3300005568 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIAAISASVLIVILAVTAGTTVR* |
Ga0066703_104213281 | 3300005568 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSAST |
Ga0068854_1000582052 | 3300005578 | Corn Rhizosphere | VDLGTRDGTLVFTVLLLGIFAISASVLIVILVVSAAAPPR* |
Ga0066652_1001335373 | 3300006046 | Soil | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVVLVVSGASQVR* |
Ga0066653_100613503 | 3300006791 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGAT |
Ga0066658_102400552 | 3300006794 | Soil | MEKRPIDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSGATPVR* |
Ga0066665_105856622 | 3300006796 | Soil | MEKRPVDLSTRDSALVFAVLLLGIFAISASVLTVVLVVSGSSPVR* |
Ga0066659_105852932 | 3300006797 | Soil | SVGGTPVLPRMGDLPHEITKLRGHMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSASTTVR* |
Ga0075425_1005333352 | 3300006854 | Populus Rhizosphere | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGTTPAR* |
Ga0075425_1022303982 | 3300006854 | Populus Rhizosphere | MEKRPVDLGTRDGTVVFAVLLLGIFAISASVLVVILLVNGAAPVR* |
Ga0079217_108704421 | 3300006876 | Agricultural Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISAAVLVVILI |
Ga0075435_1003977242 | 3300007076 | Populus Rhizosphere | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVTGSTTVR* |
Ga0099791_104747331 | 3300007255 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGATPVR* |
Ga0099793_103204132 | 3300007258 | Vadose Zone Soil | MEQRPVDLGTRDGTLVFAVLLLGIFAISAVVLIVILLVTAGTTVR* |
Ga0066710_1002637792 | 3300009012 | Grasslands Soil | MNKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGATPVR |
Ga0066710_1002860671 | 3300009012 | Grasslands Soil | EKRPVDLGTRDGTLVFAVLLLGIFAISASELVVILVLSGATPVR |
Ga0066710_1003274631 | 3300009012 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSAGTTVR |
Ga0066710_1012851802 | 3300009012 | Grasslands Soil | MGDLPHEITKLRARMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSASTTVR |
Ga0066710_1014866062 | 3300009012 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLTVVLVVSGAAPPR |
Ga0066710_1028272941 | 3300009012 | Grasslands Soil | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVVLVVSGASPVR |
Ga0099829_112575862 | 3300009038 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGATPAR* |
Ga0099830_112363501 | 3300009088 | Vadose Zone Soil | MEKRPVDLGSRDSTLVFAVLLLGIFAISASVLTVILVVSGAAPPR* |
Ga0099828_102572822 | 3300009089 | Vadose Zone Soil | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLTVILVVSGAAPPI* |
Ga0099827_101013202 | 3300009090 | Vadose Zone Soil | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLTVVLVVSGASQVR* |
Ga0099827_101297633 | 3300009090 | Vadose Zone Soil | MEKHPVDLGTRDGTVVFAVLLLGIFAISASVLIVVLVVTGATTVR* |
Ga0066709_1001200045 | 3300009137 | Grasslands Soil | MNKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGATPVR* |
Ga0114129_105631052 | 3300009147 | Populus Rhizosphere | MDKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSAVSPPR* |
Ga0114129_106151172 | 3300009147 | Populus Rhizosphere | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSAVSPPH* |
Ga0075423_109599322 | 3300009162 | Populus Rhizosphere | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILV |
Ga0134086_102433752 | 3300010323 | Grasslands Soil | MDKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSGAAPPR* |
Ga0134065_100602103 | 3300010326 | Grasslands Soil | HMEKRPVDLGSRDSTVVFAVLLLGIFAISASVLIVILVVTGVTSVR* |
Ga0134071_104270662 | 3300010336 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLLVSAGTTVR* |
Ga0134062_101804911 | 3300010337 | Grasslands Soil | RPVDLGSRDSAVVFAVLLLGIFAISASVLIVILVVTGVTSVR* |
Ga0134127_108876921 | 3300010399 | Terrestrial Soil | RPVDLGTRDGTLVFTVLLLGIFAISASVLIVILVVSAANPPR* |
Ga0134127_117609772 | 3300010399 | Terrestrial Soil | VEKRPVDLGTRDGTVVFAILLLGIFAISASVLVVILVVTSGLRVAH* |
Ga0134121_104753681 | 3300010401 | Terrestrial Soil | DLGTRDGTLVFTVLLLGIFAISASVLIVILVVSAANPPR* |
Ga0137393_107262442 | 3300011271 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLMVVLVVSGATPVR* |
Ga0120163_10856892 | 3300012003 | Permafrost | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSAAAPPR* |
Ga0120118_10324913 | 3300012010 | Permafrost | MEKRPVDLGSRDSTLVFAVLLLGIFAMSASVLIVILVVTGATSVR* |
Ga0137389_106560992 | 3300012096 | Vadose Zone Soil | MQKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVTGSTTVR* |
Ga0137389_107099742 | 3300012096 | Vadose Zone Soil | MDKRPVDLGTRDSAVVFAVLLLGIFAISASVLTVVLVVSGASAVR* |
Ga0137388_104597672 | 3300012189 | Vadose Zone Soil | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLVVILVVSGSTPVR* |
Ga0137388_116818901 | 3300012189 | Vadose Zone Soil | MQKRPVDLGTRDGTLVFAVLLLGIFAISASVLMVVLVVSGATPVR* |
Ga0137364_100921822 | 3300012198 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLFVVLVVSGATPIR* |
Ga0137364_104186662 | 3300012198 | Vadose Zone Soil | MEKRPVDLGSRDSTVVFAVLLLGIFAISASVLIVILLVSGANPIR* |
Ga0137382_109253992 | 3300012200 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGSAPPR* |
Ga0137363_103598552 | 3300012202 | Vadose Zone Soil | MEKRPVDLGTRDSTVVFAILLLGIFAISASVLIVILAVTTATSVR* |
Ga0137399_100190952 | 3300012203 | Vadose Zone Soil | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVTGTTSVR* |
Ga0137399_100581941 | 3300012203 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSG |
Ga0137399_101447833 | 3300012203 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSASTTVR* |
Ga0137380_101377043 | 3300012206 | Vadose Zone Soil | MEKRPVDLGTRDSALVFAVLLLGIFAISASVLIVILVVSGSTTVR* |
Ga0137381_105586232 | 3300012207 | Vadose Zone Soil | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVTGATSVR* |
Ga0137376_100478224 | 3300012208 | Vadose Zone Soil | MEKRPVDLGSRDSTVVFAVLLLGIFAISASVLIVILVVTGVTSVR* |
Ga0137379_107598551 | 3300012209 | Vadose Zone Soil | MEKRPVDLGSRDGTLVFAVLLLGIFAISASVLVVVLVVTGATSVR* |
Ga0137378_110039982 | 3300012210 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVTGATSVR* |
Ga0137377_101867972 | 3300012211 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGTTPIR* |
Ga0137377_112779672 | 3300012211 | Vadose Zone Soil | MDKRTVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGATPVR* |
Ga0137377_116078052 | 3300012211 | Vadose Zone Soil | MEKRPVDLGTRDSSVVFAVLLLGIFAISASVLIVVLVVSGAAPPR* |
Ga0137361_108265142 | 3300012362 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGTTPTR* |
Ga0137396_100269726 | 3300012918 | Vadose Zone Soil | MQKRTVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVTGTTSVR* |
Ga0137396_100414425 | 3300012918 | Vadose Zone Soil | MEKRPVDLGTGDGTLVFAVLLLGIFAISASVLVVVLVVSGATPIR* |
Ga0137396_105366643 | 3300012918 | Vadose Zone Soil | MEKRPLDLGTGDGTLVFAVLLLGIFAISASVLVVVLVVSGATPIR* |
Ga0137396_110116632 | 3300012918 | Vadose Zone Soil | MQKPPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSASTTVR* |
Ga0137394_107872372 | 3300012922 | Vadose Zone Soil | MEKRPVDLGSRDSTVVFAVLLLGIFAISASVLIVILVVTGATSVR* |
Ga0137359_108134742 | 3300012923 | Vadose Zone Soil | MEKRPVDLGTRDSAVVFSVLLLGIFAISASVLIVILVVSGASPVR* |
Ga0137419_109297441 | 3300012925 | Vadose Zone Soil | GTRDSTLVFAVLLLGIFAISASVLIVILVVSGANPIR* |
Ga0137416_116448231 | 3300012927 | Vadose Zone Soil | RPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGTTPIR* |
Ga0137407_104406882 | 3300012930 | Vadose Zone Soil | MEKRPVDLGSRDSTLVFAVLLLGIFAISASVLIVILVVTGATSVR* |
Ga0137410_104574192 | 3300012944 | Vadose Zone Soil | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVTGTTTVR* |
Ga0134076_104146122 | 3300012976 | Grasslands Soil | MDKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSGAAPRR* |
Ga0120172_11575211 | 3300013765 | Permafrost | QMEKRPVDLGTRDSTLVFAVLLLGIAAISASVLIVILVVTGATSVR* |
Ga0120181_10032328 | 3300013766 | Permafrost | MEKRPVDLGTRDSTLVFAVLLLGIAAISASVLIVILVVTGATSVR* |
Ga0134073_101991062 | 3300015356 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLFVVL |
Ga0134069_13528072 | 3300017654 | Grasslands Soil | VDLGTRDGTLVFAVLLLGIFAISASVLFVVLVVSGATPVR |
Ga0134074_10823572 | 3300017657 | Grasslands Soil | MDKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSGAAPPR |
Ga0134083_100476262 | 3300017659 | Grasslands Soil | MERRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSAGTTVR |
Ga0184605_100068994 | 3300018027 | Groundwater Sediment | MEKRPVDLGTRDSALVFAVLLLGIFAISASVLIVVLLVTGATSVR |
Ga0184605_100102762 | 3300018027 | Groundwater Sediment | MISRLRAHMEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVSASAPPR |
Ga0184605_100990082 | 3300018027 | Groundwater Sediment | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVILVVSGATPVR |
Ga0184605_105031301 | 3300018027 | Groundwater Sediment | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVILVVTGTTTVH |
Ga0184608_103051852 | 3300018028 | Groundwater Sediment | MEKRPVDLGTRDSTVVFAILLLGIFAISASVLIVILLVSGATPAR |
Ga0184608_103722021 | 3300018028 | Groundwater Sediment | MISRLRAHMEKRPVDLGTRDSALVFAVLLLGIFAISASVLVVILVVTAGTSGVTH |
Ga0184620_101451572 | 3300018051 | Groundwater Sediment | MEKRPVDLGSRDSTVVFAVLLLGIFAISASVLIVILVVTGTTTVH |
Ga0184619_104911302 | 3300018061 | Groundwater Sediment | QMEKRPVDLGTRDSALVFAVLLLGIFAISASVLIVVLVVSGANPIR |
Ga0066655_101226482 | 3300018431 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLFVVLVVSGATPVR |
Ga0066655_101870713 | 3300018431 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGATPVR |
Ga0066667_116555041 | 3300018433 | Grasslands Soil | MEKRPVDLGSRDGTLVFAVLLLGIFAISASVLVVILVVSGATPVR |
Ga0066662_101472082 | 3300018468 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSASTTVR |
Ga0066662_101692172 | 3300018468 | Grasslands Soil | MEKRPVDLGSRDGTLVFAVLLLGIFAISASVLFVVLVVSGATPVR |
Ga0066669_102878212 | 3300018482 | Grasslands Soil | MISRLRAHMEKRPVDLGSRDSTVVFAVLLLGIFAISASVLIVILVVTGVTSVR |
Ga0066669_112023242 | 3300018482 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVV |
Ga0066669_123999072 | 3300018482 | Grasslands Soil | MARLRAQMEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVILLVSGANPIR |
Ga0193723_10666151 | 3300019879 | Soil | MEKRPVDLGTRDSTVVFAILLLGIFAISASVLTVILLVSGATPAR |
Ga0193725_11067471 | 3300019883 | Soil | MEKRPVDLGTRDSTVVFAILLLGIFAISASVLTVILLVSGATSAR |
Ga0193747_10254452 | 3300019885 | Soil | MAKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVILVVTSSTTVH |
Ga0193731_10061052 | 3300020001 | Soil | MGYLPSLIGRLRVQMEKRPVDLGTRDSALVLGIFAISASVLIVVLVVSGANPIR |
Ga0193733_10792631 | 3300020022 | Soil | MGYLPSLIGRLRVQMEKRPVDLGTRDSALVFAVLLLGIFAISASVLIVVLLVSGANPIR |
Ga0210382_101270192 | 3300021080 | Groundwater Sediment | EKRPVDLGTRDSALVFAVLLLGIFAISASVLIVVLLVTGATSVR |
Ga0210382_102032522 | 3300021080 | Groundwater Sediment | MEQRPVDLGTRDSTLVFAVLLLGIFAISASVLVVILVVTAGTSGVTH |
Ga0210382_104052422 | 3300021080 | Groundwater Sediment | LRARMEKRPVDLGTRDSALVFAVLLLGIFAISASVLIVILVVTASTGVTH |
Ga0193719_100723562 | 3300021344 | Soil | MGYLPSLIGRLRVQMEKRPVDLGTRDSALVFAVLLLGIFAISASVLIVVLVVSGANPIR |
Ga0193719_102379972 | 3300021344 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVTAGTGVAH |
Ga0193695_10527381 | 3300021418 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSGATPTR |
Ga0224452_10119393 | 3300022534 | Groundwater Sediment | MISRLRAHMEKRPVDLGTRDSALVFAVLLLGIFAISASVLIVILVVTASTGVTH |
Ga0222623_100848441 | 3300022694 | Groundwater Sediment | RSGRGYPGTTPDGGLAGGISRLRAHMEQRPVDLGTRDSTLVFAVLLLGIFAISASVLVVILVVTAGTSGVTH |
Ga0222622_113776531 | 3300022756 | Groundwater Sediment | MEKRPVDLGSRDSTVVFAVLLLGIFAISASVLIVILVVTGATSVR |
Ga0207653_102560462 | 3300025885 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVSGSTPVR |
Ga0207684_100868264 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VEKRPVDLGTRDGTVVFAVLLLGIFAISASVLVVILVVNGAAPVR |
Ga0207684_102516043 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | VEKRPVDLGTRDGTVVFAVLLLGIFTISASVLVVILVVNAAAPVR |
Ga0207684_105068362 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVSGSTTVR |
Ga0207684_111832542 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDGTLVFAVLLLGIAAISASVLIVILVVSAGTTVR |
Ga0207646_100052514 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | VEKRPVDLGTRDGTVVFAVLLLGIFTISASVLVVILVVNGAAPVR |
Ga0207646_100106029 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLTVILVVSGSTTVR |
Ga0207646_111092101 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVV |
Ga0207667_108683741 | 3300025949 | Corn Rhizosphere | VDLGTRDGTLVFTVLLLGIFAISASVLIVILVVSAAAPPR |
Ga0209235_10276803 | 3300026296 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSASSTVR |
Ga0209027_10091791 | 3300026300 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVILVVSGAAPPR |
Ga0209027_11179712 | 3300026300 | Grasslands Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVILVVSGATPVR |
Ga0209027_11223472 | 3300026300 | Grasslands Soil | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVILLVSGANPIR |
Ga0209239_11081612 | 3300026310 | Grasslands Soil | MEKRPVDLGSRDSTVVFAVLLLGIFAISASVLIVILVVTGVTSVR |
Ga0209154_10905312 | 3300026317 | Soil | MGDLPHEITKLRGHMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSASTTVR |
Ga0209471_13369731 | 3300026318 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLAVSGATPIR |
Ga0209687_11664082 | 3300026322 | Soil | TSRLYMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLFVVLVVSGGTPVR |
Ga0209152_100562081 | 3300026325 | Soil | EITKLRGHMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSASTTVR |
Ga0209266_10279244 | 3300026327 | Soil | TSRPYMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGATPVR |
Ga0209802_10372274 | 3300026328 | Soil | MEKRPVDLGSRDGTLVFTVLLLGIFAISASVLFVVLMVSGATPVR |
Ga0209804_10648682 | 3300026335 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLFVVLVVSGGTPVR |
Ga0209159_10041894 | 3300026343 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLFVVLVVSGATPLR |
Ga0209690_12185101 | 3300026524 | Soil | GTRDGTLVFAVLLLGIFAISASVLFVVLVVSGATPVR |
Ga0209806_12271622 | 3300026529 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIAAISASVLIVILAVTAGTTVR |
Ga0209058_10984552 | 3300026536 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSAGTTVR |
Ga0209056_102743451 | 3300026538 | Soil | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLIVVLVVSG |
Ga0209805_10465642 | 3300026542 | Soil | MEKRPIDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSGATLVR |
Ga0209805_11215072 | 3300026542 | Soil | MEKRPIDLGTRDGTLVFAVLLLGIFAISASVLVVVLVVSGATPVR |
Ga0209474_100150771 | 3300026550 | Soil | MEKRPVDLSTRDGTLVFAVLLLGIFAISASVLFVVLVVSGATPVR |
Ga0209474_105044752 | 3300026550 | Soil | VEKRPVDITSHDDQVVFAILLLGIFAISFIVLAVILV |
Ga0209220_10405822 | 3300027587 | Forest Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVTSGLAR |
Ga0208989_101229861 | 3300027738 | Forest Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVTATAAPR |
Ga0209701_102457842 | 3300027862 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGATPAR |
Ga0209283_105121892 | 3300027875 | Vadose Zone Soil | MISRLRAHMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGATPAR |
Ga0209590_100828422 | 3300027882 | Vadose Zone Soil | MEKHPVDLGTRDGTVVFAVLLLGIFAISASVLIVVLVVTGATTVR |
Ga0137415_102239522 | 3300028536 | Vadose Zone Soil | MEKRPVDLGTRDSTLVFAVLLLGIFAISASVLIVILVVTGTTSVR |
Ga0137415_104420843 | 3300028536 | Vadose Zone Soil | MEKRPVDLGTGDGTLVFAVLLLGIFAISASVLVVVLVVSGATPIR |
Ga0137415_106217013 | 3300028536 | Vadose Zone Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSGTTPR |
Ga0307303_100406432 | 3300028713 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVILVVSAGAPPR |
Ga0307307_100305591 | 3300028718 | Soil | ARKYIGRLRAQMEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVTAGTGVAH |
Ga0307287_103064202 | 3300028796 | Soil | AHMEKRPVDLGTRDSALVFAVLLLGIFAISASVLIVILVVTASTGVTH |
Ga0307310_100669663 | 3300028824 | Soil | MEKRPVDLGTRDSTVVFAILLLGIFAISASVLTVILVVTGATARP |
Ga0307312_107378312 | 3300028828 | Soil | MEKRPVDLGTRDGTLVFAVLLLGIFAISASVLIVVLVVSGTTPTR |
Ga0307277_100199952 | 3300028881 | Soil | MEKRPVDLGSRDSTLVFAVLLLGIFAISASVLIVILVVTGTTSVR |
Ga0307277_100776122 | 3300028881 | Soil | MEKRPVDLGTRDSALVFAVLLLGIFAISASVLIVVLVVSGANPIR |
Ga0308194_100289603 | 3300031421 | Soil | RPVDLGTRDSALVFAVLLLGIFAISASVLIVVLVVSGANPIR |
Ga0307469_101119403 | 3300031720 | Hardwood Forest Soil | MEKRPVDLGTRDSTVVFAILLLGIFAISASVLIVILAVTTATSVR |
Ga0307471_1001763863 | 3300032180 | Hardwood Forest Soil | MEKRPVDLGTRDSTVVFAILLLGIFAISASVLIVILAVTTATTVR |
Ga0307471_1004415312 | 3300032180 | Hardwood Forest Soil | MEKRPVDLGTRDSAVVFAVLLLGIFAISASVLVVILVVTTATSVR |
Ga0307471_1023955032 | 3300032180 | Hardwood Forest Soil | MEKRPVDLGTRDGTLVFAVLLLGIAAISASVLIVILLVSAGTTVR |
⦗Top⦘ |