| Basic Information | |
|---|---|
| Family ID | F025124 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 203 |
| Average Sequence Length | 45 residues |
| Representative Sequence | PIEMTVQGRVGDSHKQIRGKVRGGGPLLRVRTGSGDIHIQ |
| Number of Associated Samples | 169 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.49 % |
| % of genes near scaffold ends (potentially truncated) | 98.03 % |
| % of genes from short scaffolds (< 2000 bps) | 88.18 % |
| Associated GOLD sequencing projects | 163 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.22 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (97.537 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (13.301 % of family members) |
| Environment Ontology (ENVO) | Unclassified (25.616 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (55.665 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.22 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 203 Family Scaffolds |
|---|---|---|
| PF12704 | MacB_PCD | 58.62 |
| PF01887 | SAM_HAT_N | 21.18 |
| PF13349 | DUF4097 | 1.48 |
| PF14559 | TPR_19 | 1.48 |
| PF02954 | HTH_8 | 1.48 |
| PF01979 | Amidohydro_1 | 0.99 |
| PF01740 | STAS | 0.99 |
| PF00248 | Aldo_ket_red | 0.99 |
| PF13185 | GAF_2 | 0.49 |
| PF13590 | DUF4136 | 0.49 |
| PF02687 | FtsX | 0.49 |
| PF02518 | HATPase_c | 0.49 |
| PF00437 | T2SSE | 0.49 |
| PF14720 | NiFe_hyd_SSU_C | 0.49 |
| PF13884 | Peptidase_S74 | 0.49 |
| PF02780 | Transketolase_C | 0.49 |
| PF12146 | Hydrolase_4 | 0.49 |
| PF01609 | DDE_Tnp_1 | 0.49 |
| PF00903 | Glyoxalase | 0.49 |
| PF12732 | YtxH | 0.49 |
| PF13103 | TonB_2 | 0.49 |
| PF13345 | Obsolete Pfam Family | 0.49 |
| PF00873 | ACR_tran | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
|---|---|---|---|
| COG1912 | Stereoselective (R,S)-S-adenosylmethionine hydrolase (adenosine-forming) | Defense mechanisms [V] | 21.18 |
| COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.49 |
| COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.49 |
| COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.49 |
| COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.49 |
| COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.49 |
| COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 97.54 % |
| Unclassified | root | N/A | 2.46 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300001082|JGI12664J13189_1006344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 804 | Open in IMG/M |
| 3300001356|JGI12269J14319_10215222 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 742 | Open in IMG/M |
| 3300001546|JGI12659J15293_10113889 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 587 | Open in IMG/M |
| 3300001593|JGI12635J15846_10274003 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1070 | Open in IMG/M |
| 3300002245|JGIcombinedJ26739_100195075 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1915 | Open in IMG/M |
| 3300004091|Ga0062387_100095459 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1584 | Open in IMG/M |
| 3300004092|Ga0062389_102394144 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 698 | Open in IMG/M |
| 3300004631|Ga0058899_11411393 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 669 | Open in IMG/M |
| 3300005458|Ga0070681_10620673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 996 | Open in IMG/M |
| 3300005468|Ga0070707_101448593 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 653 | Open in IMG/M |
| 3300005538|Ga0070731_10326405 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter | 1019 | Open in IMG/M |
| 3300005542|Ga0070732_10042430 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2616 | Open in IMG/M |
| 3300005556|Ga0066707_10383600 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 916 | Open in IMG/M |
| 3300005764|Ga0066903_103490769 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 847 | Open in IMG/M |
| 3300005844|Ga0068862_100097635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium | 2565 | Open in IMG/M |
| 3300005921|Ga0070766_10918679 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 600 | Open in IMG/M |
| 3300005994|Ga0066789_10361693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 606 | Open in IMG/M |
| 3300006028|Ga0070717_12007030 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 521 | Open in IMG/M |
| 3300006052|Ga0075029_100110412 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1659 | Open in IMG/M |
| 3300006059|Ga0075017_100022222 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4127 | Open in IMG/M |
| 3300006162|Ga0075030_101262774 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 580 | Open in IMG/M |
| 3300006172|Ga0075018_10671853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 557 | Open in IMG/M |
| 3300006176|Ga0070765_100188940 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1863 | Open in IMG/M |
| 3300006354|Ga0075021_10095731 | All Organisms → cellular organisms → Bacteria | 1760 | Open in IMG/M |
| 3300006794|Ga0066658_10419493 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 728 | Open in IMG/M |
| 3300006893|Ga0073928_10465641 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 912 | Open in IMG/M |
| 3300007076|Ga0075435_101008185 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 727 | Open in IMG/M |
| 3300009038|Ga0099829_11497899 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
| 3300009088|Ga0099830_10066848 | All Organisms → cellular organisms → Bacteria | 2593 | Open in IMG/M |
| 3300009090|Ga0099827_12005486 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 502 | Open in IMG/M |
| 3300009092|Ga0105250_10128943 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1043 | Open in IMG/M |
| 3300009524|Ga0116225_1232343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 830 | Open in IMG/M |
| 3300009552|Ga0116138_1128494 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300009624|Ga0116105_1021161 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1367 | Open in IMG/M |
| 3300009624|Ga0116105_1090684 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 753 | Open in IMG/M |
| 3300009665|Ga0116135_1039498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1627 | Open in IMG/M |
| 3300009784|Ga0123357_10759740 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 671 | Open in IMG/M |
| 3300009839|Ga0116223_10223116 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1144 | Open in IMG/M |
| 3300009839|Ga0116223_10280139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 999 | Open in IMG/M |
| 3300010046|Ga0126384_10009262 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 6087 | Open in IMG/M |
| 3300010047|Ga0126382_10663463 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 869 | Open in IMG/M |
| 3300010339|Ga0074046_10031663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3605 | Open in IMG/M |
| 3300010341|Ga0074045_10012426 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia | 6983 | Open in IMG/M |
| 3300010360|Ga0126372_11380516 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 736 | Open in IMG/M |
| 3300010361|Ga0126378_10171291 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2230 | Open in IMG/M |
| 3300010361|Ga0126378_11527855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
| 3300010361|Ga0126378_13168094 | All Organisms → cellular organisms → Bacteria | 523 | Open in IMG/M |
| 3300010379|Ga0136449_101749371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Candidatus Eremiobacterota → unclassified Candidatus Eremiobacteraeota → Candidatus Eremiobacteraeota bacterium | 934 | Open in IMG/M |
| 3300010866|Ga0126344_1021506 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 590 | Open in IMG/M |
| 3300011120|Ga0150983_10606194 | Not Available | 545 | Open in IMG/M |
| 3300011120|Ga0150983_14570170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1968 | Open in IMG/M |
| 3300011270|Ga0137391_10431410 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1123 | Open in IMG/M |
| 3300012096|Ga0137389_11411253 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 592 | Open in IMG/M |
| 3300012201|Ga0137365_11089084 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 576 | Open in IMG/M |
| 3300012357|Ga0137384_10781227 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 773 | Open in IMG/M |
| 3300012683|Ga0137398_10259490 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1159 | Open in IMG/M |
| 3300012917|Ga0137395_10436445 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 940 | Open in IMG/M |
| 3300012927|Ga0137416_12137920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 514 | Open in IMG/M |
| 3300012955|Ga0164298_10805854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 672 | Open in IMG/M |
| 3300012989|Ga0164305_10545398 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 921 | Open in IMG/M |
| 3300014156|Ga0181518_10592565 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300014169|Ga0181531_10070782 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2057 | Open in IMG/M |
| 3300014489|Ga0182018_10249079 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 978 | Open in IMG/M |
| 3300014493|Ga0182016_10368841 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 858 | Open in IMG/M |
| 3300014968|Ga0157379_12513215 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300015372|Ga0132256_103750269 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 511 | Open in IMG/M |
| 3300016294|Ga0182041_11472994 | All Organisms → cellular organisms → Bacteria | 626 | Open in IMG/M |
| 3300016404|Ga0182037_11810671 | All Organisms → cellular organisms → Bacteria | 546 | Open in IMG/M |
| 3300017822|Ga0187802_10322542 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 604 | Open in IMG/M |
| 3300017823|Ga0187818_10582295 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 505 | Open in IMG/M |
| 3300017941|Ga0187850_10406510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
| 3300017943|Ga0187819_10787952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 534 | Open in IMG/M |
| 3300017948|Ga0187847_10498064 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 675 | Open in IMG/M |
| 3300017970|Ga0187783_10229665 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1359 | Open in IMG/M |
| 3300017973|Ga0187780_10508496 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatobacter → unclassified Candidatus Sulfotelmatobacter → Candidatus Sulfotelmatobacter sp. SbA7 | 861 | Open in IMG/M |
| 3300017975|Ga0187782_10838806 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
| 3300017994|Ga0187822_10364910 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 524 | Open in IMG/M |
| 3300018004|Ga0187865_1123249 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
| 3300018006|Ga0187804_10156559 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 962 | Open in IMG/M |
| 3300018009|Ga0187884_10039962 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2259 | Open in IMG/M |
| 3300018013|Ga0187873_1103115 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1127 | Open in IMG/M |
| 3300018024|Ga0187881_10276327 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
| 3300018025|Ga0187885_10226074 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 860 | Open in IMG/M |
| 3300018025|Ga0187885_10419466 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 599 | Open in IMG/M |
| 3300018033|Ga0187867_10193948 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1157 | Open in IMG/M |
| 3300018047|Ga0187859_10148193 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1243 | Open in IMG/M |
| 3300018088|Ga0187771_11006243 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 707 | Open in IMG/M |
| 3300018088|Ga0187771_11523771 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300018090|Ga0187770_10347585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
| 3300019273|Ga0187794_1606149 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 844 | Open in IMG/M |
| 3300019786|Ga0182025_1012898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 1500 | Open in IMG/M |
| 3300019786|Ga0182025_1031352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 841 | Open in IMG/M |
| 3300019786|Ga0182025_1116462 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 930 | Open in IMG/M |
| 3300019787|Ga0182031_1036953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1461 | Open in IMG/M |
| 3300020583|Ga0210401_10007415 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 11003 | Open in IMG/M |
| 3300020583|Ga0210401_10772270 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 821 | Open in IMG/M |
| 3300021168|Ga0210406_10038299 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4279 | Open in IMG/M |
| 3300021170|Ga0210400_10523446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 979 | Open in IMG/M |
| 3300021170|Ga0210400_10534314 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 968 | Open in IMG/M |
| 3300021178|Ga0210408_10015808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 6101 | Open in IMG/M |
| 3300021181|Ga0210388_10523083 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1040 | Open in IMG/M |
| 3300021181|Ga0210388_11509155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 561 | Open in IMG/M |
| 3300021402|Ga0210385_11295072 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 558 | Open in IMG/M |
| 3300021402|Ga0210385_11569822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 502 | Open in IMG/M |
| 3300021403|Ga0210397_11004902 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 647 | Open in IMG/M |
| 3300021406|Ga0210386_10821361 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 798 | Open in IMG/M |
| 3300021433|Ga0210391_10526854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 928 | Open in IMG/M |
| 3300021474|Ga0210390_10007461 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 9019 | Open in IMG/M |
| 3300021474|Ga0210390_10926245 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300021475|Ga0210392_10247502 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1262 | Open in IMG/M |
| 3300021475|Ga0210392_10840992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 686 | Open in IMG/M |
| 3300021478|Ga0210402_11737582 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300021479|Ga0210410_10137070 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 2177 | Open in IMG/M |
| 3300021479|Ga0210410_10640510 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 942 | Open in IMG/M |
| 3300021479|Ga0210410_11360912 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
| 3300021559|Ga0210409_11076368 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 679 | Open in IMG/M |
| 3300021560|Ga0126371_12479859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 628 | Open in IMG/M |
| 3300021858|Ga0213852_1387426 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300022518|Ga0224548_1029993 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 594 | Open in IMG/M |
| 3300022532|Ga0242655_10044760 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1069 | Open in IMG/M |
| 3300022557|Ga0212123_10074032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2918 | Open in IMG/M |
| 3300022557|Ga0212123_10756463 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
| 3300022717|Ga0242661_1099171 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 607 | Open in IMG/M |
| 3300022732|Ga0224569_104743 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1020 | Open in IMG/M |
| 3300022733|Ga0224562_1010047 | All Organisms → cellular organisms → Bacteria | 748 | Open in IMG/M |
| 3300023250|Ga0224544_1020718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 909 | Open in IMG/M |
| 3300023255|Ga0224547_1026368 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 746 | Open in IMG/M |
| 3300024220|Ga0224568_1014952 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 762 | Open in IMG/M |
| 3300025432|Ga0208821_1004373 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4424 | Open in IMG/M |
| 3300025941|Ga0207711_11013259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 770 | Open in IMG/M |
| 3300026078|Ga0207702_11608069 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 643 | Open in IMG/M |
| 3300026294|Ga0209839_10002944 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 8223 | Open in IMG/M |
| 3300026309|Ga0209055_1222948 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
| 3300026315|Ga0209686_1136686 | Not Available | 780 | Open in IMG/M |
| 3300026318|Ga0209471_1058065 | All Organisms → cellular organisms → Bacteria | 1768 | Open in IMG/M |
| 3300026333|Ga0209158_1119602 | Not Available | 987 | Open in IMG/M |
| 3300026854|Ga0207727_125020 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300027070|Ga0208365_1061126 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 508 | Open in IMG/M |
| 3300027168|Ga0208239_1011533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300027565|Ga0209219_1106854 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 687 | Open in IMG/M |
| 3300027570|Ga0208043_1161281 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
| 3300027681|Ga0208991_1140751 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 715 | Open in IMG/M |
| 3300027767|Ga0209655_10244062 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 586 | Open in IMG/M |
| 3300027787|Ga0209074_10519677 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 520 | Open in IMG/M |
| 3300027842|Ga0209580_10340135 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 747 | Open in IMG/M |
| 3300027842|Ga0209580_10652934 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300027854|Ga0209517_10030693 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 4518 | Open in IMG/M |
| 3300027867|Ga0209167_10327808 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 830 | Open in IMG/M |
| 3300027869|Ga0209579_10527614 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 641 | Open in IMG/M |
| 3300027884|Ga0209275_10079267 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1643 | Open in IMG/M |
| 3300027889|Ga0209380_10122441 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1513 | Open in IMG/M |
| 3300027889|Ga0209380_10156314 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 1334 | Open in IMG/M |
| 3300027894|Ga0209068_10170218 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1187 | Open in IMG/M |
| 3300027894|Ga0209068_10572594 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300027898|Ga0209067_10974786 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 500 | Open in IMG/M |
| 3300028138|Ga0247684_1063870 | Not Available | 601 | Open in IMG/M |
| 3300028666|Ga0265336_10156631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
| 3300028746|Ga0302233_10284878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 625 | Open in IMG/M |
| 3300028759|Ga0302224_10097199 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1132 | Open in IMG/M |
| 3300028759|Ga0302224_10160539 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
| 3300028759|Ga0302224_10179800 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
| 3300028906|Ga0308309_10481110 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1072 | Open in IMG/M |
| 3300029903|Ga0247271_100377 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 12584 | Open in IMG/M |
| 3300029910|Ga0311369_10007527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 13932 | Open in IMG/M |
| 3300029918|Ga0302143_1061605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 867 | Open in IMG/M |
| 3300029944|Ga0311352_11057607 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 622 | Open in IMG/M |
| 3300030007|Ga0311338_10089054 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 3887 | Open in IMG/M |
| 3300030053|Ga0302177_10552220 | Not Available | 592 | Open in IMG/M |
| 3300030399|Ga0311353_11166573 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
| 3300030503|Ga0311370_10215713 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2565 | Open in IMG/M |
| 3300030659|Ga0316363_10319259 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 617 | Open in IMG/M |
| 3300030844|Ga0075377_11158787 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 552 | Open in IMG/M |
| 3300030906|Ga0302314_11251176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 691 | Open in IMG/M |
| 3300031028|Ga0302180_10314664 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
| 3300031234|Ga0302325_11211401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1003 | Open in IMG/M |
| 3300031234|Ga0302325_11220208 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 998 | Open in IMG/M |
| 3300031446|Ga0170820_11786711 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300031446|Ga0170820_17276131 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 832 | Open in IMG/M |
| 3300031525|Ga0302326_13323037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 539 | Open in IMG/M |
| 3300031715|Ga0307476_10109697 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1955 | Open in IMG/M |
| 3300031718|Ga0307474_10241936 | All Organisms → cellular organisms → Bacteria | 1380 | Open in IMG/M |
| 3300031718|Ga0307474_10335641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1168 | Open in IMG/M |
| 3300031720|Ga0307469_11274446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 697 | Open in IMG/M |
| 3300031720|Ga0307469_11989635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 564 | Open in IMG/M |
| 3300031747|Ga0318502_10890433 | All Organisms → cellular organisms → Bacteria | 541 | Open in IMG/M |
| 3300031754|Ga0307475_10543103 | All Organisms → cellular organisms → Bacteria | 932 | Open in IMG/M |
| 3300031754|Ga0307475_10709032 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 802 | Open in IMG/M |
| 3300031754|Ga0307475_11493151 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 519 | Open in IMG/M |
| 3300031823|Ga0307478_10012238 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 5923 | Open in IMG/M |
| 3300031823|Ga0307478_10306402 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1302 | Open in IMG/M |
| 3300031823|Ga0307478_10337357 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1240 | Open in IMG/M |
| 3300031823|Ga0307478_11113703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 658 | Open in IMG/M |
| 3300031823|Ga0307478_11571555 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 543 | Open in IMG/M |
| 3300031890|Ga0306925_11578021 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 639 | Open in IMG/M |
| 3300031939|Ga0308174_11014880 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300032076|Ga0306924_10361169 | All Organisms → cellular organisms → Bacteria | 1664 | Open in IMG/M |
| 3300032180|Ga0307471_100511584 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1350 | Open in IMG/M |
| 3300032261|Ga0306920_100791012 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1393 | Open in IMG/M |
| 3300032828|Ga0335080_10569058 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1195 | Open in IMG/M |
| 3300032828|Ga0335080_12341170 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 510 | Open in IMG/M |
| 3300032955|Ga0335076_10866527 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 785 | Open in IMG/M |
| 3300033004|Ga0335084_11324429 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
| 3300033134|Ga0335073_11248631 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 740 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 13.30% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 7.39% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 6.90% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 5.42% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 4.93% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 4.93% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.94% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.94% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.45% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.96% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.46% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 2.46% |
| Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.48% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.48% |
| Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 1.48% |
| Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.48% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.99% |
| Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 0.99% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.99% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.99% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
| Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.49% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.49% |
| Palsa | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.49% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.49% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.49% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.49% |
| Termite Gut | Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.49% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300001082 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O3 | Environmental | Open in IMG/M |
| 3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
| 3300001546 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
| 3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
| 3300004631 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF234 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005538 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 | Environmental | Open in IMG/M |
| 3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
| 3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
| 3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
| 3300006794 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_107 | Environmental | Open in IMG/M |
| 3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
| 3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
| 3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
| 3300009088 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaG | Environmental | Open in IMG/M |
| 3300009090 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG | Environmental | Open in IMG/M |
| 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
| 3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
| 3300009624 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_10 | Environmental | Open in IMG/M |
| 3300009665 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 | Environmental | Open in IMG/M |
| 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Host-Associated | Open in IMG/M |
| 3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
| 3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
| 3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
| 3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
| 3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300014156 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014489 | Permafrost microbial communities from Stordalen Mire, Sweden - 812P2M metaG | Environmental | Open in IMG/M |
| 3300014493 | Permafrost microbial communities from Stordalen Mire, Sweden - 712S2M metaG | Environmental | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016404 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017823 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_3 | Environmental | Open in IMG/M |
| 3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
| 3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
| 3300017994 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SourceSoil_2 | Environmental | Open in IMG/M |
| 3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
| 3300018006 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_4 | Environmental | Open in IMG/M |
| 3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
| 3300018013 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_100 | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
| 3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
| 3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
| 3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
| 3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
| 3300019273 | Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300019786 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300019787 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (PacBio error correction) | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021168 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-M | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
| 3300021181 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
| 3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
| 3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
| 3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
| 3300021559 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-M | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300021858 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300022518 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 20-24 | Environmental | Open in IMG/M |
| 3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022717 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-11-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic ? CZU1 | Host-Associated | Open in IMG/M |
| 3300022733 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSU3 | Environmental | Open in IMG/M |
| 3300023250 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P1 10-14 | Environmental | Open in IMG/M |
| 3300023255 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 P2 10-14 | Environmental | Open in IMG/M |
| 3300024220 | Spruce litter microbial communities from Bohemian Forest, Czech Republic ? CLU5 | Environmental | Open in IMG/M |
| 3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
| 3300026309 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 (SPAdes) | Environmental | Open in IMG/M |
| 3300026315 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 (SPAdes) | Environmental | Open in IMG/M |
| 3300026318 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_128 (SPAdes) | Environmental | Open in IMG/M |
| 3300026333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_140 (SPAdes) | Environmental | Open in IMG/M |
| 3300026854 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 48 (SPAdes) | Environmental | Open in IMG/M |
| 3300027070 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes) | Environmental | Open in IMG/M |
| 3300027168 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF037 (SPAdes) | Environmental | Open in IMG/M |
| 3300027565 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027681 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027767 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027787 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter (SPAdes) | Environmental | Open in IMG/M |
| 3300027842 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
| 3300027867 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027884 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
| 3300027898 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2013 (SPAdes) | Environmental | Open in IMG/M |
| 3300028138 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK25 | Environmental | Open in IMG/M |
| 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Host-Associated | Open in IMG/M |
| 3300028746 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_1 | Environmental | Open in IMG/M |
| 3300028759 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E3_1 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029903 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Fen703 | Environmental | Open in IMG/M |
| 3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300029918 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_1 | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300030053 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_2 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
| 3300030844 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300030906 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300031028 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2 | Environmental | Open in IMG/M |
| 3300031234 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2 | Environmental | Open in IMG/M |
| 3300031446 | Fir Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031715 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
| 3300031747 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031939 | Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
| 3300032955 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5 | Environmental | Open in IMG/M |
| 3300033004 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4 | Environmental | Open in IMG/M |
| 3300033134 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI12664J13189_10063441 | 3300001082 | Forest Soil | SPIEMTVQGRVQESRKTIRGKVRGGGPLLSVRTGSGDIHVQ* |
| JGI12269J14319_102152221 | 3300001356 | Peatlands Soil | DIDAPVEMTVQGRVQESRKSINGKVRGGGPLLAVRTGSGDIHVE* |
| JGI12659J15293_101138891 | 3300001546 | Forest Soil | APITMTVQGRVQETHKQIVGKVRGGGPLLTLRTGSGDIHIE* |
| JGI12635J15846_102740031 | 3300001593 | Forest Soil | DISTSSGTLNMDAPITMTVQGRVQDTRKSIQGKVRGGGPALSLRTGSGDIHLE* |
| JGIcombinedJ26739_1001950751 | 3300002245 | Forest Soil | VNSPIEMTVQGRVQESRKQIHGKVRGGGPLLSVRTGSGDIHVD* |
| Ga0062387_1000954591 | 3300004091 | Bog Forest Soil | PITMTVQGRVQETRKQITGKVRGGGPLLSLRTGSGDIHIE* |
| Ga0062389_1023941441 | 3300004092 | Bog Forest Soil | MTVQGRVQETRKSIVGKVRGGGPLLTVRTGSGDIHIQ* |
| Ga0058899_114113932 | 3300004631 | Forest Soil | IEMTVQGRVNETHRQIRGKVRGGGPLLRVRTGSGDIHIS* |
| Ga0070681_106206732 | 3300005458 | Corn Rhizosphere | IEMTVQGRVGDSHKSIHGKVHGGGPSLRVHTGSGDIEIQ* |
| Ga0070707_1014485931 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | SGTIDVDSPIEMTVQGRVQESRKTIHGKVRGGGPLLSVRTGSGDIRIQ* |
| Ga0070731_103264051 | 3300005538 | Surface Soil | LTTSSGTLDVGPAITMTVQGRVQETRKRIEGKVHGGGPLLTVRTGSGDIHIE* |
| Ga0070732_100424301 | 3300005542 | Surface Soil | VGSPIEMTVQGRVDSSRREIRGKVRGGGPLLRVHTGSGDIHIE* |
| Ga0066707_103836002 | 3300005556 | Soil | DQPVVMTVQGRVQEPRRNVSGKVHGGGPPLRVHTGSGDIEIR* |
| Ga0066903_1034907691 | 3300005764 | Tropical Forest Soil | SGSIDVGAPIEMTVQGRVGESRKQIHGKARGGGPMLRVHTGSGDIHIE* |
| Ga0068862_1000976351 | 3300005844 | Switchgrass Rhizosphere | TVQGRVNDSPHHTISGKVHGGGPLLRVHTGSGDISIR* |
| Ga0070766_109186791 | 3300005921 | Soil | ISTSSGSVDVGAPIEMTVQGRIGDVHKSVHGKVRGGGPLLRVRTGSGDIHIE* |
| Ga0066789_103616931 | 3300005994 | Soil | VGTPIEMTVQGRVGDSHKQIRGKVHGGGPLLRVRTGSGDIHIQ* |
| Ga0070717_120070301 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | QGRVGESHKQIHGKARGGGPLLRVRTGSGDIHIE* |
| Ga0075029_1001104122 | 3300006052 | Watersheds | VQGRIGDSHKSIHGKVRGGGPLLRVHTGSGDIHIE* |
| Ga0075017_1000222221 | 3300006059 | Watersheds | GSVQVDSPLEMTVQGRVQETRKSIHGKVRGGGPMLSVRTGSGDIHIQ* |
| Ga0075030_1012627742 | 3300006162 | Watersheds | PLEMTVQGRVQETRKQIHGKVRGGGPLLSVRTGSGDIRVD* |
| Ga0075018_106718531 | 3300006172 | Watersheds | VDVSSPIEMTVQGRVNDVHKSIHGKVRGGGPLLRVRTGSGDIHIS* |
| Ga0070765_1001889403 | 3300006176 | Soil | DLSTSSGTLDVDAPITMTVQGRVQERHKSIVGKARGGGPLLTLHTGSGDIHIE* |
| Ga0075021_100957313 | 3300006354 | Watersheds | IQGRVEDAHKTIRGKVRGGGPEISVHTGSGDIRVD* |
| Ga0066658_104194931 | 3300006794 | Soil | GQPIEMTVQGRVGDSHKSIHGKVHGGGPTLRVHTGSGDIQIQ* |
| Ga0073928_104656412 | 3300006893 | Iron-Sulfur Acid Spring | DISTSSGSIDVGSPIEMTVQGRVDDTHRQIHGKVHGGGPLLKVRTGSGDIHIG* |
| Ga0075435_1010081851 | 3300007076 | Populus Rhizosphere | TSSGSIDVGAPIEMTVQGRVGESHKSIHGKARGGGPLLRVRTGSGDIHIE* |
| Ga0099829_114978991 | 3300009038 | Vadose Zone Soil | GEPIEMTVQGRVGDSHKQIRGKVHGGGPLLRVRTGSGDIHIQ* |
| Ga0099830_100668485 | 3300009088 | Vadose Zone Soil | GTIVVDQPVVTTVQGRVQEQRRNVSGKVHGGGPLLRVHTGSGDIEIR* |
| Ga0099827_120054862 | 3300009090 | Vadose Zone Soil | DVGAPITMTVQGRVQETRKSIQGKVRGGGPLLTLRTGSGDIRIE* |
| Ga0105250_101289432 | 3300009092 | Switchgrass Rhizosphere | VEGRVHDAPQKSISGQVHGGGPLLRVHTGSGDISIE* |
| Ga0116225_12323432 | 3300009524 | Peatlands Soil | GSVDVGAPVEMTVQGRVGDMHKQIRGKVRGGGQLLRVRTGSGDIRIE* |
| Ga0116138_11284941 | 3300009552 | Peatland | ITMTIQGRVQEMRKQIVGKVGGGGPLLTVRTGSGDIHIE* |
| Ga0116105_10211611 | 3300009624 | Peatland | QGRVQETRKQIVGKVRGGGPLLSLRTGSGDIHIE* |
| Ga0116105_10906841 | 3300009624 | Peatland | SPIEMTVQGRVGDTHKQIRGKVRGGGPLLRVHTGSGDIHIA* |
| Ga0116135_10394983 | 3300009665 | Peatland | SSSSGTIEVVPALTTTVQGRVQEDRKRIAGKVRGGGPVVKVHTSSGDIHLE* |
| Ga0123357_107597401 | 3300009784 | Termite Gut | DVGAPIEMTVQGRVADVHKSIHGKARGGGPLLRVRTGSGDIHIE* |
| Ga0116223_102231162 | 3300009839 | Peatlands Soil | DVGAPVEMTVQGRVGDMHKQIRGKVRGGGQLLRVRTGSGDIRIE* |
| Ga0116223_102801391 | 3300009839 | Peatlands Soil | PIEMTVQGRVQESRKQIHGKVGGGGPLLSVRTGSGDIHIQ* |
| Ga0126384_100092621 | 3300010046 | Tropical Forest Soil | NTSSGSVIVDQPVTMTVQGKVQESHKSINGTVRGGGPLLAVHTGSGDVHIE* |
| Ga0126382_106634631 | 3300010047 | Tropical Forest Soil | NTSSGSVIVDQPVTMTVQGKVQEGPKSINGTVRGGGPLLTVHTGSGDVHIE* |
| Ga0074046_100316635 | 3300010339 | Bog Forest Soil | SGTVRVDSPITMTVQGRVEETHKSIQGKVRGGGPLLTVRTGSGDIHIE* |
| Ga0074045_100124268 | 3300010341 | Bog Forest Soil | TSSGTVDVDSPIEMTVQGRVQEERKSIRGKVRGGGPLLSVRTGSGDIHIH* |
| Ga0126372_113805161 | 3300010360 | Tropical Forest Soil | PVTATVQGRVEDAHKTIRGKVRGGGPEINVHTGSGDIRLN* |
| Ga0126378_101712913 | 3300010361 | Tropical Forest Soil | SSGSIDVGAPIEMTVQGRVGDTRKAIRGKVRGGGSLVRVRTGSGDIHIE* |
| Ga0126378_115278551 | 3300010361 | Tropical Forest Soil | NSGTINMDQPVTTTVLGRVQESRRTISGKVRGGGPLVSVRTGSGDIHIE* |
| Ga0126378_131680942 | 3300010361 | Tropical Forest Soil | DVGAPIEMTVQGRIGDSHKTIHGKVRGGGPLLRVHTGSGDIHIE* |
| Ga0136449_1017493712 | 3300010379 | Peatlands Soil | STSSGTLDVDAPITMTVQGRVEEMRKSIVGKVRGGGPLLTLRTGSGDVHIE* |
| Ga0126344_10215062 | 3300010866 | Boreal Forest Soil | DVGPAITMTVQGRVQEARKQITGKVRGGGPLLTVRTGSGDIHIE* |
| Ga0150983_106061942 | 3300011120 | Forest Soil | DVGSPITMTVQGRVQETRKSITGKVRGGGPLLTIRTGSGDIHIE* |
| Ga0150983_145701702 | 3300011120 | Forest Soil | TIEVNSPIEMTVQGRVNETHRQIRGKVRGGGPLLRVRTGSGDIHIS* |
| Ga0137391_104314102 | 3300011270 | Vadose Zone Soil | STSSGTLDVDAPITMTVQGRVQETRKQIIGKVRGGGPLLTLRTGSGDIHIQ* |
| Ga0137389_114112531 | 3300012096 | Vadose Zone Soil | MTVQGRVQESRKQIRGKVRGGGPTLSVRTGSGDIQIQ* |
| Ga0137365_110890842 | 3300012201 | Vadose Zone Soil | ISTSSGSIDVGAPLEMTVQGRVGDSHKSIHGKVRGGGQLLRVHTGSGDIHVE* |
| Ga0137384_107812272 | 3300012357 | Vadose Zone Soil | MTVQGRVEESRKSVHGKVRGGGPTLRVRTGSGDIHVD* |
| Ga0137398_102594902 | 3300012683 | Vadose Zone Soil | LDVGAPITMTVQGRVQETRKSIQGKVRGGGPLLTLHTGSGDIHIE* |
| Ga0137395_104364452 | 3300012917 | Vadose Zone Soil | TVQGRVQESRKSIHGKVRGGGPLLSLRTGSGDIHIE* |
| Ga0137416_121379201 | 3300012927 | Vadose Zone Soil | APITMTVQGRVQETRKSIHGQVRGGGPVLKVHTGSGDIHIQ* |
| Ga0164298_108058541 | 3300012955 | Soil | IEMTVQGRVGDSHKSIRGKVHGGGPTLRVHTGSGDIQIQ* |
| Ga0164305_105453982 | 3300012989 | Soil | ANTSSGSVIVDQPVTMTVQGRVQESRKAINGSVRGGGPLLAVHTGSGDVHIE* |
| Ga0181518_105925652 | 3300014156 | Bog | DADISTSSGSVDVGAPVEMTVQGRVGDAHKQIRGKVRGGGQLLRVHTGSGDIRIE* |
| Ga0181531_100707821 | 3300014169 | Bog | TTTVQGRVPEGRKHIVGKAGGGGPALSVRTGSGDIHIE* |
| Ga0182018_102490791 | 3300014489 | Palsa | ADISTSSGTLDVNAPVTMTVQGRVQETRKQIVGKVRGGGPSLTLRTGSGDIHIE* |
| Ga0182016_103688412 | 3300014493 | Bog | TVQGRVQETRKQIVGKVRGGGPLLTVHTGSGDIQIQ* |
| Ga0157379_125132151 | 3300014968 | Switchgrass Rhizosphere | DADINTSSGTIDVEAPIEMTVQGRVQESRKSIRGKGHGGGPTLAVRTGSGDIHIQ* |
| Ga0132256_1037502691 | 3300015372 | Arabidopsis Rhizosphere | DVGEPIEMTVQGRVGDSHKQIRGKVHGGGQLLRVRTGSGDIHIQ* |
| Ga0182041_114729941 | 3300016294 | Soil | IDVGAPIEMTVQGRIGDAHKAIHGKVRGGGPLLRVHTGSGDIHIE |
| Ga0182037_118106712 | 3300016404 | Soil | GSIDVGAPIEMTVQGRIGDAHKAIHGKVRGGGPLLRVHTGSGDIHIE |
| Ga0187802_103225421 | 3300017822 | Freshwater Sediment | TSSGTLEVDDPITMTVQGRVQERHKSIAGKVRGGGPLLSVRTGSGDIHIQ |
| Ga0187818_105822952 | 3300017823 | Freshwater Sediment | APIEMTVQGRIGDVHKSIQGKVRGGGPLLRVRTGSGDIHIE |
| Ga0187850_104065101 | 3300017941 | Peatland | MEVNPAITMTIQGRVQEMRKQIVGKVGGGGPLLTVRTGSGDIHIE |
| Ga0187819_107879521 | 3300017943 | Freshwater Sediment | ISTSSGTIDVNSPIEMTVQGRVQETRRQIHGKVRGGGPLLSVRTGSGDISVQ |
| Ga0187847_104980641 | 3300017948 | Peatland | MTVQGRVGDMHKQIRGKVRGGGPLLRVRTGSGDINIG |
| Ga0187783_102296651 | 3300017970 | Tropical Peatland | NAAFDANISTSSGTIDVDAPITTTVQGRVNDRRKEIIGKARGGGPLLSLRTGSGDIHIE |
| Ga0187780_105084962 | 3300017973 | Tropical Peatland | EHPIEMTVQGRVQESRKQIRGKVGGGGALLSVRTGSGDIHIQ |
| Ga0187782_108388062 | 3300017975 | Tropical Peatland | SGSIDVGAPIEMTVQGRVGDARKAIRGKVRGGGSLVRVRTGSGDIHIE |
| Ga0187822_103649101 | 3300017994 | Freshwater Sediment | VDSPIEMTVQGRVQETRKQIHGKVHGGGPLLSVRTGSGDIHIQ |
| Ga0187865_11232492 | 3300018004 | Peatland | PANAAFDANLATGSGAVDVGPAITMTVQGRVQETRKQIIGKVHGGGPLLTVRTGSGDIHI |
| Ga0187804_101565591 | 3300018006 | Freshwater Sediment | SPIEMTVQGRVEEMRKAIRGKVRGGGQLLRVRTGSGDIQIQ |
| Ga0187884_100399621 | 3300018009 | Peatland | TSSGTMEVNPAITMTIQGRVQEMRKQIVGKVGGGGPLLTVRTGSGDIHIE |
| Ga0187873_11031151 | 3300018013 | Peatland | VDVGPAITMTVQGRVQETRKQIIGKVHGGGPLLTVRTGSGDIHIE |
| Ga0187881_102763272 | 3300018024 | Peatland | NAAFDANLATSSGTMEVNPAITMTIQGRVQEMRKQIVGKVGGGGPLLTVRTGSGDIHIE |
| Ga0187885_102260742 | 3300018025 | Peatland | MEVNPAITMTVQGRVQEMRKQIEGKVRGGGPMLTVHTSSGDVHIE |
| Ga0187885_104194661 | 3300018025 | Peatland | NAAFDANLATGSGAVDVGPAITMTVQGRVQETRKQIIGKVHGGGPLLTVRTGSGDIHIE |
| Ga0187867_101939481 | 3300018033 | Peatland | TSSGTLDVDAPITMTVQGRVQETRKQIVGKVRGGGPLLSLRTGSGDIHIE |
| Ga0187859_101481932 | 3300018047 | Peatland | MTVQGRVGDTHKQIRGKVRGGGPLLRVHTGSGDIHIA |
| Ga0187771_110062431 | 3300018088 | Tropical Peatland | SPIEMTVQGRVGDSHKTIRGKVRGGGPLLRVRTGSGDIQIE |
| Ga0187771_115237712 | 3300018088 | Tropical Peatland | VQGRVQEMRKSIHGKVRGGGPLLSVRTGSGDIEIR |
| Ga0187770_103475851 | 3300018090 | Tropical Peatland | PVTMTVQGRVEETRKHIAGKVRGGGPLLSLRTGSGDIHIE |
| Ga0187794_16061491 | 3300019273 | Peatland | TSSGSVNVDHPIEMTVQGRVQEERKTIRGKVHGGGPLLAVHTGSGDIHIQ |
| Ga0182025_10128984 | 3300019786 | Permafrost | TMTVQGRLQETRKQIMGKVHGGGPLLTVRTGSGDIHIE |
| Ga0182025_10313521 | 3300019786 | Permafrost | TLDVGPLDVGPAITMTVQGRVQETRKQIMGKVHGGGPLLTVRTGSGDIHIE |
| Ga0182025_11164622 | 3300019786 | Permafrost | TVQGRVQETRKQNMGKVHGGGPLLTVRTGSGDIHIE |
| Ga0182031_10369531 | 3300019787 | Bog | RFPADAAFAFDANLSTSSGSMEISPAITMTVQGRVQETRKQIVGKVRGGGPLLTVHTGSGDIQIQ |
| Ga0210401_100074159 | 3300020583 | Soil | SVDVGAPVEMTVQGRIGDSHKSIHGKVRGGGPLLRVHTGSGDIHIE |
| Ga0210401_107722701 | 3300020583 | Soil | PITMTVQGRVQETRKSITGKVRGGGPLLTLRTGSGDIHIQ |
| Ga0210406_100382996 | 3300021168 | Soil | VDSPIEMTVQGRVQESRKQIRGKVRGGGPELSVRTGSGDIHIQ |
| Ga0210400_105234462 | 3300021170 | Soil | LDIDAPITMTVQGRVQETRKSIHGQVRGGGPVLKVHTGSGDITIQ |
| Ga0210400_105343141 | 3300021170 | Soil | TIEVNSRIEMTVQGRVNETHRQIRGKVRGGGPLLRVRTGSGDIHIS |
| Ga0210408_100158089 | 3300021178 | Soil | GTVEVESPIEMTVQGRVQEMRKSIKGKVRGGGPVLSVRTGSGDIRIQ |
| Ga0210388_105230832 | 3300021181 | Soil | EMTVQGRVQETRKSINGKVRGGGPLLAVRTGSGDIHIQ |
| Ga0210388_115091551 | 3300021181 | Soil | SGTLDVNAPITMTVQGRVQETRKSIVGKVRGGGPLLTLRTGSGDIHID |
| Ga0210385_112950722 | 3300021402 | Soil | SPIEMTVQGRVGDTHKQIRGKVRGGGPLLRVHTGSGDIHIA |
| Ga0210385_115698222 | 3300021402 | Soil | VEMTVQGRIGDVHKSVHGKVRGGGPLLRVRTGSGDIHIE |
| Ga0210397_110049022 | 3300021403 | Soil | TVDVESPIEMTVQGRIGDSHKQIHGKVRGGGQLLRVRTGSGDIHIQ |
| Ga0210386_108213612 | 3300021406 | Soil | ISTSSGTVDVDSPIEMTVQGRVGDTHKQIRGKVRGGGPLLRVHTGSGDIHIA |
| Ga0210391_105268542 | 3300021433 | Soil | SPIEMTVQGRVQESRKQIHGKVRGGGPLLSVRTGSGDIHVD |
| Ga0210390_100074618 | 3300021474 | Soil | APVEMTVQGRVQETRKSINGKVRGGGPLLAVRTGSGDIHIQ |
| Ga0210390_109262451 | 3300021474 | Soil | IEMTVQGRVGDTHKQIRGKVRGGGPLLRVHTGSGDIHIA |
| Ga0210392_102475021 | 3300021475 | Soil | DVGEPIEMTVQGRVGDTHKQIRGKVHGGGPLLRVRTGSGDIHIQ |
| Ga0210392_108409921 | 3300021475 | Soil | GTLDVDAPITMTVQGRVNETHKSINGKVRGGGPMLTLRTGSGDIHIQ |
| Ga0210402_117375821 | 3300021478 | Soil | ADISTSSGTVDVNSPVEMIVQGRVDENHKTIHGKVRGGGPVLSVRTGSGDIHIQ |
| Ga0210410_101370701 | 3300021479 | Soil | SVDAPLTMTVQGRVQESRKSVMGKVRGGGPLLTLRTGSGDIHIQ |
| Ga0210410_106405101 | 3300021479 | Soil | VQGRIGYSHKQIHGKVRGGGQLLRVHTGSGDIHIQ |
| Ga0210410_113609122 | 3300021479 | Soil | DANISTSSGTLDVDAPITMTVQGRVRETRKSITGKVRGGGPLLTLRTGSGDIHIQ |
| Ga0210409_110763682 | 3300021559 | Soil | RISTSSGTVDIDAPVEMTVQGRVQETRKSINGKVRGGGPLLAVRTGSGDIHIQ |
| Ga0126371_124798591 | 3300021560 | Tropical Forest Soil | SIDVGAPIEMTVQGRVGDTRKAIRGKVRGGGSLVRVRTGSGDIHIE |
| Ga0213852_13874262 | 3300021858 | Watersheds | VQGRVQETRKQIHGKVRGGGPLLSVRTGSGDIRVD |
| Ga0224548_10299932 | 3300022518 | Soil | GSIDVGSPIEMTVQGRLDDTHKQIHGKVHGGGPLLKVRTGSGDIHIG |
| Ga0242655_100447602 | 3300022532 | Soil | VDVDSPIEMTVQGRVQESRKQIHGKVRGGGPELSVRTGSGDIHIQ |
| Ga0212123_100740324 | 3300022557 | Iron-Sulfur Acid Spring | STSSGSIDVGSPIEMTVQGRVDDTHRQIHGKVHGGGPLLKVRTGSGDIHIS |
| Ga0212123_107564631 | 3300022557 | Iron-Sulfur Acid Spring | DISTSSGSIDVGSPIEMTVQGRVDDTHRQIHGKVHGGGPLLKVRTGSGDIHIG |
| Ga0242661_10991711 | 3300022717 | Soil | VGSPIEMTVQGRVDDTHRQIHGKVHGGGPMLKVRTGSGDIHIS |
| Ga0224569_1047432 | 3300022732 | Rhizosphere | FEARISTSSGTVDIDAPVEMTVQGRVQETRKSINGKVRGGGPLLAVRTGSGDIHIQ |
| Ga0224562_10100472 | 3300022733 | Soil | FDANLSTSSGSMDVNPAITMTVQGRVQETRKQIVGKVRGGGPLLTVRTGSGDIHIE |
| Ga0224544_10207181 | 3300023250 | Soil | GTLDVNAPVTMTVQGRVQETRKQIVGKVRGGGPSLTLRTGSGDIHIE |
| Ga0224547_10263681 | 3300023255 | Soil | TLDVGPAITMTVQGRVEDTRKRIEGKVRGGGPVLTVRTGSGDIHIE |
| Ga0224568_10149522 | 3300024220 | Plant Litter | VQGRVADMHKQIRGKVRGGGPLLRVRTGSGDISIG |
| Ga0208821_10043731 | 3300025432 | Peatland | AITMTVQGRVQEMRKQIIGKVRGGGPLLTVRTGSGDIHIE |
| Ga0207711_110132592 | 3300025941 | Switchgrass Rhizosphere | TTVEGPVHDAPQKSISGQVHGGGPLLRVHTGSGDISIE |
| Ga0207702_116080691 | 3300026078 | Corn Rhizosphere | IEMTVQGRVGDSHKSIHGKVHGGGPSLRVHTGSGDIQIQ |
| Ga0209839_1000294410 | 3300026294 | Soil | STSSGSVDVGTPIEMTVQGRVGDSHKQIRGKVHGGGPLLRVRTGSGDIHIQ |
| Ga0209055_12229481 | 3300026309 | Soil | VQGRIGDSHKSIHGKVRGGGPLLRVHTGSGDIHIE |
| Ga0209686_11366862 | 3300026315 | Soil | PGTIVVDQPVVMTVQGRVQEPRRNVSGKVHGGGPPLRVHTGSGDIEIR |
| Ga0209471_10580652 | 3300026318 | Soil | ITTSSGTIDIGSPIEMTVQGRVQESRKSIRGKVRGGGPLLSVRTGSGDIHIQ |
| Ga0209158_11196021 | 3300026333 | Soil | VEQPVVMTVQGRVQEPRRNVSGKVHGGGPPLRVHTGSGDIDIR |
| Ga0207727_1250201 | 3300026854 | Tropical Forest Soil | VGQPIEMTVQGRVGDAHKQIHGKVHGGGPLLRVHTGSGDIHLQ |
| Ga0208365_10611261 | 3300027070 | Forest Soil | NISTSSGTLDVDAPITMTVQGRVQETRKSIIGKVRGGGPLLSLRTGSGDIHIE |
| Ga0208239_10115332 | 3300027168 | Forest Soil | SSGTVDVGAPVEMTVQGRVGDMHKQIRGKVRGGGPLLRVRTGSGDISIG |
| Ga0209219_11068541 | 3300027565 | Forest Soil | GTLDIDAPITMTVQGRVPETRKSIHGQVRGGGPVLKVHTGSGDIHIE |
| Ga0208043_11612812 | 3300027570 | Peatlands Soil | DISTSSGSIEVNSPIEMTVQGRVQESRKQIRGKVRGGGPLLSVRTGSGDIEIQ |
| Ga0208991_11407512 | 3300027681 | Forest Soil | DVNSPIEMTVQGRVQESRKQIRGKVRGGGPTLSVRTGSGDIQIL |
| Ga0209655_102440622 | 3300027767 | Bog Forest Soil | SSGTLDIDAPITMTVQGRVQETRKHIEGKVRGGGPLLTLHTGSGDIHIE |
| Ga0209074_105196771 | 3300027787 | Agricultural Soil | TVQGKVQEERKSIVGTVGGGGPSLIVRTGSGDIHIE |
| Ga0209580_103401352 | 3300027842 | Surface Soil | VDVGAPVEMTVQGRIGDSHKSIHGKVRGGGPLLRVHTGSGDIHIE |
| Ga0209580_106529342 | 3300027842 | Surface Soil | DSPIEMTVQGRVQEARRHIQGKVHGGGPLLSVRTGSGDVHIE |
| Ga0209517_100306937 | 3300027854 | Peatlands Soil | DADISTSSGTVDVGAPIEMTVQGRVQEERKSIRGKVRGGGPLLSVRTGSGDINIQ |
| Ga0209167_103278081 | 3300027867 | Surface Soil | STSSGTLDIGAPITMTVQGRVQETRKQIVGKVRGGGPLLTVRTGSGDIHVE |
| Ga0209579_105276142 | 3300027869 | Surface Soil | NSPIEMTVQGRVNETHRQIHGKVRGGGPLLRVHTGSGDIHIE |
| Ga0209275_100792673 | 3300027884 | Soil | DISTSSGTVDVDSPIEMTVQGRVGDTHKQIRGKVRGGGPLLRVHTGSGDIHIA |
| Ga0209380_101224412 | 3300027889 | Soil | ITVQGRVGEARKQIRGKVRGGGPLLRVRTGSGDIHVE |
| Ga0209380_101563143 | 3300027889 | Soil | MTVQGRVQETRKHIEGKVRGGGPLLTLHTGSGDIHIE |
| Ga0209068_101702181 | 3300027894 | Watersheds | IQGRVEDAHKTIRGKVRGGGPEISVHTGSGDIRVD |
| Ga0209068_105725942 | 3300027894 | Watersheds | NSPIEMTVQGRVQESRKNIRGKVRGGGPLLSVRTGSGDVHIQ |
| Ga0209067_109747861 | 3300027898 | Watersheds | VQGRVQDMHKSIRGQVRGGGPMLTVRTGSGDIHVD |
| Ga0247684_10638702 | 3300028138 | Soil | HPVTTTVVGKVQESRKTISGKVRGGGTLVSVRTGSGDIHIE |
| Ga0265336_101566311 | 3300028666 | Rhizosphere | VQGRIGDSHKQIRGKVHGGGPLLRVRTGSGDIHIQ |
| Ga0302233_102848781 | 3300028746 | Palsa | ANISTNSGTLDVDAPITMTVQGRVQETHKQIVGKVRGGGPLLSLRTGSGDIHIE |
| Ga0302224_100971991 | 3300028759 | Palsa | VPITTTVQGRVQEGRKHIVGKAGGGGPALSVRTGSGDIHIE |
| Ga0302224_101605392 | 3300028759 | Palsa | EARISTSSGTVDIDAPVEMTVQGRVQESRKSINGKVRGGGPLLAVRTGSGDIHVE |
| Ga0302224_101798002 | 3300028759 | Palsa | MTVQGRVGDMHKQIRGKVRGGGPLLRVRTGSGDISIG |
| Ga0308309_104811101 | 3300028906 | Soil | MTSSGTLDVNAPFTRTVQGRVVERHKQILGKVRGGGPLLTLRTGSGDIHIE |
| Ga0247271_10037713 | 3300029903 | Soil | VQGRVQETRKQIVGKVRGGGPLLSLRTGSGDIHIE |
| Ga0311369_100075271 | 3300029910 | Palsa | NVPITTTVQGRVQEGRKHIVGKAGGGGPPLSVRTGSGDIHIE |
| Ga0302143_10616051 | 3300029918 | Bog | TLDVNAPVTMTVQGRVQEGRKHIEGKVRGGGPSLRVRTGSGDIHIE |
| Ga0311352_110576072 | 3300029944 | Palsa | PIEMTVQGRVDNSHKQIRGKVRGGGPLLSVRTGSGDIQIQ |
| Ga0311338_100890541 | 3300030007 | Palsa | TLDVNAPVTMTVQGRVQETRKQIVGKVRGGGPSLTLRTGSGDIHIE |
| Ga0302177_105522202 | 3300030053 | Palsa | AFDVDLATSSGTVQVDPAVTMTVQGRVQQEHKSIQGKVRGGGPMLTVRTGSGDIHIQ |
| Ga0311353_111665731 | 3300030399 | Palsa | ADIMTSSGTLDVDAPITTTVQGRVQERHKHIVGKVRGGGPLLTLRTGSGDIHIE |
| Ga0311370_102157133 | 3300030503 | Palsa | TVQGRVQETRKQIVGKVRGGGPSLTLRTGSGDIHIE |
| Ga0316363_103192591 | 3300030659 | Peatlands Soil | APVEMTVQGRVGDMHKQIRGKVRGGGQLLRVRTGSGDIRIE |
| Ga0075377_111587871 | 3300030844 | Soil | LEVDAPLTMTVQGRVQEMHKSIAGKVRGGGPLLTVKTGSGDIHIE |
| Ga0302314_112511762 | 3300030906 | Palsa | APIEMTVQGRVGDMHKQIRGKVRGGGPLLRVRTGSGDISIG |
| Ga0302180_103146642 | 3300031028 | Palsa | VEMVVQGRAQEIQKQIHGKVRGGGQLLRVRTGSGDIHIE |
| Ga0302325_112114011 | 3300031234 | Palsa | DADISTSSGTLDVNAPVTMTVQGRVQETRKQIVGKVRGGGPSLTLRTGSGDIHIE |
| Ga0302325_112202082 | 3300031234 | Palsa | ANISTSSGTVDINAPVEMTVQGRVQESRKSINGKVRGGGPLLSVRTGSGDIHVQ |
| Ga0170820_117867112 | 3300031446 | Forest Soil | VQGRVDDTHHQIHGKVRGGGQLLKVRTGSGDIHIS |
| Ga0170820_172761311 | 3300031446 | Forest Soil | PIEMTVQGRVGDSHKQIRGKVRGGGPLLRVRTGSGDIHIQ |
| Ga0302326_133230372 | 3300031525 | Palsa | SGTLDLNVPITTTVQGRVQEGRKHIVGKAGGGGPPLSVRTGSGDIHIE |
| Ga0307476_101096973 | 3300031715 | Hardwood Forest Soil | TVDVGEPIEMTVQGRVGDSHKQIRGKVHGGGPLLRVRTGSGDIHIQ |
| Ga0307474_102419361 | 3300031718 | Hardwood Forest Soil | ITSSGTIDVDSPIEMTVQGRVQESRKSIRGKVRGGGPLLSVRTGSGDIHIQ |
| Ga0307474_103356412 | 3300031718 | Hardwood Forest Soil | IEMTVQGRVNETHRQIRGKVRGGGPLLRVRTGSGDIHIS |
| Ga0307469_112744461 | 3300031720 | Hardwood Forest Soil | DAEITTSSGTIDIDSPLETTVQGRVQESRKSIRGKVRGGGPLLSVRTGSGDIHIQ |
| Ga0307469_119896351 | 3300031720 | Hardwood Forest Soil | ITTSSGTIDVDSPIEMTVQGRVQESRKTIRGKVRGGGPVLSVRTGSGDIHIQ |
| Ga0318502_108904332 | 3300031747 | Soil | ISTSSGSIDVGAPIEMTVQGRVGESHKQIHGKARGGGPLLRVRTGSGDIHLES |
| Ga0307475_105431032 | 3300031754 | Hardwood Forest Soil | EMTVQGRVQESRKSIRGKVRGGGPLLSVRTGSGDIHIQ |
| Ga0307475_107090321 | 3300031754 | Hardwood Forest Soil | MTVQGRVQESRKSIVGKVRGGGPLLTLRTGSGDIHIQ |
| Ga0307475_114931511 | 3300031754 | Hardwood Forest Soil | TTTVQGRVEESRKNVRGKVHGGGPEVAVRTGSGDIRVN |
| Ga0307478_100122381 | 3300031823 | Hardwood Forest Soil | VDVGAPVEMTVQGRIDDMHKQIHGKVRGGGPLLRVHTGSGDIHIQ |
| Ga0307478_103064021 | 3300031823 | Hardwood Forest Soil | DISTSSGTVNVDAPVEMTVQGRVQEARKQIRGKVRGGGPLLSVRTGSGDIHIQ |
| Ga0307478_103373572 | 3300031823 | Hardwood Forest Soil | SGTLDVDAPITMTVQGRIQESRKSIQGKVRGGGPLLTLRTGSGDIHIE |
| Ga0307478_111137032 | 3300031823 | Hardwood Forest Soil | IEMTVQGRVNETRKQIHGKVRGGGPLLSVRTGSGDIQIQ |
| Ga0307478_115715552 | 3300031823 | Hardwood Forest Soil | GTLDVGPAITMTVQGRVQEARKQIMGKAHGGGPLLTVRTGSGDIHIE |
| Ga0306925_115780212 | 3300031890 | Soil | SGSIVIDQPVTTTVQGRVQEMRKNIRGKVRGGGPEIAVRTGSGDIRVN |
| Ga0308174_110148802 | 3300031939 | Soil | PVEMTVQGRVGDSHKSIRGKVHGGGPTLRVHTGSGDIEIQ |
| Ga0306924_103611693 | 3300032076 | Soil | VGAPLEMTVQGRIGDSHKAIHGKVRGGGPLLRVHTGSGDIHIE |
| Ga0307471_1005115842 | 3300032180 | Hardwood Forest Soil | DISTSSGSIDVGSPIEMTVQGRIGDAHKAIHGKVRGGGPLLRVHTGSGDIHIE |
| Ga0306920_1007910122 | 3300032261 | Soil | LLTSSGSIVIDQPVTTTVQGRVQEMRKNIRGKVRGGGPEIAVRTGSGDIRVN |
| Ga0335080_105690581 | 3300032828 | Soil | VSTNSGSVDVDSPIEMTVQGRVQETRKNIRGKVRGGGPLLSVHTGSGDVHIQ |
| Ga0335080_123411702 | 3300032828 | Soil | VGAPVEMTVQGRIGDMRKSIRGKVRGGGPLLRVRTGSGDIHIE |
| Ga0335076_108665272 | 3300032955 | Soil | PLEMTVQGRVNDTHKQIHGKVRGGGPLLRVRTGSGDIHID |
| Ga0335084_113244291 | 3300033004 | Soil | GFEADISTSSGSIDVGAPIEMTVQGRVGESHKSIHGKARSGGPLLRVRTGSGDIHIE |
| Ga0335073_112486312 | 3300033134 | Soil | EPPIEMTVQGHIGESHKRVQGKARGGGPTLSVHTGSGDIHIQ |
| ⦗Top⦘ |