| Basic Information | |
|---|---|
| Family ID | F025104 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 203 |
| Average Sequence Length | 49 residues |
| Representative Sequence | MTYIDSAILDLTERCCRRFQVLTGRTNVWLAVQLTNLSIIVYFVW |
| Number of Associated Samples | 161 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 61.27 % |
| % of genes near scaffold ends (potentially truncated) | 83.74 % |
| % of genes from short scaffolds (< 2000 bps) | 78.33 % |
| Associated GOLD sequencing projects | 150 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.37 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (73.399 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.360 % of family members) |
| Environment Ontology (ENVO) | Unclassified (31.527 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (50.739 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.37 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 203 Family Scaffolds |
|---|---|---|
| PF00903 | Glyoxalase | 3.45 |
| PF00891 | Methyltransf_2 | 1.97 |
| PF12681 | Glyoxalase_2 | 1.97 |
| PF01850 | PIN | 1.97 |
| PF13692 | Glyco_trans_1_4 | 1.97 |
| PF13180 | PDZ_2 | 1.48 |
| PF08669 | GCV_T_C | 1.48 |
| PF12704 | MacB_PCD | 1.48 |
| PF02687 | FtsX | 1.48 |
| PF00326 | Peptidase_S9 | 1.48 |
| PF12543 | DUF3738 | 0.99 |
| PF01625 | PMSR | 0.99 |
| PF13147 | Obsolete Pfam Family | 0.99 |
| PF05448 | AXE1 | 0.99 |
| PF08242 | Methyltransf_12 | 0.99 |
| PF08450 | SGL | 0.99 |
| PF01494 | FAD_binding_3 | 0.99 |
| PF03150 | CCP_MauG | 0.99 |
| PF09180 | ProRS-C_1 | 0.99 |
| PF13620 | CarboxypepD_reg | 0.99 |
| PF00583 | Acetyltransf_1 | 0.99 |
| PF03795 | YCII | 0.99 |
| PF13000 | Acatn | 0.49 |
| PF02274 | ADI | 0.49 |
| PF00593 | TonB_dep_Rec | 0.49 |
| PF01261 | AP_endonuc_2 | 0.49 |
| PF00004 | AAA | 0.49 |
| PF00313 | CSD | 0.49 |
| PF01833 | TIG | 0.49 |
| PF00877 | NLPC_P60 | 0.49 |
| PF02668 | TauD | 0.49 |
| PF04389 | Peptidase_M28 | 0.49 |
| PF01795 | Methyltransf_5 | 0.49 |
| PF13424 | TPR_12 | 0.49 |
| PF07638 | Sigma70_ECF | 0.49 |
| PF05787 | DUF839 | 0.49 |
| PF00069 | Pkinase | 0.49 |
| PF07883 | Cupin_2 | 0.49 |
| PF00753 | Lactamase_B | 0.49 |
| PF00291 | PALP | 0.49 |
| PF13231 | PMT_2 | 0.49 |
| PF13193 | AMP-binding_C | 0.49 |
| PF01545 | Cation_efflux | 0.49 |
| PF06283 | ThuA | 0.49 |
| PF06267 | DUF1028 | 0.49 |
| PF02585 | PIG-L | 0.49 |
| PF01557 | FAA_hydrolase | 0.49 |
| PF01436 | NHL | 0.49 |
| PF13637 | Ank_4 | 0.49 |
| PF13857 | Ank_5 | 0.49 |
| PF01979 | Amidohydro_1 | 0.49 |
| PF12680 | SnoaL_2 | 0.49 |
| PF13026 | DUF3887 | 0.49 |
| PF13483 | Lactamase_B_3 | 0.49 |
| PF01546 | Peptidase_M20 | 0.49 |
| PF06983 | 3-dmu-9_3-mt | 0.49 |
| PF00595 | PDZ | 0.49 |
| PF00174 | Oxidored_molyb | 0.49 |
| PF01738 | DLH | 0.49 |
| PF13579 | Glyco_trans_4_4 | 0.49 |
| PF07681 | DoxX | 0.49 |
| PF07992 | Pyr_redox_2 | 0.49 |
| PF13570 | PQQ_3 | 0.49 |
| PF00486 | Trans_reg_C | 0.49 |
| PF08818 | DUF1801 | 0.49 |
| PF13360 | PQQ_2 | 0.49 |
| PF02826 | 2-Hacid_dh_C | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
|---|---|---|---|
| COG0515 | Serine/threonine protein kinase | Signal transduction mechanisms [T] | 1.97 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 1.97 |
| COG1506 | Dipeptidyl aminopeptidase/acylaminoacyl peptidase | Amino acid transport and metabolism [E] | 0.99 |
| COG3386 | Sugar lactone lactonase YvrE | Carbohydrate transport and metabolism [G] | 0.99 |
| COG3391 | DNA-binding beta-propeller fold protein YncE | General function prediction only [R] | 0.99 |
| COG2350 | YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHis | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.99 |
| COG3458 | Cephalosporin-C deacetylase or related acetyl esterase | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.99 |
| COG1858 | Cytochrome c peroxidase | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.99 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.99 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.99 |
| COG0442 | Prolyl-tRNA synthetase | Translation, ribosomal structure and biogenesis [J] | 0.99 |
| COG0225 | Peptide methionine sulfoxide reductase MsrA | Posttranslational modification, protein turnover, chaperones [O] | 0.99 |
| COG5646 | Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis) | Posttranslational modification, protein turnover, chaperones [O] | 0.49 |
| COG4874 | Uncharacterized conserved protein | Function unknown [S] | 0.49 |
| COG5649 | Uncharacterized conserved protein, DUF1801 domain | Function unknown [S] | 0.49 |
| COG4813 | Trehalose utilization protein | Carbohydrate transport and metabolism [G] | 0.49 |
| COG4430 | Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 family | Function unknown [S] | 0.49 |
| COG4270 | Uncharacterized membrane protein | Function unknown [S] | 0.49 |
| COG3965 | Predicted Co/Zn/Cd cation transporter, cation efflux family | Inorganic ion transport and metabolism [P] | 0.49 |
| COG3915 | Uncharacterized conserved protein | Function unknown [S] | 0.49 |
| COG3865 | Glyoxalase superfamily enzyme, possible 3-demethylubiquinone-9 3-methyltransferase | General function prediction only [R] | 0.49 |
| COG0053 | Divalent metal cation (Fe/Co/Zn/Cd) efflux pump | Inorganic ion transport and metabolism [P] | 0.49 |
| COG3342 | Uncharacterized conserved protein, Ntn-hydrolase superfamily | General function prediction only [R] | 0.49 |
| COG3211 | Secreted phosphatase, PhoX family | General function prediction only [R] | 0.49 |
| COG2764 | Zn-dependent glyoxalase, PhnB family | Energy production and conversion [C] | 0.49 |
| COG2259 | Uncharacterized membrane protein YphA, DoxX/SURF4 family | Function unknown [S] | 0.49 |
| COG2235 | Arginine deiminase | Amino acid transport and metabolism [E] | 0.49 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
| COG2120 | N-acetylglucosaminyl deacetylase, LmbE family | Carbohydrate transport and metabolism [G] | 0.49 |
| COG2041 | Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductases | Energy production and conversion [C] | 0.49 |
| COG1834 | N-Dimethylarginine dimethylaminohydrolase | Amino acid transport and metabolism [E] | 0.49 |
| COG1595 | DNA-directed RNA polymerase specialized sigma subunit, sigma24 family | Transcription [K] | 0.49 |
| COG1230 | Co/Zn/Cd efflux system component | Inorganic ion transport and metabolism [P] | 0.49 |
| COG0791 | Cell wall-associated hydrolase, NlpC_P60 family | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
| COG0275 | 16S rRNA C1402 N4-methylase RsmH | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.40 % |
| Unclassified | root | N/A | 26.60 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000363|ICChiseqgaiiFebDRAFT_13933123 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
| 3300000955|JGI1027J12803_106826444 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 645 | Open in IMG/M |
| 3300000956|JGI10216J12902_100379460 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 786 | Open in IMG/M |
| 3300003319|soilL2_10154519 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2005 | Open in IMG/M |
| 3300004081|Ga0063454_101716868 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300004114|Ga0062593_100048079 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2631 | Open in IMG/M |
| 3300004114|Ga0062593_101119986 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 819 | Open in IMG/M |
| 3300004114|Ga0062593_103290032 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300004153|Ga0063455_100727245 | Not Available | 673 | Open in IMG/M |
| 3300004153|Ga0063455_100741352 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 669 | Open in IMG/M |
| 3300004156|Ga0062589_102630596 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 523 | Open in IMG/M |
| 3300004463|Ga0063356_105562533 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
| 3300004479|Ga0062595_101055747 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 705 | Open in IMG/M |
| 3300004778|Ga0062383_10507876 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300005093|Ga0062594_100089926 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1784 | Open in IMG/M |
| 3300005181|Ga0066678_10075027 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1991 | Open in IMG/M |
| 3300005290|Ga0065712_10751430 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 528 | Open in IMG/M |
| 3300005330|Ga0070690_100868785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 704 | Open in IMG/M |
| 3300005331|Ga0070670_101372176 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 648 | Open in IMG/M |
| 3300005332|Ga0066388_100160221 | All Organisms → cellular organisms → Bacteria | 2840 | Open in IMG/M |
| 3300005332|Ga0066388_100627618 | Not Available | 1693 | Open in IMG/M |
| 3300005332|Ga0066388_104006591 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 751 | Open in IMG/M |
| 3300005333|Ga0070677_10246622 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 884 | Open in IMG/M |
| 3300005334|Ga0068869_101261652 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 651 | Open in IMG/M |
| 3300005334|Ga0068869_101758233 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 554 | Open in IMG/M |
| 3300005335|Ga0070666_11478082 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 508 | Open in IMG/M |
| 3300005347|Ga0070668_100596632 | All Organisms → cellular organisms → Bacteria | 966 | Open in IMG/M |
| 3300005355|Ga0070671_101131493 | Not Available | 688 | Open in IMG/M |
| 3300005366|Ga0070659_100868255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 787 | Open in IMG/M |
| 3300005406|Ga0070703_10418920 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 587 | Open in IMG/M |
| 3300005438|Ga0070701_10564095 | Not Available | 749 | Open in IMG/M |
| 3300005444|Ga0070694_100997011 | All Organisms → cellular organisms → Bacteria | 695 | Open in IMG/M |
| 3300005450|Ga0066682_10924766 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 518 | Open in IMG/M |
| 3300005451|Ga0066681_10288579 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1002 | Open in IMG/M |
| 3300005455|Ga0070663_102150389 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 503 | Open in IMG/M |
| 3300005457|Ga0070662_100662802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 881 | Open in IMG/M |
| 3300005458|Ga0070681_10160903 | All Organisms → cellular organisms → Bacteria | 2169 | Open in IMG/M |
| 3300005518|Ga0070699_101764018 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300005540|Ga0066697_10530724 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 663 | Open in IMG/M |
| 3300005543|Ga0070672_100422246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1145 | Open in IMG/M |
| 3300005546|Ga0070696_102025233 | Not Available | 500 | Open in IMG/M |
| 3300005578|Ga0068854_100047115 | All Organisms → cellular organisms → Bacteria | 3071 | Open in IMG/M |
| 3300005617|Ga0068859_101273081 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 810 | Open in IMG/M |
| 3300005718|Ga0068866_10835152 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 643 | Open in IMG/M |
| 3300005841|Ga0068863_102479779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 528 | Open in IMG/M |
| 3300005844|Ga0068862_100456341 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1206 | Open in IMG/M |
| 3300005844|Ga0068862_102383673 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 541 | Open in IMG/M |
| 3300006049|Ga0075417_10648122 | All Organisms → cellular organisms → Bacteria | 540 | Open in IMG/M |
| 3300006173|Ga0070716_101251183 | Not Available | 598 | Open in IMG/M |
| 3300006796|Ga0066665_10873847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 699 | Open in IMG/M |
| 3300006796|Ga0066665_11686995 | All Organisms → cellular organisms → Bacteria | 502 | Open in IMG/M |
| 3300006845|Ga0075421_101783733 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
| 3300006846|Ga0075430_100428674 | All Organisms → cellular organisms → Bacteria | 1091 | Open in IMG/M |
| 3300006847|Ga0075431_100208357 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1998 | Open in IMG/M |
| 3300006847|Ga0075431_100494357 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
| 3300006852|Ga0075433_11890819 | All Organisms → cellular organisms → Bacteria | 512 | Open in IMG/M |
| 3300006854|Ga0075425_101260129 | All Organisms → cellular organisms → Bacteria | 839 | Open in IMG/M |
| 3300006881|Ga0068865_100320749 | All Organisms → cellular organisms → Bacteria | 1246 | Open in IMG/M |
| 3300009012|Ga0066710_101461876 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1057 | Open in IMG/M |
| 3300009137|Ga0066709_100122615 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3252 | Open in IMG/M |
| 3300009137|Ga0066709_101743217 | All Organisms → cellular organisms → Bacteria | 879 | Open in IMG/M |
| 3300009137|Ga0066709_102316739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 735 | Open in IMG/M |
| 3300009137|Ga0066709_102571977 | All Organisms → cellular organisms → Bacteria | 683 | Open in IMG/M |
| 3300009147|Ga0114129_13105561 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
| 3300009148|Ga0105243_10840086 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 909 | Open in IMG/M |
| 3300009148|Ga0105243_11812857 | Not Available | 641 | Open in IMG/M |
| 3300009153|Ga0105094_10569949 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300009156|Ga0111538_12316720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 674 | Open in IMG/M |
| 3300009162|Ga0075423_12416132 | All Organisms → cellular organisms → Bacteria | 573 | Open in IMG/M |
| 3300009162|Ga0075423_13170718 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 504 | Open in IMG/M |
| 3300009176|Ga0105242_10445013 | Not Available | 1220 | Open in IMG/M |
| 3300009176|Ga0105242_10563378 | Not Available | 1094 | Open in IMG/M |
| 3300009177|Ga0105248_13014691 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 536 | Open in IMG/M |
| 3300009553|Ga0105249_11647168 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 714 | Open in IMG/M |
| 3300009553|Ga0105249_12689987 | All Organisms → cellular organisms → Bacteria | 570 | Open in IMG/M |
| 3300009789|Ga0126307_10215014 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1543 | Open in IMG/M |
| 3300009789|Ga0126307_11237559 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
| 3300010039|Ga0126309_10889084 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 589 | Open in IMG/M |
| 3300010040|Ga0126308_10763450 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 668 | Open in IMG/M |
| 3300010044|Ga0126310_11248671 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
| 3300010047|Ga0126382_11318944 | All Organisms → cellular organisms → Bacteria | 653 | Open in IMG/M |
| 3300010320|Ga0134109_10303068 | Not Available | 616 | Open in IMG/M |
| 3300010360|Ga0126372_13040650 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 520 | Open in IMG/M |
| 3300010362|Ga0126377_11662098 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 713 | Open in IMG/M |
| 3300010373|Ga0134128_11538167 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 732 | Open in IMG/M |
| 3300010398|Ga0126383_13132266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 540 | Open in IMG/M |
| 3300010400|Ga0134122_10474793 | All Organisms → cellular organisms → Bacteria | 1125 | Open in IMG/M |
| 3300010403|Ga0134123_11751307 | All Organisms → cellular organisms → Bacteria | 673 | Open in IMG/M |
| 3300011412|Ga0137424_1044479 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 791 | Open in IMG/M |
| 3300012212|Ga0150985_121703003 | Not Available | 1519 | Open in IMG/M |
| 3300012469|Ga0150984_107512145 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 517 | Open in IMG/M |
| 3300012469|Ga0150984_120413605 | Not Available | 554 | Open in IMG/M |
| 3300012582|Ga0137358_10721091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
| 3300012683|Ga0137398_10634717 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300012685|Ga0137397_10204369 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1469 | Open in IMG/M |
| 3300012915|Ga0157302_10393491 | All Organisms → cellular organisms → Bacteria | 569 | Open in IMG/M |
| 3300012929|Ga0137404_11291950 | Not Available | 672 | Open in IMG/M |
| 3300012944|Ga0137410_11639149 | All Organisms → cellular organisms → Bacteria | 564 | Open in IMG/M |
| 3300012984|Ga0164309_11633801 | All Organisms → cellular organisms → Bacteria | 552 | Open in IMG/M |
| 3300012984|Ga0164309_11865903 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 515 | Open in IMG/M |
| 3300012985|Ga0164308_10589985 | All Organisms → cellular organisms → Bacteria | 944 | Open in IMG/M |
| 3300012988|Ga0164306_11912987 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 516 | Open in IMG/M |
| 3300013297|Ga0157378_13046520 | All Organisms → cellular organisms → Bacteria | 520 | Open in IMG/M |
| 3300013306|Ga0163162_12961322 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 546 | Open in IMG/M |
| 3300014325|Ga0163163_13021802 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp. | 525 | Open in IMG/M |
| 3300014325|Ga0163163_13300035 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
| 3300014326|Ga0157380_10079013 | All Organisms → cellular organisms → Bacteria | 2686 | Open in IMG/M |
| 3300015200|Ga0173480_10230170 | All Organisms → cellular organisms → Bacteria | 999 | Open in IMG/M |
| 3300015262|Ga0182007_10412487 | All Organisms → cellular organisms → Bacteria | 516 | Open in IMG/M |
| 3300015357|Ga0134072_10351401 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 566 | Open in IMG/M |
| 3300015372|Ga0132256_101523720 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 779 | Open in IMG/M |
| 3300015372|Ga0132256_102320366 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 640 | Open in IMG/M |
| 3300015374|Ga0132255_102709914 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
| 3300018000|Ga0184604_10059595 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1081 | Open in IMG/M |
| 3300018051|Ga0184620_10238859 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 609 | Open in IMG/M |
| 3300018061|Ga0184619_10111691 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1233 | Open in IMG/M |
| 3300018075|Ga0184632_10212809 | All Organisms → cellular organisms → Bacteria | 850 | Open in IMG/M |
| 3300018429|Ga0190272_10737038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 894 | Open in IMG/M |
| 3300018469|Ga0190270_12814739 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 549 | Open in IMG/M |
| 3300018476|Ga0190274_11634898 | All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → unclassified Gemmatimonadetes → Gemmatimonadetes bacterium | 737 | Open in IMG/M |
| 3300018481|Ga0190271_10610402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1210 | Open in IMG/M |
| 3300018482|Ga0066669_10481411 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1071 | Open in IMG/M |
| 3300018920|Ga0190273_11150644 | Not Available | 655 | Open in IMG/M |
| 3300019362|Ga0173479_10152512 | All Organisms → cellular organisms → Bacteria | 925 | Open in IMG/M |
| 3300020009|Ga0193740_1038635 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 754 | Open in IMG/M |
| 3300020059|Ga0193745_1129037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 521 | Open in IMG/M |
| 3300025923|Ga0207681_11508443 | All Organisms → cellular organisms → Bacteria | 563 | Open in IMG/M |
| 3300025925|Ga0207650_11153089 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 660 | Open in IMG/M |
| 3300025926|Ga0207659_10022921 | All Organisms → cellular organisms → Bacteria | 4164 | Open in IMG/M |
| 3300025926|Ga0207659_10734635 | All Organisms → cellular organisms → Bacteria | 846 | Open in IMG/M |
| 3300025926|Ga0207659_11120341 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 677 | Open in IMG/M |
| 3300025933|Ga0207706_10143491 | All Organisms → cellular organisms → Bacteria | 2101 | Open in IMG/M |
| 3300025933|Ga0207706_10599099 | Not Available | 946 | Open in IMG/M |
| 3300025936|Ga0207670_10941646 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 725 | Open in IMG/M |
| 3300025940|Ga0207691_10483250 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1052 | Open in IMG/M |
| 3300025986|Ga0207658_11851188 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 550 | Open in IMG/M |
| 3300026121|Ga0207683_10053985 | All Organisms → cellular organisms → Bacteria | 3524 | Open in IMG/M |
| 3300026121|Ga0207683_11839433 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Vicinamibacteria → Vicinamibacterales → Vicinamibacteraceae → Luteitalea → unclassified Luteitalea → Luteitalea sp. | 554 | Open in IMG/M |
| 3300026323|Ga0209472_1231741 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 597 | Open in IMG/M |
| 3300026527|Ga0209059_1071789 | Not Available | 1484 | Open in IMG/M |
| 3300026527|Ga0209059_1164306 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 794 | Open in IMG/M |
| 3300027645|Ga0209117_1193364 | Not Available | 515 | Open in IMG/M |
| 3300027651|Ga0209217_1206039 | Not Available | 527 | Open in IMG/M |
| 3300027717|Ga0209998_10068584 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 845 | Open in IMG/M |
| 3300027722|Ga0209819_10118291 | Not Available | 926 | Open in IMG/M |
| 3300027818|Ga0209706_10282641 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 789 | Open in IMG/M |
| 3300027843|Ga0209798_10104205 | All Organisms → cellular organisms → Bacteria | 1442 | Open in IMG/M |
| 3300027873|Ga0209814_10196853 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 870 | Open in IMG/M |
| 3300027873|Ga0209814_10269226 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 740 | Open in IMG/M |
| 3300027909|Ga0209382_11684995 | Not Available | 623 | Open in IMG/M |
| 3300028379|Ga0268266_11913580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
| 3300028587|Ga0247828_10256184 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300028592|Ga0247822_10721284 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 807 | Open in IMG/M |
| 3300028597|Ga0247820_10070974 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2067 | Open in IMG/M |
| 3300031114|Ga0308187_10343202 | Not Available | 574 | Open in IMG/M |
| 3300031421|Ga0308194_10346916 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
| 3300031538|Ga0310888_10003658 | All Organisms → cellular organisms → Bacteria | 5125 | Open in IMG/M |
| 3300031538|Ga0310888_10125049 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1342 | Open in IMG/M |
| 3300031547|Ga0310887_10762916 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
| 3300031854|Ga0310904_10465653 | Not Available | 841 | Open in IMG/M |
| 3300031854|Ga0310904_10625890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
| 3300031858|Ga0310892_10009686 | All Organisms → cellular organisms → Bacteria | 3879 | Open in IMG/M |
| 3300031944|Ga0310884_10268492 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
| 3300032013|Ga0310906_10773557 | Not Available | 676 | Open in IMG/M |
| 3300032174|Ga0307470_11898580 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
| 3300032179|Ga0310889_10674860 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 538 | Open in IMG/M |
| 3300032205|Ga0307472_100615829 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 961 | Open in IMG/M |
| 3300032211|Ga0310896_10009682 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Gemmatales → Gemmataceae → Frigoriglobus → Frigoriglobus tundricola | 3059 | Open in IMG/M |
| 3300032211|Ga0310896_10302343 | All Organisms → cellular organisms → Bacteria | 828 | Open in IMG/M |
| 3300033407|Ga0214472_10830328 | Not Available | 829 | Open in IMG/M |
| 3300033412|Ga0310810_11018817 | All Organisms → cellular organisms → Bacteria | 704 | Open in IMG/M |
| 3300033551|Ga0247830_10501194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 955 | Open in IMG/M |
| 3300034148|Ga0364927_0203223 | All Organisms → cellular organisms → Bacteria | 584 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.36% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 8.87% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 8.87% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 6.40% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 4.43% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 4.43% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.45% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 2.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.96% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.46% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 2.46% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 2.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.46% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.46% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 1.97% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 1.97% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.48% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 1.48% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.48% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.48% |
| Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 0.99% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.99% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.99% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.99% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.49% |
| Sugarcane Root And Bulk Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.49% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.49% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.49% |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000363 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
| 3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
| 3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
| 3300003319 | Sugarcane bulk soil Sample L2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
| 3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
| 3300004778 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005181 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_127 | Environmental | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
| 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005450 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 | Environmental | Open in IMG/M |
| 3300005451 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 | Environmental | Open in IMG/M |
| 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Environmental | Open in IMG/M |
| 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
| 3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
| 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Environmental | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
| 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Host-Associated | Open in IMG/M |
| 3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006796 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 | Environmental | Open in IMG/M |
| 3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
| 3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
| 3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
| 3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
| 3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Host-Associated | Open in IMG/M |
| 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009153 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (3) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300009789 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28 | Environmental | Open in IMG/M |
| 3300010039 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot56 | Environmental | Open in IMG/M |
| 3300010040 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot55 | Environmental | Open in IMG/M |
| 3300010044 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010320 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_11112015 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011412 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT620_2 | Environmental | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012582 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015357 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_5_0_1 metaG | Environmental | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
| 3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
| 3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
| 3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
| 3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
| 3300018075 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b1 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300018482 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118 | Environmental | Open in IMG/M |
| 3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300020009 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s1 | Environmental | Open in IMG/M |
| 3300020059 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2 | Environmental | Open in IMG/M |
| 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026323 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_130 (SPAdes) | Environmental | Open in IMG/M |
| 3300026527 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151 (SPAdes) | Environmental | Open in IMG/M |
| 3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027651 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027722 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 19-21cm March2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027818 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 19-21cm September2015 (SPAdes) | Environmental | Open in IMG/M |
| 3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
| 3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028587 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day3 | Environmental | Open in IMG/M |
| 3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
| 3300028597 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glucose_Day14 | Environmental | Open in IMG/M |
| 3300028799 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_123 | Environmental | Open in IMG/M |
| 3300031114 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031421 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300031538 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D1 | Environmental | Open in IMG/M |
| 3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
| 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Host-Associated | Open in IMG/M |
| 3300031716 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031854 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1 | Environmental | Open in IMG/M |
| 3300031858 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D2 | Environmental | Open in IMG/M |
| 3300031892 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D2 | Environmental | Open in IMG/M |
| 3300031944 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D1 | Environmental | Open in IMG/M |
| 3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300032211 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D1 | Environmental | Open in IMG/M |
| 3300033407 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT140D175 | Environmental | Open in IMG/M |
| 3300033412 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NC | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| 3300034148 | Sediment microbial communities from East River floodplain, Colorado, United States - 18_j17 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ICChiseqgaiiFebDRAFT_139331231 | 3300000363 | Soil | MTRVDSAVLDLAEGLCQKFQLLTGRTNVWLALQLTNLSIIVYFVW |
| JGI1027J12803_1068264442 | 3300000955 | Soil | MTFIDSVVLNLIERSCRGFQRLTGRTNVWLALQLTNLSIIVYFVWAGLYAV |
| JGI10216J12902_1003794601 | 3300000956 | Soil | MAFIDSVLLDLTERCCRRFQLLTGRTNVWLAIQFTNLSIVVYFVWAG |
| JGI10216J12902_1037928351 | 3300000956 | Soil | MIAIDSVLLNLTERSCRAFQRLTGKTNVWLAVQLTNLSIVM |
| soilL2_101545192 | 3300003319 | Sugarcane Root And Bulk Soil | MAAIDSALLDFVEWLCRKFQVLTGRTNVWLAVQFTNLSIIVYFIWAGVYFVSS |
| Ga0063454_1017168681 | 3300004081 | Soil | MTYVDAGILHVIEYVCHRIQRLTGRTNVWLAVQLTNVTVVVYFAWAVLFFAGVDRVL |
| Ga0062593_1000480791 | 3300004114 | Soil | VYYLPHSGPVGYIDSAILNLTEWACRRFQVLTGRTNVWLAVQFTNLSIIVYFVWAGVYWW |
| Ga0062593_1011199861 | 3300004114 | Soil | MAFIDSVVLNLTERSCRGFQRLTGRTNVWLALQLTNLSIIV |
| Ga0062593_1013110891 | 3300004114 | Soil | MIFVDTVILNLFERACRRFQQLTGRTNVWLALQLTNLSIVVYFLWAGASFWSAESGLRLFVGL |
| Ga0062593_1032900322 | 3300004114 | Soil | MPRGENSARECSVRYLDTAILDATEWLCRKFQLATGRTNVWVAVQLTNLSIIVYFVWAAV |
| Ga0063455_1007272451 | 3300004153 | Soil | MTYIDAALLNTIEWFCHKFQLLTGRTNVWLAAQLTNLSIV |
| Ga0063455_1007413521 | 3300004153 | Soil | MTYIDSAILDLTEWFCRKFQVLTGRTNAWLAVQFTNLSIVMYFVWAGVYFWNSDVEARVA |
| Ga0062589_1008656661 | 3300004156 | Soil | MAYIDSSILNVTEWLCRRFQLLTGRTNVWLAFQLTNLSIIVYFVWAGMLYFWSSDRTAR |
| Ga0062589_1020592022 | 3300004156 | Soil | MAFIDLAILNITERLCRTFQRLTGRTNVWLAFQLTNLSIVVYFVWAGVYVWGTRGVTRTLIAA |
| Ga0062589_1026305961 | 3300004156 | Soil | MIYIDGRILDVVEWLCRRFQFFTGRTNLWLAVQLTNLSIILYFPWTAGAFWGSG |
| Ga0063356_1007778171 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTYIDQGILNLVEWLCHKFQRLTGRTNVWLALQLTNLSIIVYFIVYFVWPNVYFGRRHV |
| Ga0063356_1032028062 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MTYIDEIILDLTERLCRRFQLLTGRTNVWLAVQLTNLSIVVYFVWAGAYIWSSDWPIRIVLGLFCG |
| Ga0063356_1055625331 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAFIDSVLLDLTERSCRRFQLLTGRTNVWLAIQFTNLSIVVYFVWAGFVYV |
| Ga0062595_1010557471 | 3300004479 | Soil | VTYIDAVILNLAERACRRFQMLTGRTNVWLAVQLTNLSIIVYFVWAGLFFWNADIVPR |
| Ga0062383_105078762 | 3300004778 | Wetland Sediment | VGYVDTAVLNVVERLCRRFQLLTGRSNVWLAVQLTNLSVAVYFV |
| Ga0062594_1000899261 | 3300005093 | Soil | MTYVDAALLNLVELVCRKFQVLTGRTNVWLAIQLTNLSIVVYFLWAVLY |
| Ga0066678_100750272 | 3300005181 | Soil | MNRIDVFILDVTEWACRKFQLLTGKTNVWLAVQLTNLSIIVYFVWAGLYFWSTELWLR |
| Ga0065712_107514302 | 3300005290 | Miscanthus Rhizosphere | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVLFFVW |
| Ga0070690_1008687852 | 3300005330 | Switchgrass Rhizosphere | MTFIDSVVLNLIERSCRRFQRLTGRTNVWLALQLTNLSIIVYFVWAGLYA |
| Ga0070670_1013721761 | 3300005331 | Switchgrass Rhizosphere | MTYIDTALLDFTEQVCRRFQIWTGRTNVWLAFQLTNLSIIIYFVWAATLY |
| Ga0066388_1001602211 | 3300005332 | Tropical Forest Soil | MASLDSAILDFTERCCRRFQLLTGRTNVWLALQLTNLSIVVYFVWAAMS |
| Ga0066388_1006276181 | 3300005332 | Tropical Forest Soil | VTYVDSAILDATEWLCRRFQILTGRTNVWLAVQLTNVSIILYFVWAATYFWNTDLTT |
| Ga0066388_1040065912 | 3300005332 | Tropical Forest Soil | MTYIDSVILNLIERSCRRFQRLTGRTNVWLALQLTNLSVIVYFVWA |
| Ga0070677_102466222 | 3300005333 | Miscanthus Rhizosphere | MTYIDAAVLNLIERLCHRFQLLTGRTNVWLAVQFTNVSIILYFVWAAMYFWRS |
| Ga0068869_1007687022 | 3300005334 | Miscanthus Rhizosphere | MAYIDSSILNVTEWFCRRFQLLTGRTNVWLAFQLTNLSIIVYFVWAGMLYFWSSDRTARLSL |
| Ga0068869_1012616521 | 3300005334 | Miscanthus Rhizosphere | MAYIDSAILNLTERVCRRFQLLTGKTNVWLAVQLTNLSIIVYFVWAG |
| Ga0068869_1017582332 | 3300005334 | Miscanthus Rhizosphere | MTFIDSVLLDLTERFCRRFQLLTGRTNMWLAVQLTNLSIIVYFVWA |
| Ga0070666_114780822 | 3300005335 | Switchgrass Rhizosphere | MRAIDSALLNLTERFCHRFQVVTGRTSVWLAFQLTNLSIVVYFVGTGLYFWNASGLPR |
| Ga0070687_1006457722 | 3300005343 | Switchgrass Rhizosphere | VFFLDSVILDATERVCRRFQLLTGRTNVWLAMQLTNISIIVYF |
| Ga0070668_1005966322 | 3300005347 | Switchgrass Rhizosphere | MTYIDSAILNLTERCCRRFQVLTGRTNVWLAVQLTNLSIIV |
| Ga0070671_1011314931 | 3300005355 | Switchgrass Rhizosphere | MAFIDSAVLNLIERSCRGFQRLTGRTNVWLAVQLTNLSIVV |
| Ga0070659_1008682552 | 3300005366 | Corn Rhizosphere | MGYVDSAILNLTEWACRRFQVLTGRTNVWLAVQFTNLSIIVYFVWAGVY |
| Ga0070703_104189201 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | VTYIDSALLNLIERTCRRFQLLTGRTNVWLAIQLTNLSIVVYFV |
| Ga0070701_105640952 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFIDSAVLNLIERSCRGFQRLTGRTNVWLAVQLTNLSIIIYFVWA |
| Ga0070694_1009970112 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYIDSVILDLTERACRRFQMLTGRTNVWLAGQLTNLSIIVYFVWA |
| Ga0066682_109247661 | 3300005450 | Soil | MTYIDAVILNLTEWACRRFQVLTGRTNVWLAVQFTNLSIIVYFIWAALYF |
| Ga0066681_102885792 | 3300005451 | Soil | MTYVDAVILDLTEWACRRFQVVTGRTNVWLAVQLTNLSIILYFVWAMM |
| Ga0070663_1021503892 | 3300005455 | Corn Rhizosphere | MALIDSVILRLTERACRRFQRLTGRTNVWLAAQLTNLSIIVYFVW |
| Ga0070662_1006628021 | 3300005457 | Corn Rhizosphere | MGYIDSAILDLTEWCCRKFQLLTGRTNVWLAVQLTNLSIIVYF |
| Ga0070681_101609031 | 3300005458 | Corn Rhizosphere | MLHVDAAILSATERFARRFQVLTGRTNIWLAVQLTNLSIVVYFVW |
| Ga0070699_1017640182 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MAYIDSATLNLTEWFCRQFQLPTGRTNVWLAVQFTNLNIIVYFIWAGVYFWKAASRPE* |
| Ga0066697_105307241 | 3300005540 | Soil | MIDVDSVILNLIERSCQAFQRLTGRTNVWLAFQLTNLSIIVYFAWAGVYVLQSGHVV |
| Ga0070672_1004222464 | 3300005543 | Miscanthus Rhizosphere | MALIDSVILRLTERACRRFQRLTGRTNVWLAAQLTNLSIIVYFVWAG |
| Ga0070696_1020252332 | 3300005546 | Corn, Switchgrass And Miscanthus Rhizosphere | MIFVDTVILNLVERACRRFQQLTGRTNVWLALQLTNLSIVVY |
| Ga0068854_1000471151 | 3300005578 | Corn Rhizosphere | VFFLDSLILDATERVCRRFQLLTGRTNVWLAMQLTNISIIVYFVWAAL |
| Ga0068859_1012730811 | 3300005617 | Switchgrass Rhizosphere | MTYVDAALLNLVELVCRKFQVLTGRTNVWLAIQLTNLSIVVYFLWAVLYF |
| Ga0068866_108351521 | 3300005718 | Miscanthus Rhizosphere | MTYIDLAVLNLTEWFCHKLQVLTGRTNVWLAVQLTNLSIIVYFVW |
| Ga0068863_1024797791 | 3300005841 | Switchgrass Rhizosphere | MGYVDSAILNLTEWACRKFQVLTGRTNVWLAVQFTNLSIIVYFVWAGV |
| Ga0068862_1004563411 | 3300005844 | Switchgrass Rhizosphere | VTFIDSVLLNLTERTCRRFQLLTGRTNVWLAIQFTNLSIVVYFVWA |
| Ga0068862_1023836732 | 3300005844 | Switchgrass Rhizosphere | MTYIDAAILTLTEWCCRRFQLLTGRTNIWLALQLTNLSIVVYFVWA |
| Ga0081539_103225001 | 3300005985 | Tabebuia Heterophylla Rhizosphere | VGYVDSVILNATERLCHRFQRMTGRTNIWLAVQLTNLSIIMYFVCASMYFWRAEMTGRIL |
| Ga0075417_106481222 | 3300006049 | Populus Rhizosphere | MTYIDSQLLNLTESLCQRFQVLTGKTNVWLAVQLTNLSVVVYFVWI |
| Ga0070716_1012511832 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | LTIDDALLNATEWFCRKFQVLTGRTNVWLAFQLTNLSIILYFVWAAMYFWNE |
| Ga0066665_108738471 | 3300006796 | Soil | MIDVDSVILNLTERSCQAFQRLTGRTNVWLAFQLTNLSIIVYFAWAGLYVW |
| Ga0066665_116869951 | 3300006796 | Soil | MTYIDAAILNVTESFCHTFQRLTGRTNVWLAVQITNLSIIVYFVWAAV |
| Ga0075421_1017837332 | 3300006845 | Populus Rhizosphere | MTFIDSVVLNLIERSCRGFQRLTGRTNVWLALQLTNLSIIVYFVWAGLYAFN |
| Ga0075430_1004286743 | 3300006846 | Populus Rhizosphere | MAFIDSVVLNLIERSCRGFQRLTGRTNVWLAVQLTNLSIIVYF |
| Ga0075431_1002083573 | 3300006847 | Populus Rhizosphere | MLAFDSFTLDLVEWLCRKFQWLTGRTNVWLAAQLTNLS |
| Ga0075431_1004943571 | 3300006847 | Populus Rhizosphere | MTFIDSVVLNLIERSCRGFQRLTGRTNVWLAVQLTNLSIILYFVWAGLYSLNI |
| Ga0075433_118908192 | 3300006852 | Populus Rhizosphere | MIFIDSAILNVTEWLCRRFQLLTGRTSVWLAFQLTNLSIVVYFVWAAM |
| Ga0075420_1015436071 | 3300006853 | Populus Rhizosphere | MTRVDSAILGLAEWFCQKFQLLTGRTNVWLALQLTNL |
| Ga0075425_1012601292 | 3300006854 | Populus Rhizosphere | MAFIDSAVLNLIERSCRGFQRLTGRTNVWLAVQLTNLSIIIYFVWAGLWSLIV |
| Ga0075429_1009898982 | 3300006880 | Populus Rhizosphere | MLYIDSVILDMIERLPQISAADRRTNVWLALQLTNLSIVVYFLWAA |
| Ga0068865_1003207491 | 3300006881 | Miscanthus Rhizosphere | MTYIDSAILNLTEWFCHRFQLLTGRTNVWLAVQLTNLSIIVYF |
| Ga0066710_1014618761 | 3300009012 | Grasslands Soil | MNHIDLFILDMTEWACRKFQLLTGKTNVWLAVQLTNLSIIVYFVW |
| Ga0105245_123762422 | 3300009098 | Miscanthus Rhizosphere | VFFLDSLILDATERVCRRFQLLTGRTNVWLAMQLTN |
| Ga0066709_1001226155 | 3300009137 | Grasslands Soil | MIDVDSVILNLTERSCQAFQRLTGRTNVWLAFQLTNLSIIVYFAWAGLYVWQSGD |
| Ga0066709_1017432171 | 3300009137 | Grasslands Soil | MTYLDTAILNLTERFCRKFQLLTGKTNVWLAIQLTNLSIIVYFVWAGVF |
| Ga0066709_1023167391 | 3300009137 | Grasslands Soil | VQTLDTAVLDLTESLCRRFQRLTGRTNVWLAGQLTNVSIIVYFVWAALSFWRRDPATRLF |
| Ga0066709_1025719771 | 3300009137 | Grasslands Soil | MTYVDTALLDLTEWCCRKFQLLTGRTNVCLAIQLTNLSIIVYFVWAALFFWIS |
| Ga0114129_113954711 | 3300009147 | Populus Rhizosphere | MLYIDSVILDMIERACRRFQRLTGRTNVWLALQLTNLSIVVYFLWAAVAFAGA |
| Ga0114129_131055611 | 3300009147 | Populus Rhizosphere | MTYIDTVILNLIERFCRRFQRLTGRTNVWLAVQLTN |
| Ga0105243_108400862 | 3300009148 | Miscanthus Rhizosphere | LWDIVSGKMTYIDSAILNLTEWFCHRFQLLTGRTNVWLAV |
| Ga0105243_118128572 | 3300009148 | Miscanthus Rhizosphere | MTYIDPAILDVTEWFCHRFQLLTGRTNVWLALQLTNLSIIVYFVWAGVYFWS |
| Ga0105094_105699491 | 3300009153 | Freshwater Sediment | MIYIDSVIVNVVERACRRFQRLTGKTNVWLAVQFTNLSIIVYF |
| Ga0111538_123167202 | 3300009156 | Populus Rhizosphere | VPGIDELLLDFTERLCQRFQELTGRTNVWLAVQLTNLSIII |
| Ga0075423_124161321 | 3300009162 | Populus Rhizosphere | LTYIDSALLDLIEWSTRRFQRLTGRTNVWLAVQLTNLSIVVYFVWAAMVF |
| Ga0075423_131707182 | 3300009162 | Populus Rhizosphere | MTFIDSVVLNLIERSCRGFQRLTGRTNVWLALQLTNLSIIVYFVWA |
| Ga0105242_104450131 | 3300009176 | Miscanthus Rhizosphere | VTLVDSILLDLTEWLCRRLQVLTGRTNVWLAFQLTNFSIVVFFVWAGMHFRIG |
| Ga0105242_105633782 | 3300009176 | Miscanthus Rhizosphere | MTFIDSAVLNLIERSCRGFQRLTGRTNVWLAIQLTNLSII |
| Ga0105248_125907421 | 3300009177 | Switchgrass Rhizosphere | MTYIDSAILDLTEWFCHRFQRLTGRTNVWLALQLTNLSIIVYFVWAGVVYFWSSDAAVR |
| Ga0105248_130146911 | 3300009177 | Switchgrass Rhizosphere | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVLFFVWAGMHLVIG |
| Ga0105249_116471682 | 3300009553 | Switchgrass Rhizosphere | VTFIDSVLLNLTERTCRRFQLLTGRTNVWLAIQFTNLSIVVYFVWAGVVYVLSG |
| Ga0105249_126899871 | 3300009553 | Switchgrass Rhizosphere | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVWAGMHFRIG |
| Ga0126307_102150142 | 3300009789 | Serpentine Soil | MTYIDSVLLNLTERACRRFQLLTGRTNVWLAIQFTNLSIVVYFVWAGV |
| Ga0126307_112375592 | 3300009789 | Serpentine Soil | MTFIDAAILNLTERCCRRFQRLTGRTNVWLGVQLTNLSIIVYFIWAGVYSWSS |
| Ga0126309_108890841 | 3300010039 | Serpentine Soil | MTYIDSGILHLAEWFCHRFQRLTGRTNVWLAVQLTNLSIIVYFVWAGVY |
| Ga0126308_107634501 | 3300010040 | Serpentine Soil | MTYIDAAVLNLIERLCHRFQRLTGRTNIWLAVQFTNVSII |
| Ga0126310_112486711 | 3300010044 | Serpentine Soil | MTYIDAAVLNFIERLCHRFQRLTGRTNIWLAVQFTNVSIIV |
| Ga0126382_113189441 | 3300010047 | Tropical Forest Soil | MASIDAAILDLTERCCRRFQVLTGRTNVWLALQLTNLSIVVYFV |
| Ga0134109_103030681 | 3300010320 | Grasslands Soil | LNYIDDALLNATEWCCRRFQVLTGRTNVWLAFQLTNLSIIVYFVWALMYFWAEDFATRV |
| Ga0126376_131640841 | 3300010359 | Tropical Forest Soil | MIAIDSVLLDMTEWLCHKIQLLTGRTNVWLSVQLTNLSIIVYFVW |
| Ga0126372_130406501 | 3300010360 | Tropical Forest Soil | VLFIDSVLLNATEWACRKFQVLTGRTNVWLAFQLTNFSIVVFFVWAGMHFRI |
| Ga0126377_116620982 | 3300010362 | Tropical Forest Soil | MTYIDSVLVRLTEWCCHRFQRLTGRTNIWLAVQLTNLSIIVYFVWAAAYLWAGGL |
| Ga0134128_115381672 | 3300010373 | Terrestrial Soil | MGYVDSAILNLTEWACRKFQVLTGRTNVWLAVQFTNLSIIVYFVWAGVYWWSSD |
| Ga0126383_131322662 | 3300010398 | Tropical Forest Soil | MTYIDSAILNITEWCCRRFQLLTGRTNVWLAFQLTNLS |
| Ga0134122_104747931 | 3300010400 | Terrestrial Soil | MTYIDSAILDLTERCCRRFQVLTGRTNVWLAVQLTNLSIIVYFVW |
| Ga0134123_117513073 | 3300010403 | Terrestrial Soil | MMIYIDSAILNLTEWFCRKFQLLTGRTNVWLAVQFTNLSIIVYFVWAGVYFWSSGV |
| Ga0137424_10444793 | 3300011412 | Soil | MLYIDSVILNMIERACRRFQRLTGRTNVWLALQLT |
| Ga0150985_1217030032 | 3300012212 | Avena Fatua Rhizosphere | MTYIDAALLNAIEWICHKVQLLTGRTNVWLAAQLTNLSIVMYFVW |
| Ga0150984_1011449801 | 3300012469 | Avena Fatua Rhizosphere | MTYIDAALLNTIEWFCHKFQLLTGRTNVWLAAQLTNLSIVMYFVWAAMYFWNTDFTLRLS |
| Ga0150984_1075121452 | 3300012469 | Avena Fatua Rhizosphere | MTYIDSALLDFVERLCHRFQIMTGRTNLWLAFQLTNLSIVVYFVWTGVYIWNSHG |
| Ga0150984_1204136051 | 3300012469 | Avena Fatua Rhizosphere | VFFLDSLILDATEWVCRRFQVLTGRTNVWLALQLTNLSIVVYF |
| Ga0137358_107210912 | 3300012582 | Vadose Zone Soil | VTYIDSALVNLTESLCRKFQLLTGRTNVWLALQLTNLSII |
| Ga0137398_106347171 | 3300012683 | Vadose Zone Soil | MTYIDSAVLNLTEWFCHRFQLLTGRTNVWLAVQLTN |
| Ga0137397_102043691 | 3300012685 | Vadose Zone Soil | MAYVDLAVLNLTEWSCQRFQVLTGRTNVWLAAQLTNLSIIVYFVLWAGLYFS |
| Ga0157302_103934912 | 3300012915 | Soil | MTRIDSAILDLTERFCRRFQLVTGRTNIWLAVQLTN |
| Ga0137404_112919501 | 3300012929 | Vadose Zone Soil | MTYIDSAVLNLTERCCRRFQLLTGKTNIWLAMQLTNLSIIVYF |
| Ga0137410_116391492 | 3300012944 | Vadose Zone Soil | MTYIDSAVLNLTERCCRRFQLLTGKTNIWLAMQLTNLS |
| Ga0164309_116338011 | 3300012984 | Soil | MTYLDSAILNAFERVCRKFQVLTGRTNVWLAVQLTNLSIVVYFIWAGVYFWKSELWLRASVGAFCVG |
| Ga0164309_118659032 | 3300012984 | Soil | MTYIDLALLDLIEGLCRRFQILTGRTNVCLAFELTNLSIIVYFIWAGVYFWAIPGL |
| Ga0164308_105899852 | 3300012985 | Soil | MTYIDQALLNIVEWCCRRVQVLTGRTNVWLALQLTNLSIVV |
| Ga0164306_119129871 | 3300012988 | Soil | MTYIDQALLNIVEWCCRRVQVLTGRTNVWLALQLTNLSIVVYF |
| Ga0157378_130465201 | 3300013297 | Miscanthus Rhizosphere | MTRIDSAILDLTERFCRRFQLVTGRTNIWLAVQLTNLSIIMYFVWA |
| Ga0163162_129613221 | 3300013306 | Switchgrass Rhizosphere | VTLVDSLLLDQIELLCRRFQVLTGRTNVWLAVQLTNLSVVVYFIW |
| Ga0163163_130218022 | 3300014325 | Switchgrass Rhizosphere | MGFIDSTILNLTEWACRKFQALTGRTNLWLAVQLTNLSIIVYFVWAAAYFISSDWPPRIF |
| Ga0163163_133000351 | 3300014325 | Switchgrass Rhizosphere | MTYLDTLLLDLVERSCRGFQRLTGRTNVWLAVQLTNISIIVYFVWA |
| Ga0157380_100790131 | 3300014326 | Switchgrass Rhizosphere | MIFVDTVILNLVEGACRRFQQLTGRSNVWLALQLTNLSIVVY |
| Ga0173480_102301703 | 3300015200 | Soil | MTYLDLGLLNLIEQGCRAFQRLTGKTNVWLGVQLTNLSIVVFFAWA |
| Ga0182007_104124871 | 3300015262 | Rhizosphere | MITIDAAILNVTEWLCRKFQRLTGRTSVWLAFQLTNLSIIVYFVWAAMSVW |
| Ga0134072_103514011 | 3300015357 | Grasslands Soil | MLYIDLAILNLTERSCQRFQRVTGRTNVWLAVQLTNLSIIV |
| Ga0132258_109533391 | 3300015371 | Arabidopsis Rhizosphere | VFFLDSVILDATEQVCRRFQLLTGRTNVWLAMQLTNISIIVY |
| Ga0132256_1015237201 | 3300015372 | Arabidopsis Rhizosphere | MTYIDSAILNLTESLCRRFQLLTGRTNVWLALQLTNLSIVVYFIWACVYF |
| Ga0132256_1023203662 | 3300015372 | Arabidopsis Rhizosphere | MLYIDSVILNMIERACRRFQRLTGRTNVWLALQLTNLSIVIYFAWA |
| Ga0132255_1027099142 | 3300015374 | Arabidopsis Rhizosphere | MTYLDSVVLDLTERACRRFQVLTGRTNVWLAGQLTNLSIVVYFVWAAMAFWREDAA |
| Ga0184604_100595951 | 3300018000 | Groundwater Sediment | MTYIDSVLLNLTEWFCRQFQLLTGRTNVWLAVQFTNLSIIVYFV |
| Ga0184620_102388591 | 3300018051 | Groundwater Sediment | MTYIDSAILDLTEWLCHRFQLVTGRSNVWLAVQLTN |
| Ga0184619_101116913 | 3300018061 | Groundwater Sediment | MTYIDSVLLNLTEWFCRQFQLLTGRTNVWLAVQFTNLSIIVYFVWAGVYFWSSDIL |
| Ga0184632_102128091 | 3300018075 | Groundwater Sediment | MTYIDSAILNLTEWFCRQFQLLTGRTNVWLAVQFTNLNIIVYFVWA |
| Ga0190272_107370381 | 3300018429 | Soil | MLYIDSVILNMIERACRWFQRLTGRTNVWLAVQLTNLSIIIYFL |
| Ga0190270_128147392 | 3300018469 | Soil | MTYIDSAILNLTEWLCRKFQLLTGRTNVWLAVQLTNLSIIVYFVWAGVYFWS |
| Ga0190274_116348981 | 3300018476 | Soil | MAVIDGAILNLTEWSCRKFQALTGRTNVWLAVQLTNVSIIVYFV |
| Ga0190271_106104021 | 3300018481 | Soil | VIDSPILDLVERFCHSFQRMTGRTNVWLAVQLTNLSIIVYFVWAGIYFWTIDDA |
| Ga0066669_104814112 | 3300018482 | Grasslands Soil | LNYIDDALLNATEWCCRRFQVLTGRTNVWLAFQLTNLSIIVYFVWALMYFW |
| Ga0190273_111506441 | 3300018920 | Soil | MPYIDQLMLNLTERSCRRFQVLTGRTNVWLAVQLTNLSI |
| Ga0173479_101525122 | 3300019362 | Soil | MTYIDSAILNLTERCCRRFQVLTGRTNVWLAVQLTNLSIIVYFVWAGMYFWIS |
| Ga0193740_10386352 | 3300020009 | Soil | MTFIDSALLNLTEWVCRQFQLLTGRTNVWLAVQFT |
| Ga0193745_11290371 | 3300020059 | Soil | MTYIDSAILNLTEWFCRQFQLLTGRTNVWLAAQFTNLSIIVY |
| Ga0207663_113806831 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | MTYLDAGVLNAFERFCHKFQRLTGRTNVWLAAQVTNRTIVVYFVWAAMYFWNTQFSVR |
| Ga0207681_115084431 | 3300025923 | Switchgrass Rhizosphere | MTYIDSAILNLTERCCRRFQVLTGRTNVWLAVQLTNLSIIVYFVWAGMYFWISDDATARL |
| Ga0207650_111530891 | 3300025925 | Switchgrass Rhizosphere | MTYIDTALLDFTERVCRRFQIWTGRTNVWLAFQLTNLSIIIYFVWAATLY |
| Ga0207659_100229215 | 3300025926 | Miscanthus Rhizosphere | MTFIDSVVLNLIERSCRGFQRLTGRTNVWLALQLTNLSII |
| Ga0207659_107346353 | 3300025926 | Miscanthus Rhizosphere | MALIDSVILRLTERACRRFQRLTGRTNVWLAAQLTNLSII |
| Ga0207659_111203413 | 3300025926 | Miscanthus Rhizosphere | MALIDSVILRLTERACRRFQRLTGRTNVWLAAQLT |
| Ga0207706_101434913 | 3300025933 | Corn Rhizosphere | MTYIDSAILNLTERCCRRFQVLTGRTNVWLAVQLTNLSIIVYFVWAGMYFWISDD |
| Ga0207706_105990992 | 3300025933 | Corn Rhizosphere | MGYIDSAILDLTEWCCRKFQLLTGRTNVWLAVQLTNLSIIVYFVSAS |
| Ga0207670_109416462 | 3300025936 | Switchgrass Rhizosphere | MTYVDAALLNLVELVCRKFQVLTGRTNVWLAIQLTNLSIVVYF |
| Ga0207691_104832503 | 3300025940 | Miscanthus Rhizosphere | MLYIDSVILDMIERACRRFQRLTGRTNVWLALQLTNLSIVIYFAW |
| Ga0207711_117146651 | 3300025941 | Switchgrass Rhizosphere | MAGIDSALLNFTERVCRRLQVLTGRTNVWLAFQLTNLSIIVYFVWAVAYFQRLTTSARVVVA |
| Ga0207658_116444621 | 3300025986 | Switchgrass Rhizosphere | VFFLDSVILDATERVCRRFQLLTGRTNVWLAMQLTNISIIVYFV |
| Ga0207658_118511882 | 3300025986 | Switchgrass Rhizosphere | MLHVDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVWAGMHFVI |
| Ga0207675_1027458942 | 3300026118 | Switchgrass Rhizosphere | MIAIDSVLLNLTERSCRAFQRLTGKTNVWLAVQLTNLSIVV |
| Ga0207683_100539851 | 3300026121 | Miscanthus Rhizosphere | MVYVDLALLDLIECLCRRFQILTGRTNVWLAFQLTNLSIVVYFIWAGVYFWTIPG |
| Ga0207683_118394331 | 3300026121 | Miscanthus Rhizosphere | MTYIDSAILNLTEWFCHRFQLLTGRTNVWLAVQLTNLSIIVYFIWAGVYFW |
| Ga0209472_12317411 | 3300026323 | Soil | MTYVDAVILDLTEWACRRFQVVTGRTNVWLAVQLTNLSIILYFVWAMMSFWN |
| Ga0209059_10717891 | 3300026527 | Soil | MNHIDLFILDMTEWACRKFQLLTGKTNVWLAVQLTNLSIIVYF |
| Ga0209059_11643062 | 3300026527 | Soil | MNRIDVFILDVTEWACRKFQLLTGKTNVWLAVQLTNLSIIVYF |
| Ga0209117_11933642 | 3300027645 | Forest Soil | MTYIDSVILNLTERFCRRFQLLTGRTNVWLAVQLTNLSIVVYFIWAGV |
| Ga0209217_12060391 | 3300027651 | Forest Soil | MTYIDSVILNLTERFCRRFQLLTGRTNVWLAVQLTNLSIVVYFIWAGVYSWSSD |
| Ga0209998_100685843 | 3300027717 | Arabidopsis Thaliana Rhizosphere | MALIDWVILRLTERACRRFQRLTGRTNVWLAAQLTNLSIIVYFV |
| Ga0209819_101182912 | 3300027722 | Freshwater Sediment | MTYIDSAMLTLAEWFCHKFQRLTGRTNVWLAVQLTN |
| Ga0209706_102826412 | 3300027818 | Freshwater Sediment | MIYIDSVIVNVVERACRRFQRLTGKTNVWLAVQFTNLSIIVYFVWAGAYFWSAE |
| Ga0209798_101042051 | 3300027843 | Wetland Sediment | VGYVDTAVLNLVERLCRRFQLLTGRTNVWLAVQLTNLSVAVYFVWAVSVYLASG |
| Ga0209814_101968531 | 3300027873 | Populus Rhizosphere | MLAFDSFTLDLVEWLCRKFQWLTGRTNVWLAAQLTNLSIVVYFVWV |
| Ga0209814_102692262 | 3300027873 | Populus Rhizosphere | MAYVDLAVLNLTEWSCQRFQALTGRTNVWLAAQLTNLSIIVYFVLWAGLYFSSRDWAWRV |
| Ga0209382_116518172 | 3300027909 | Populus Rhizosphere | MTYVDAALLNLVELVCRKFQVLTGKTSVWLAIQLTNLSIVVYFLWALLYFLIA |
| Ga0209382_116849952 | 3300027909 | Populus Rhizosphere | MTFIDSVVLNLIERSCRGFQRLTGRTNVWLALQLTNLSIIVYFVWAGLYAFNI |
| Ga0268266_119135802 | 3300028379 | Switchgrass Rhizosphere | MTYIDAAILNLTERCCRRFQRLTGRTNVWLAVQLTNLSIIVYFIWAGVYSW |
| Ga0268265_126756212 | 3300028380 | Switchgrass Rhizosphere | MTYIDAAILTLTEWCCRRFQLLTGRTNIWLALQLTNLSIVVYFVWAGAVFWSDDWPSRILLAAFC |
| Ga0247828_102561841 | 3300028587 | Soil | MALIDSVILRLTERACRRFQRLTGRTNVWLAAQLTNLSIIVYFVWAGLY |
| Ga0247822_107212843 | 3300028592 | Soil | MSYIDSALLNLTQRFCRRFQLLTGRTNVWLGLQLTNLSIVVYFVWAGAYF |
| Ga0247820_100709743 | 3300028597 | Soil | MTYIDEIILDLTERICRRFQLLTGRTNVWLAVQLTNLSIVVYFVWAGAYIWSSDWP |
| Ga0307284_101566151 | 3300028799 | Soil | MTYIDSAVLDLTEWLCHRFQLLTGRTNVWLAVQLTNLSIIVYFIWAGVYFWTGDAAVRTALGLFC |
| Ga0308187_103432022 | 3300031114 | Soil | VTYIDSALLNLTEWLCRKFQLLTGRTNVWLALQLTNLSIIVYFVWAAVYSWSSGV |
| Ga0308194_103469161 | 3300031421 | Soil | MTYIDSAILDLTEWLCHKVQLMTGRTNVWLAVQLTNLSIIV |
| Ga0310888_100036584 | 3300031538 | Soil | MIFVDTVILNLVEGACRRFQQLTGRSNVWLALQLTNLSIVVYFLWAG |
| Ga0310888_101250492 | 3300031538 | Soil | VTYIDAALLNLIEWFCRKMQLLTGWTNVWLAFQLTNLSVIVYFVWAGLYLW |
| Ga0310887_107629161 | 3300031547 | Soil | VGAVDSTLLDLTEWCCRRWQLLTGRTNVWLAVQLTNVSVIVYFVWAGVYFWGG |
| Ga0307408_1021226602 | 3300031548 | Rhizosphere | MTYIDAAVLNLIERLCHRFQRLTGRTNIWLAVQFTNVSIIVYFVWAAMYFWRSDMMVRVAFGVFGCALLY |
| Ga0310813_112102512 | 3300031716 | Soil | MSYLDALLLNLTERACHRFQRLTGRTNIWLAVQLTNISIIVYFVWAGVSFWVSATASRVFIGVFCTALLYA |
| Ga0310907_108438772 | 3300031847 | Soil | MIFVDTVILNLVEGACRRFQQLTGRSNVWLALQLTNLSIVVYFLWAGASFWSAESGLRLFVG |
| Ga0310904_104656532 | 3300031854 | Soil | MTFIDSAVLNLIERSCRGFQRLTGRTNVWLAIQLTNLSIIIYFVWAGLWSL |
| Ga0310904_106258902 | 3300031854 | Soil | MTFIDSVVLNLIERSCRRFQRLTGRTNVWLALQLTNLSIIVYFMWAGLYAFNIDIKL |
| Ga0310892_100096861 | 3300031858 | Soil | MIFVDTVILNLVEGACRRFQQLTGRSNVWLALQLTNLSIVVYFL |
| Ga0310893_102461941 | 3300031892 | Soil | MTFIDSALLNLTEAFCRKFQRLTGRTNVWLAFQLTNFSIVVYFIWGGLYVFGSRGLSRILVALLCGGVLYL |
| Ga0310884_102684922 | 3300031944 | Soil | MTRVDSAVLNLAEGLCQRFQLLTGRTNVWLALQLTNLSIIVYFVWAGLQFLSSDPATRV |
| Ga0310906_107735572 | 3300032013 | Soil | MTYIDEIILDLTERLCRRFQLLTGRTNVWLAVQLTNLSIVVYFVWAGAYIWSSDWPIRIV |
| Ga0310890_104316193 | 3300032075 | Soil | MIYLDGAILTLTEWCCRKFQLLTGRTNIWLALQLTNLSIVVYFVWAGAIFWSDDWPSRILLAAFCSA |
| Ga0306924_114673012 | 3300032076 | Soil | MIAIDSVLLDMTEWLCHKIQLLTGRTNVWLSVQLTNLS |
| Ga0307470_118985801 | 3300032174 | Hardwood Forest Soil | MTFIDSVVLNLIERSCRGFQRLTGRTNVWLALQLTNLSIIVYFVWAGLYA |
| Ga0310889_106748601 | 3300032179 | Soil | MAFIDSAVLNLIERSCRGFQRLTGRTNVWLAIQLTNLSIIIYFVWAGLW |
| Ga0307472_1006158291 | 3300032205 | Hardwood Forest Soil | MLHIDSALLDLTEWLCRRFQVLTGRTNVWLAFQLTNFSIVVFFVWAGMHFQIGG |
| Ga0310896_100096821 | 3300032211 | Soil | MTYIDSALLNLTEAFCRKFQRLTGRTNVWLAFQLT |
| Ga0310896_103023431 | 3300032211 | Soil | MTYVDAALLNLVELVCRKFQVLTGKTSVWLAIQLTNLSIVVYFL |
| Ga0214472_108303282 | 3300033407 | Soil | MTYVDAALLRLTERCCRRFQLLTGRTNVWLAVQLTNLSIIVYFAWAGAYFWSLDL |
| Ga0310810_110188171 | 3300033412 | Soil | VTHLDSAMLNAFEWACRKFQVLTGRTNVWLAFQLTNLSIVVYFVWAALSFWKSELWLRLF |
| Ga0247830_105011941 | 3300033551 | Soil | MSYIDSVILSLTERCCQRFQLLTGRTNVWLAVQLTNLSVIVYFVWATLYFWSAG |
| Ga0364927_0203223_3_152 | 3300034148 | Sediment | MAVIDGAILNLTEWSCRKFQALTGRTNVWLAVQLTNVSIIVYFVWAAAYF |
| ⦗Top⦘ |