NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F025075

Metagenome / Metatranscriptome Family F025075

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F025075
Family Type Metagenome / Metatranscriptome
Number of Sequences 203
Average Sequence Length 41 residues
Representative Sequence VRSQTYEITFLGQAGTTLRAEFDDCEVTIGPGTTTLRAELPD
Number of Associated Samples 161
Number of Associated Scaffolds 203

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 98.03 %
% of genes near scaffold ends (potentially truncated) 99.51 %
% of genes from short scaffolds (< 2000 bps) 92.12 %
Associated GOLD sequencing projects 152
AlphaFold2 3D model prediction Yes
3D model pTM-score0.58

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (52.709 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(39.901 % of family members)
Environment Ontology (ENVO) Unclassified
(35.961 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(46.305 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.57%    β-sheet: 32.86%    Coil/Unstructured: 58.57%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.58
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 203 Family Scaffolds
PF00196GerE 4.43
PF00781DAGK_cat 1.48
PF01740STAS 0.99
PF17032zinc_ribbon_15 0.99
PF13180PDZ_2 0.49
PF00654Voltage_CLC 0.49
PF06897DUF1269 0.49
PF07690MFS_1 0.49
PF02852Pyr_redox_dim 0.49
PF13604AAA_30 0.49
PF00689Cation_ATPase_C 0.49
PF14236DUF4338 0.49
PF00884Sulfatase 0.49

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 203 Family Scaffolds
COG1597Phosphatidylglycerol kinase, diacylglycerol kinase familyLipid transport and metabolism [I] 2.96
COG0038H+/Cl- antiporter ClcAInorganic ion transport and metabolism [P] 0.49
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.49
COG4803Uncharacterized membrane proteinFunction unknown [S] 0.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms52.71 %
UnclassifiedrootN/A47.29 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000364|INPhiseqgaiiFebDRAFT_104620480Not Available532Open in IMG/M
3300001454|JGI20204J15135_1031085All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → unclassified Oscillatoriales → Oscillatoriales cyanobacterium SpSt-402505Open in IMG/M
3300003505|JGIcombinedJ51221_10329863Not Available620Open in IMG/M
3300005329|Ga0070683_100346840All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1414Open in IMG/M
3300005332|Ga0066388_105106658Not Available666Open in IMG/M
3300005332|Ga0066388_105362378All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia650Open in IMG/M
3300005363|Ga0008090_15598528Not Available613Open in IMG/M
3300005436|Ga0070713_100034547All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4064Open in IMG/M
3300005436|Ga0070713_101603868Not Available632Open in IMG/M
3300005439|Ga0070711_100834372All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia783Open in IMG/M
3300005535|Ga0070684_102113441Not Available531Open in IMG/M
3300005587|Ga0066654_10676490Not Available576Open in IMG/M
3300005610|Ga0070763_10488860All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium703Open in IMG/M
3300005614|Ga0068856_100137392All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2450Open in IMG/M
3300005614|Ga0068856_100648608All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1076Open in IMG/M
3300005712|Ga0070764_11053320All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia514Open in IMG/M
3300005713|Ga0066905_101904972Not Available550Open in IMG/M
3300005764|Ga0066903_102820192All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia943Open in IMG/M
3300005764|Ga0066903_105129305All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia694Open in IMG/M
3300006052|Ga0075029_101219938Not Available526Open in IMG/M
3300006176|Ga0070765_100785303All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia900Open in IMG/M
3300006354|Ga0075021_11135651Not Available512Open in IMG/M
3300006804|Ga0079221_11728279Not Available510Open in IMG/M
3300006806|Ga0079220_10806113All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia711Open in IMG/M
3300006914|Ga0075436_100900049Not Available662Open in IMG/M
3300009137|Ga0066709_102425540All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia711Open in IMG/M
3300009520|Ga0116214_1423291Not Available521Open in IMG/M
3300009545|Ga0105237_11048995All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia822Open in IMG/M
3300009698|Ga0116216_10771938All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia576Open in IMG/M
3300010043|Ga0126380_10676300All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia826Open in IMG/M
3300010043|Ga0126380_10928850All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia726Open in IMG/M
3300010046|Ga0126384_11371367All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia658Open in IMG/M
3300010359|Ga0126376_12929856Not Available527Open in IMG/M
3300010360|Ga0126372_10463382All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1179Open in IMG/M
3300010360|Ga0126372_11548466All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia700Open in IMG/M
3300010361|Ga0126378_11281693All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia828Open in IMG/M
3300010362|Ga0126377_13210902Not Available528Open in IMG/M
3300010366|Ga0126379_13485893Not Available527Open in IMG/M
3300010371|Ga0134125_10617130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1198Open in IMG/M
3300010376|Ga0126381_103464677All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia620Open in IMG/M
3300010398|Ga0126383_11479866All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia769Open in IMG/M
3300010398|Ga0126383_11822119Not Available697Open in IMG/M
3300010398|Ga0126383_13363800Not Available522Open in IMG/M
3300010867|Ga0126347_1114087All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia742Open in IMG/M
3300012207|Ga0137381_10525285Not Available1032Open in IMG/M
3300012285|Ga0137370_10492158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia750Open in IMG/M
3300012285|Ga0137370_11027652Not Available507Open in IMG/M
3300012357|Ga0137384_10427434Not Available1092Open in IMG/M
3300012948|Ga0126375_11674705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii551Open in IMG/M
3300012951|Ga0164300_10227018All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia933Open in IMG/M
3300012984|Ga0164309_11939820Not Available505Open in IMG/M
3300012985|Ga0164308_10316929All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1245Open in IMG/M
3300014325|Ga0163163_11648059All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia702Open in IMG/M
3300016270|Ga0182036_11599078Not Available549Open in IMG/M
3300016404|Ga0182037_10417345All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1109Open in IMG/M
3300016404|Ga0182037_10999812All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia729Open in IMG/M
3300016422|Ga0182039_11155210All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia698Open in IMG/M
3300016445|Ga0182038_10235365All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1463Open in IMG/M
3300016445|Ga0182038_10567930All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia976Open in IMG/M
3300016445|Ga0182038_12040333Not Available520Open in IMG/M
3300017924|Ga0187820_1324957Not Available510Open in IMG/M
3300017937|Ga0187809_10072858All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1126Open in IMG/M
3300017942|Ga0187808_10250572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia792Open in IMG/M
3300017943|Ga0187819_10742448Not Available552Open in IMG/M
3300017970|Ga0187783_10736451Not Available712Open in IMG/M
3300017974|Ga0187777_11199887Not Available555Open in IMG/M
3300017974|Ga0187777_11335127All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia528Open in IMG/M
3300017975|Ga0187782_10078191All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria2420Open in IMG/M
3300017975|Ga0187782_10917329All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia680Open in IMG/M
3300017975|Ga0187782_11285526All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia574Open in IMG/M
3300017975|Ga0187782_11595639Not Available515Open in IMG/M
3300018001|Ga0187815_10274827Not Available713Open in IMG/M
3300018058|Ga0187766_10331612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia992Open in IMG/M
3300019789|Ga0137408_1169396All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1223Open in IMG/M
3300020580|Ga0210403_10206298All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1613Open in IMG/M
3300020580|Ga0210403_10407752All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1109Open in IMG/M
3300020580|Ga0210403_10441251All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1061Open in IMG/M
3300020583|Ga0210401_10076973All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3139Open in IMG/M
3300021171|Ga0210405_11197948Not Available563Open in IMG/M
3300021178|Ga0210408_11263821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura barringtoniae561Open in IMG/M
3300021180|Ga0210396_10431083All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1158Open in IMG/M
3300021181|Ga0210388_10230375All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1624Open in IMG/M
3300021181|Ga0210388_10552978All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1009Open in IMG/M
3300021401|Ga0210393_10857985Not Available738Open in IMG/M
3300021403|Ga0210397_10139567Not Available1683Open in IMG/M
3300021403|Ga0210397_10620305All Organisms → cellular organisms → Bacteria827Open in IMG/M
3300021404|Ga0210389_10154680All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1779Open in IMG/M
3300021405|Ga0210387_10050824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria3338Open in IMG/M
3300021405|Ga0210387_11412810Not Available598Open in IMG/M
3300021406|Ga0210386_11501413Not Available562Open in IMG/M
3300021406|Ga0210386_11520128Not Available558Open in IMG/M
3300021420|Ga0210394_11775597All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. CA-103260515Open in IMG/M
3300021432|Ga0210384_10754989All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia869Open in IMG/M
3300021474|Ga0210390_10560088All Organisms → cellular organisms → Bacteria → Terrabacteria group960Open in IMG/M
3300021475|Ga0210392_11265065Not Available552Open in IMG/M
3300025898|Ga0207692_10378991All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia878Open in IMG/M
3300025911|Ga0207654_11183744Not Available557Open in IMG/M
3300025912|Ga0207707_11171922Not Available623Open in IMG/M
3300025916|Ga0207663_10054592Not Available2502Open in IMG/M
3300025916|Ga0207663_11281299Not Available590Open in IMG/M
3300025922|Ga0207646_11538830All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia575Open in IMG/M
3300025928|Ga0207700_11813355Not Available536Open in IMG/M
3300025929|Ga0207664_11871022Not Available523Open in IMG/M
3300025941|Ga0207711_11029999Not Available763Open in IMG/M
3300025944|Ga0207661_11342584All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia657Open in IMG/M
3300026121|Ga0207683_10238052Not Available1660Open in IMG/M
3300026489|Ga0257160_1086593Not Available560Open in IMG/M
3300026557|Ga0179587_10142674All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1487Open in IMG/M
3300027107|Ga0208367_111019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia623Open in IMG/M
3300027119|Ga0209522_1012604All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia932Open in IMG/M
3300027604|Ga0208324_1133560Not Available682Open in IMG/M
3300027619|Ga0209330_1147476Not Available530Open in IMG/M
3300027725|Ga0209178_1303417Not Available588Open in IMG/M
3300027775|Ga0209177_10126049All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia843Open in IMG/M
3300027895|Ga0209624_10732572All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia651Open in IMG/M
3300028906|Ga0308309_10268643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1433Open in IMG/M
3300029943|Ga0311340_10050219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria4937Open in IMG/M
3300030494|Ga0310037_10267801All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia736Open in IMG/M
3300030524|Ga0311357_10165130All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2182Open in IMG/M
3300030580|Ga0311355_10239698All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1865Open in IMG/M
3300031090|Ga0265760_10071490All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1065Open in IMG/M
3300031128|Ga0170823_11848612Not Available565Open in IMG/M
3300031543|Ga0318516_10807941Not Available529Open in IMG/M
3300031544|Ga0318534_10199699All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1154Open in IMG/M
3300031544|Ga0318534_10860793Not Available508Open in IMG/M
3300031561|Ga0318528_10675046All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia553Open in IMG/M
3300031572|Ga0318515_10356839All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia784Open in IMG/M
3300031640|Ga0318555_10367443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia779Open in IMG/M
3300031640|Ga0318555_10723182Not Available538Open in IMG/M
3300031668|Ga0318542_10010897All Organisms → cellular organisms → Bacteria3442Open in IMG/M
3300031681|Ga0318572_10970988Not Available505Open in IMG/M
3300031713|Ga0318496_10058728Not Available2007Open in IMG/M
3300031713|Ga0318496_10366002Not Available796Open in IMG/M
3300031713|Ga0318496_10460475All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia703Open in IMG/M
3300031715|Ga0307476_10442896Not Available961Open in IMG/M
3300031723|Ga0318493_10715996Not Available561Open in IMG/M
3300031736|Ga0318501_10733734Not Available545Open in IMG/M
3300031748|Ga0318492_10092264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1479Open in IMG/M
3300031748|Ga0318492_10697471All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia544Open in IMG/M
3300031751|Ga0318494_10866038Not Available529Open in IMG/M
3300031754|Ga0307475_10319157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1248Open in IMG/M
3300031765|Ga0318554_10837213Not Available514Open in IMG/M
3300031770|Ga0318521_10934684Not Available530Open in IMG/M
3300031778|Ga0318498_10190061All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia932Open in IMG/M
3300031778|Ga0318498_10413503Not Available599Open in IMG/M
3300031778|Ga0318498_10484219Not Available546Open in IMG/M
3300031779|Ga0318566_10357387All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia720Open in IMG/M
3300031782|Ga0318552_10067743Not Available1720Open in IMG/M
3300031792|Ga0318529_10126967All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1165Open in IMG/M
3300031796|Ga0318576_10070289Not Available1555Open in IMG/M
3300031798|Ga0318523_10287469All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia821Open in IMG/M
3300031799|Ga0318565_10635398Not Available512Open in IMG/M
3300031805|Ga0318497_10319647All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia865Open in IMG/M
3300031819|Ga0318568_10414581All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia839Open in IMG/M
3300031823|Ga0307478_11208211Not Available630Open in IMG/M
3300031831|Ga0318564_10319764Not Available684Open in IMG/M
3300031831|Ga0318564_10440830Not Available568Open in IMG/M
3300031833|Ga0310917_11197663Not Available505Open in IMG/M
3300031846|Ga0318512_10313230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia781Open in IMG/M
3300031846|Ga0318512_10430878All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia664Open in IMG/M
3300031846|Ga0318512_10736171Not Available507Open in IMG/M
3300031859|Ga0318527_10072543All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1382Open in IMG/M
3300031890|Ga0306925_11534471Not Available651Open in IMG/M
3300031893|Ga0318536_10053917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1949Open in IMG/M
3300031910|Ga0306923_12477382Not Available512Open in IMG/M
3300031942|Ga0310916_10994776All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia700Open in IMG/M
3300031942|Ga0310916_11761239Not Available500Open in IMG/M
3300031946|Ga0310910_11473011Not Available523Open in IMG/M
3300031954|Ga0306926_10857859All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1090Open in IMG/M
3300031981|Ga0318531_10198398All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia904Open in IMG/M
3300032001|Ga0306922_10786029All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia996Open in IMG/M
3300032008|Ga0318562_10675868Not Available594Open in IMG/M
3300032035|Ga0310911_10833189Not Available533Open in IMG/M
3300032039|Ga0318559_10382924Not Available655Open in IMG/M
3300032041|Ga0318549_10481494Not Available558Open in IMG/M
3300032052|Ga0318506_10417005All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia595Open in IMG/M
3300032054|Ga0318570_10033184Not Available2063Open in IMG/M
3300032060|Ga0318505_10463571All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia598Open in IMG/M
3300032060|Ga0318505_10626796Not Available505Open in IMG/M
3300032064|Ga0318510_10342608Not Available629Open in IMG/M
3300032067|Ga0318524_10621842Not Available569Open in IMG/M
3300032089|Ga0318525_10019170Not Available3225Open in IMG/M
3300032089|Ga0318525_10496668Not Available624Open in IMG/M
3300032089|Ga0318525_10521967Not Available607Open in IMG/M
3300032090|Ga0318518_10460001All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia652Open in IMG/M
3300032160|Ga0311301_10060017All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria8340Open in IMG/M
3300032160|Ga0311301_10664181Not Available1478Open in IMG/M
3300032261|Ga0306920_102743889Not Available672Open in IMG/M
3300032261|Ga0306920_103173120Not Available616Open in IMG/M
3300032261|Ga0306920_104102219Not Available527Open in IMG/M
3300032770|Ga0335085_10875468Not Available981Open in IMG/M
3300032828|Ga0335080_10415209All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia1442Open in IMG/M
3300032892|Ga0335081_10875916All Organisms → cellular organisms → Bacteria1062Open in IMG/M
3300032892|Ga0335081_11522562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia739Open in IMG/M
3300032895|Ga0335074_10515575All Organisms → cellular organisms → Bacteria → Terrabacteria group1233Open in IMG/M
3300032954|Ga0335083_10932179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia688Open in IMG/M
3300032955|Ga0335076_10100158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia2826Open in IMG/M
3300033004|Ga0335084_10084965All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3282Open in IMG/M
3300033134|Ga0335073_11923304Not Available545Open in IMG/M
3300033158|Ga0335077_10045675All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia5358Open in IMG/M
3300033289|Ga0310914_10701291Not Available908Open in IMG/M
3300033289|Ga0310914_11272409Not Available638Open in IMG/M
3300033290|Ga0318519_10985956Not Available523Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil39.90%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.90%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.90%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil4.93%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.94%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere3.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil2.96%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment2.46%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil2.46%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.46%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.97%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.97%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.97%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.97%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.48%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.48%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.49%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.49%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil0.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.49%
Switchgrass RhizosphereHost-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere0.49%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.49%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.49%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.49%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000364Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001454Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 shallow-092012EnvironmentalOpen in IMG/M
3300003505Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924)EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005587Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_103EnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300006914Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5Host-AssociatedOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009520Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010046Tropical forest soil microbial communities from Panama - MetaG Plot_36EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010867Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012207Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaGEnvironmentalOpen in IMG/M
3300012285Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012357Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaGEnvironmentalOpen in IMG/M
3300012948Tropical forest soil microbial communities from Panama - MetaG Plot_14EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014325Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016404Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017924Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5EnvironmentalOpen in IMG/M
3300017937Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4EnvironmentalOpen in IMG/M
3300017942Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3EnvironmentalOpen in IMG/M
3300017943Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4EnvironmentalOpen in IMG/M
3300017970Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017974Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020580Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-MEnvironmentalOpen in IMG/M
3300020583Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-MEnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021180Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-OEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021401Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-OEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021404Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-OEnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025941Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027107Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF029 (SPAdes)EnvironmentalOpen in IMG/M
3300027119Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027604Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027619Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030494Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG (v2)EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030580II_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300031090Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031128Oak Summer Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031543Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031640Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23EnvironmentalOpen in IMG/M
3300031668Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23EnvironmentalOpen in IMG/M
3300031681Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031715Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_05EnvironmentalOpen in IMG/M
3300031723Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031754Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515EnvironmentalOpen in IMG/M
3300031765Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f22EnvironmentalOpen in IMG/M
3300031770Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f17EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031779Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f22EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031796Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f24EnvironmentalOpen in IMG/M
3300031798Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19EnvironmentalOpen in IMG/M
3300031799Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f21EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031819Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f21EnvironmentalOpen in IMG/M
3300031823Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031910Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2)EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032008Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032052Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f19EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032060Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f18EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032067Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032828Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032895Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.3EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300032955Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.5EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033134Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.2EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033289Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN108EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
INPhiseqgaiiFebDRAFT_10462048013300000364SoilVQAQTYEITFLGQAGSTLRAEFDDCEITIGPGITTLR
JGI20204J15135_103108523300001454Arctic Peat SoilAYEITFIGQAGTTLRAEFDDCEVTIGPDTTTLRGLTP*
JGIcombinedJ51221_1032986313300003505Forest SoilVQAQTYEITFLGRAGTTLRAEFDDCEVTIGPGTTTLRAEVPDRGALS
Ga0070683_10034684013300005329Corn RhizosphereVQTQTYEITFLGQAGTTLRAEFDDCEITIGPGTTTLRAELP
Ga0066388_10510665813300005332Tropical Forest SoilVRSQTYEITFLGQAGSTLSAEFDDCEITVGPGTTTLRADLPDQGALSGLM
Ga0066388_10536237823300005332Tropical Forest SoilVSQQTVRRNPVRAQTYEITFTGEAGTALRAEFEDCEITIGPG
Ga0008090_1559852823300005363Tropical Rainforest SoilVRSQMYEITFLGQAGQTLRAEFDDCEVTIGPGTTTLRAEL
Ga0070713_10003454733300005436Corn, Switchgrass And Miscanthus RhizosphereVRSQTYEITFTGQAGATLRAEFDDCDITVGRGMTTLRAELPD
Ga0070713_10160386813300005436Corn, Switchgrass And Miscanthus RhizosphereVQSQTYEITFLGQAGSTLSAEFDDCEIIIGPGTTTLRADLP
Ga0070711_10083437213300005439Corn, Switchgrass And Miscanthus RhizosphereVRSQTYEITFLGQAGTTLRAEFDDCEVIIGPGTTTLRTELPDRGA
Ga0070684_10211344113300005535Corn RhizosphereMLVRPHTYEVTFAGQAGAALCAEFDDFTVTVGPDTTTLRAE
Ga0066654_1067649023300005587SoilMRARTYEITFVGQAGTVVRAEFDDCEVTVGPDTTTLRAELADQ
Ga0070763_1048886013300005610SoilVAGPQTYEITFTGQAGSTLCAEFDDCEVTMGRGTTVLRAELPDQG
Ga0068856_10013739213300005614Corn RhizosphereVQTQTYEITFLGQAGTTLRAEFDDCEITIGPGTTTLRAELPDRGALTG
Ga0068856_10064860813300005614Corn RhizosphereVQPQTYEITFLGQAGTTLRAEFEDCEVIIGRGTTTLRTELP
Ga0070764_1105332023300005712SoilVRSQTYEITFLGQAGATVRAEFYDCEVTIGPGTTTLRAELLDRGALA
Ga0066905_10190497213300005713Tropical Forest SoilVRSQTYEITFLGQAGSTLSAEFDDCEVTIGPGTTTLRADLPDQGALSG
Ga0066903_10282019213300005764Tropical Forest SoilVRSQKYEITFLGQAGETLRAEFDDCEVTIGPGTTTLR
Ga0066903_10512930513300005764Tropical Forest SoilVRSQTMYEITFLGQAGETLRAEFDDGEVSIGPGTTT
Ga0075029_10121993823300006052WatershedsVRSQTYEITFAGQAGSTLRTEFDDCEVIAGPGTTT
Ga0070765_10078530313300006176SoilVQGQTYEITFLGQAGTTLRAEFDDCELTIGPGTTTLRAE
Ga0075021_1113565113300006354WatershedsVRSQTYEITFLGQAGSTLSAAFDDCEVTVGPGTTTLRAD
Ga0079221_1172827923300006804Agricultural SoilVRSQTYEITFLGQAGETLRAEFDDCEVTIGPGTTTLRAELLDR
Ga0079220_1080611323300006806Agricultural SoilVRSHTYEITFTGEAGSTLRAEFDDCEVTVGPGTTTLRAELPDQ
Ga0075436_10090004933300006914Populus RhizosphereVQTQTYELTFLGQAGSTLRAEFDDCEITIGPGTTTLRAELPDRG
Ga0066709_10242554013300009137Grasslands SoilVQTQTYEITFLGQAGSTLRAEFDDCEITIGPGTTTLRAELPDR
Ga0116214_142329123300009520Peatlands SoilMRCQTYEITFVGQAGTTLCAEFDDCAITIGPGTTTLRAQL
Ga0105237_1104899513300009545Corn RhizosphereVQPQIYEITFLGEAGTTLRAEFEDCEVIIGRGTTTLRTELPDRGAL
Ga0116216_1077193823300009698Peatlands SoilVGSRTYEITFAGQAGSTLRAEFDDCEVIVGSATTTLRAEVP
Ga0126380_1067630023300010043Tropical Forest SoilVRPQTYEITFTGQAGNALRAEFDDCEVTVGPGTTTLRAELPD
Ga0126380_1092885023300010043Tropical Forest SoilVRSQTYEITFLGQAGETLRSEFDDCEVTIGPGTTTLRTELPDRGALSGLIE
Ga0126384_1137136723300010046Tropical Forest SoilVTPVRPQIYEITFTGQAGTALRAEFDDCEVTVGPGTT
Ga0126376_1292985613300010359Tropical Forest SoilVRSQTYEITFLGQAGSTLSAEFDDCEIKLGPGTTTLRADLVDQGALSG
Ga0126372_1046338223300010360Tropical Forest SoilVRSQTYEITFTGEAGSALRAEFDDCEVTVGPGTTTLRA
Ga0126372_1154846623300010360Tropical Forest SoilVQTQTYEITFLGQAGTTLQAEFDDCEITIGPGTTTLRAELPDRGA
Ga0126378_1128169313300010361Tropical Forest SoilVRSQTYEITFLGQAGDTLRAEFEDWEITIGPGTTTLRTELPDRGA
Ga0126377_1321090233300010362Tropical Forest SoilVQTQTYEITFLGQAGTTLRAEFEDCEVTIGRGTTTLRT
Ga0126379_1348589313300010366Tropical Forest SoilVRSQTYEITFLGQAGSTLSAEFDDCEITVGPGTTTLRADLPDQG
Ga0134125_1061713013300010371Terrestrial SoilVLRSQTYEITFTGQAGRVLRAEFDDCEVTQGPGTTTLRA
Ga0126381_10346467723300010376Tropical Forest SoilVHTRTYEITFLGQAGTTLRAEFDDCEVSVGPDTTTLRAELPDQ
Ga0126383_1147986613300010398Tropical Forest SoilVIPVRPQIYEITFTGQAGTALRAEFEDCEVTVGPGTT
Ga0126383_1182211923300010398Tropical Forest SoilVRSQTYEITFLGQAGSTLSAEFDDCEITIGPGTTTLRADLPDQG
Ga0126383_1336380013300010398Tropical Forest SoilVQSQTYEITFLGQAGSTLSAEFDDCEIIIGPGTTTLRA
Ga0126347_111408723300010867Boreal Forest SoilVRSQTYEITFTGQAGSTLREEFDDCEVTIGRGITTLRARLPD
Ga0137381_1052528533300012207Vadose Zone SoilVRSQTYEITFLGQAGTTLCAEFDDCEVTIGPGTTTL
Ga0137370_1049215813300012285Vadose Zone SoilVRPQIYEITFTGQAGTALRAEFDDCEVTVGPGTTTL
Ga0137370_1102765213300012285Vadose Zone SoilVTPVQSQIYEITFTGQAGTALRAEFDDCEVTVGPGTTTL
Ga0137384_1042743413300012357Vadose Zone SoilVRSQTFEITFLGQAGTTLCAEFDDCEVTIGPGTTTL
Ga0126375_1167470513300012948Tropical Forest SoilVQSQTYEITFLGQAGATLRAEFDDCEVRIGPGTTTL
Ga0164300_1022701813300012951SoilVVLAQTYEITFTGRAGTTLRAEFDDCQVTVGPDTTTLRAD
Ga0164309_1193982023300012984SoilVRSHTYEITFTGEAGSALRTEFDDCAVTVGPGTTTLRAELPD
Ga0164308_1031692923300012985SoilVQSKTYEITFLGQAGTTLSAEFDDCEVTIGPGTTTLRAELPDRGALSG
Ga0163163_1164805923300014325Switchgrass RhizosphereVQPQTYEITFLGEAVTTLRAEFEDCEVIIGRGTTTLRTELPD
Ga0182036_1159907823300016270SoilVRSQTYEITFTGQAGATLRAEFDDCDVTVGRGRTTLRAELPDE
Ga0182037_1041734523300016404SoilVRSQTYEITFLGQAGDTLRAEFEDCEVTIGPGTTTLRTELPDR
Ga0182037_1099981213300016404SoilVRPQTYEITFAGQADTTLRSEFDDCEITLGPGTTTL
Ga0182039_1115521013300016422SoilVQPQTYEITFLGQAGTTLRAEFDDCEVTIGPGTTTLRAELPDRGALTG
Ga0182038_1023536513300016445SoilVQSQTYEITFLGQAGSTLSAEFDDCEIIIGPGTTTLRAD
Ga0182038_1056793013300016445SoilVRSQTYEITFTGQAGATLRAEFDDCDITVGRGMTT
Ga0182038_1204033313300016445SoilVRSQTYEITFLGQAGSTLTAEFDDCEITIGPGTTTLR
Ga0187820_132495713300017924Freshwater SedimentMTEKTGGDSPVHARMYEITFLGQAGTTLRAEFDDCEVTVVPDRTTLRAELP
Ga0187809_1007285823300017937Freshwater SedimentVRAQTYEITFLGQASTTLRAEFDDCEVTIGPGTTTLRAELPDRGA
Ga0187808_1025057213300017942Freshwater SedimentMMQPWTYEIIFAGQADAGVCAEFDDCAVIIGPGTTTLHAHVPDQG
Ga0187819_1074244813300017943Freshwater SedimentVVPSQTYEITFTGQAGTTLRAEFDDCEVTIGPGTTTLR
Ga0187783_1073645113300017970Tropical PeatlandVRTQTHEITFLGRASTTLRAEFDDCEITIGPGTTTLRAELPDR
Ga0187777_1119988713300017974Tropical PeatlandVRSQEYEITFTGEAGTALREEFDDCEVTVGAGTTT
Ga0187777_1133512713300017974Tropical PeatlandLVRSQTYEITFTGQAGATLRSEFDDCEVSIGPGTTTLRAE
Ga0187782_1007819113300017975Tropical PeatlandVRPQTYEITFLGQAGTTLRAEFDDCEVTIGPGTTTLRAELPDR
Ga0187782_1091732923300017975Tropical PeatlandVRSQTYEITFLGQAGTTLRAEFDDCEVSVGPGTTT
Ga0187782_1128552623300017975Tropical PeatlandVVRSQTYEITFTGQITPGLRAEFDDCEVIVGADTTTLH
Ga0187782_1159563923300017975Tropical PeatlandVPPQTYEITFVGEAGTTLRAEFDDCEVAVGPGTTTLRAEL
Ga0187815_1027482713300018001Freshwater SedimentVQAQKYEITFLGQAGTTLRAEFEDCEVTIGPGTTTLRAELPD
Ga0187766_1033161223300018058Tropical PeatlandVQSQTYEITFIGQAGNTLRAEFDDCVVTIGRGTTTLRADLPDPEAL
Ga0137408_116939613300019789Vadose Zone SoilVRAQTYEITFLGQANSALRAEFEDCEVTVGHGTTTLRADFPD
Ga0210403_1020629823300020580SoilVLSQTYEITFLGQAGSALTAEFDDCEITIGPGTTTLRTDLP
Ga0210403_1040775223300020580SoilVVPAQTYEITFIGRAGTTLRAEFDDCQVTVGPDTTTLRA
Ga0210403_1044125113300020580SoilVHARTYEITFLGQAGTTLRAEFDDCEVTVGPDRTTLRA
Ga0210401_1007697323300020583SoilVQSQTYEITFLGQAGTTLRAEFDDCEVTIGPGTTTLRTELPD
Ga0210405_1119794813300021171SoilVRPHTYEITFTGEAGTAVRAEFDDCEVNVGSGTTTLRAELPD
Ga0210408_1126382123300021178SoilMRSCTYEVTFLGQAGRTLRAEFDDCEVTIGPGTTTLRAELP
Ga0210396_1043108323300021180SoilMRSQTYEITFTGEAGTALRAEFDDCDVAVGLGTTTLRAE
Ga0210388_1023037513300021181SoilVEAQTYEITFLGQAGTTLRAEFEDCEVTIGPGTTTL
Ga0210388_1055297813300021181SoilVQSQTYEITFLGQAGTTLRAEFEDCQLTIGPGTTTLRTELPDR
Ga0210393_1085798513300021401SoilVQSQTYEITFLGQAGSTLSAEFDDCEITVGPGTTTLRADL
Ga0210397_1013956723300021403SoilMRSQTYEITFAGQAGGTLCAEFDDCAITVGSDTTTLRAQLPD
Ga0210397_1062030513300021403SoilVQPQTYEITFIGQADTVLRAEFDDCEVTVGRGMTTL
Ga0210389_1015468023300021404SoilVQTQIFEITFLGEAGATLSAEFDDCQVTLGPGTTTLRAAL
Ga0210387_1005082413300021405SoilVQPRPYEITFAGKAGKLLRAEFDDCEISVGSCTTTLRAGLIDQSALQ
Ga0210387_1141281013300021405SoilVEAQTYEITFLGQAGTTLRAEFEDCEVTIGPGTTTLR
Ga0210386_1150141313300021406SoilVDAQTYEITFLGQAGTTLRAEFEDCEVTIGPGTTTLRTELP
Ga0210386_1152012823300021406SoilVQSQTYEITFLGQAGSTLSAEFDDCEITVGPGTTTLRADLPDQGALSGLIE
Ga0210394_1177559713300021420SoilMRSQTYEITFTGEAGTALRAEFDDCDVAVGLGTTTLRA
Ga0210384_1075498923300021432SoilVQSQTYEITFLGQAGTTLRAEFDDCEVTIGPGTTTLR
Ga0210390_1056008813300021474SoilVRPQTYEITFTGQASSTLCAEFDDCEVTIGRGTTILRAEL
Ga0210392_1126506523300021475SoilVQSQTYEITFTGEAGGTLRAEFDDCAITIGPGTTTLRAQL
Ga0207692_1037899123300025898Corn, Switchgrass And Miscanthus RhizosphereVQAQTYEITFLGQAGTTLRAEFDDCEITIGPGTTT
Ga0207654_1118374423300025911Corn RhizosphereVQSKTYEITFLGQAGTTLSAEFDDCEVTIGPGTTTLRAE
Ga0207707_1117192223300025912Corn RhizosphereVQPQTYEITFLGEAGTTLRAEFEDCEVIIGRGTTTLRTEL
Ga0207663_1005459213300025916Corn, Switchgrass And Miscanthus RhizosphereVHARTYEITFLGQAGTTLRAEFDDCEVSVGPDRTTLRAELPD
Ga0207663_1128129913300025916Corn, Switchgrass And Miscanthus RhizosphereVQAQTYEITFLGQAGTTLRAEFDDCEVTIGPGTTTLR
Ga0207646_1153883013300025922Corn, Switchgrass And Miscanthus RhizosphereVRFQTYEITFTGQPDVTLQAEFDDCAITMGPDATTL
Ga0207700_1181335513300025928Corn, Switchgrass And Miscanthus RhizosphereVQSKTYEITFLGQAGTTLSAEFDDCEVTIGPGTTTLRAELPDRGAL
Ga0207664_1187102213300025929Agricultural SoilVRAQTYEITFLGQAGSTLSAEFDDCEITVGPGTTTLRADLPDQG
Ga0207711_1102999923300025941Switchgrass RhizosphereVQPQTYEITFLGQAGTTLRAEFEDCEVIIGRGTTTLRTELPDRGAL
Ga0207661_1134258423300025944Corn RhizosphereVRSQTYEITFLGQAGTTLRAEFDDCEVIIGPGTTTLRTELPDRG
Ga0207683_1023805213300026121Miscanthus RhizosphereVQAQTYEITFLGQAGTTLRAEFDDCEITIGPGTTTLR
Ga0257160_108659313300026489SoilVRFQTYEITFTGQPDVTLHAEFDDSAITIGPDVTTLRALLPDQD
Ga0179587_1014267423300026557Vadose Zone SoilMGSQTYEITFTGEAGTALCAEFDDCDVAVGQGTTTLR
Ga0208367_11101923300027107Forest SoilVQSQTYEITFLGQAGTTLRAEFEDCQLTIGPGTTTLRTEL
Ga0209522_101260413300027119Forest SoilVRSQTYEVTFLGQAGETLRAEFDDCEITIGPGTTTLRAELPDR
Ga0208324_113356013300027604Peatlands SoilVRAQMYEITFLGQAGTTLRAEFEDCEVTIGPGITTLRAELPDRGA
Ga0209330_114747613300027619Forest SoilVQSQTFEITFLGQAGTTLRAEFEDCEVTIGPGITTLRTEL
Ga0209178_130341723300027725Agricultural SoilVQTQTYEITFLGQAGTTLRAEFDDCEITIGPGTTT
Ga0209177_1012604913300027775Agricultural SoilVQPQIYEITFLGEAGTTLRAEFEDCEVIIGRGTTTLRTEL
Ga0209624_1073257213300027895Forest SoilVLSRTYEITFTGQAGPAVGAEFDDCEVIRGAGATTLRAELP
Ga0308309_1026864313300028906SoilVQSQTYEITFLGQAGTTLRAEFDDCEVTIGPGTTTLRAEL
Ga0311340_1005021943300029943PalsaVLLQTYEITFTGQAGSTLRAEFDDCEVTVGPGITTLRAELP
Ga0310037_1026780123300030494Peatlands SoilVQSQTYEITFTGQAGPVLRAEFDDCEVTIGPGTTTLR
Ga0311357_1016513013300030524PalsaVLLQTYEITFTGQAGSTLRAEFDDCEVTVGPGITTL
Ga0311355_1023969813300030580PalsaVLLQTYEITFTGQAGSTLRAEFDDCEVTVGPGITT
Ga0265760_1007149013300031090SoilVQAQTYEITFLGQAGTTLRTEFEDCEVTIGPGTTTLRAELPD
Ga0170823_1184861213300031128Forest SoilVLSQTYEITFLGQAGSTLTAEFDDCEITIGPGTTTLRTNLSDQALP
Ga0318516_1080794113300031543SoilVQSQTYEITFLGQASSTLSAEFDDCEIIIGPGTTTLRADLPD
Ga0318534_1019969923300031544SoilVRPQIYEITFTGQAGTALRAEFEDCEVSVGPGTTT
Ga0318534_1086079313300031544SoilVRSQTYEITFLGQAGSTLRAEFEDCEVTIGPGTTT
Ga0318528_1067504613300031561SoilVPTQTYEITFAGRAGTTLRAEFDDCQVTVGPSTTTLRAA
Ga0318515_1035683913300031572SoilVRSHMYEITFLGQAGETLRAEFDDCEVSIGPGTTTLRTELPDRG
Ga0318555_1036744313300031640SoilVQSQTYEITFLGQASSTLSAEFDDCEIIIGPGTTTLRADL
Ga0318555_1072318213300031640SoilVGSQTYEITFANQAGAVLRAEFDDCEITIGPATTTLRADLPDPAAF
Ga0318542_1001089713300031668SoilVPTQTYEITFAGQAGTTLRAEFDDCQVTVGPSTTTLRADLP
Ga0318572_1097098823300031681SoilVRSQIYEITFTGQAGSALRAEFDDCEVMLGPGTTTLRAE
Ga0318496_1005872813300031713SoilVVPAQTYEITFTGRVGPTLRAEFDDCQVTVGPGTTTLR
Ga0318496_1036600223300031713SoilVQSQTYEITFLGQASSTLSAEFDDCEIIIGPGTTTLRAD
Ga0318496_1046047523300031713SoilVRSQTYEITFAGQADTTLRSEFDDCEVTVGPGTTTLRAE
Ga0307476_1044289623300031715Hardwood Forest SoilVQTQTYEITFLGRAGTTLRSEFDDCEVTIGPGTTTLRAEVPDRGALSGLME
Ga0318493_1071599613300031723SoilVRSQTYEITFTGEAGSTLRAEFDDCEVTVGPGTTT
Ga0318501_1073373413300031736SoilVRSQTYEITFLGQAGSTLSAEFDDCEITIGPGTTT
Ga0318492_1009226423300031748SoilVRSQTYEITFLGQAGATLRAEFDDCEVTIGPGTTTLRADL
Ga0318492_1069747113300031748SoilVRPQTYEITFAGQADTTLRSEFDDCEVTVGPGTTTLRAD
Ga0318494_1086603813300031751SoilVRSQLYEITFLGQAGETLRAEFDDCEVTIGPGTTTLRTELPDRGALSG
Ga0307475_1031915713300031754Hardwood Forest SoilVQAQTYEITFLGQAGTTLRTEFDDCEVTIGPGTTT
Ga0318554_1083721313300031765SoilVRSQTYEITFLGQAGETLQAEFDDCEVSIGPGTTTLRTELPDRGA
Ga0318521_1093468423300031770SoilVVNPVRAQTYEITFLGQASTTLRAEFDDCEVTIGP
Ga0318498_1019006123300031778SoilVPTQTYEITFAGRAGTTLRAEFDDCQVTVGPSTTTLRA
Ga0318498_1041350313300031778SoilVVNPVRAQTYEITFLGQASTTLRAEFDDCEVTIGPGTTTLRADLPDRGALT
Ga0318498_1048421913300031778SoilVQSQTYEITFLGQASSTLSAEFDDCEIIIGPGTTTLRADLPDQGALTG
Ga0318566_1035738713300031779SoilVVNPVRAQTYEITFLGQASTTLRAEFDDCEVTIGPGTTTL
Ga0318552_1006774313300031782SoilVRPQIYEITFTGQAGTALRAEFEDCEVSVGPGTTTLRAELP
Ga0318529_1012696713300031792SoilMAREVVNPVRAQTYEITFLGQASTTLRAEFDDCEVTIGPGTTTLRADLPDRG
Ga0318576_1007028913300031796SoilVPAQTYEITFTGRAGRTLRAEFDDCQVTVGPDTTTLRA
Ga0318523_1028746923300031798SoilVQSQTYEITFLGQAGSTLSAEFDDCEVIIGPGTTTLRAD
Ga0318565_1063539813300031799SoilVQSQTYEITFLGQASSTLSAEFDDCEIIIGPGTTTLRADLPDQG
Ga0318497_1031964723300031805SoilVQPQTYEITFLGQAGTTLRAEFDDCEVTIGPGTTTLRAELPDRGALTGLM
Ga0318568_1041458123300031819SoilVRSQIYEITFTGQAGSALRAEFDDCEVMLGPGTTT
Ga0307478_1120821123300031823Hardwood Forest SoilVQAQTYEITFLGRASTTLRAEFDDCEVTIGPGTTTLRTEV
Ga0318564_1031976423300031831SoilMAREVVNPVRAQTYEITFLGQASTTLRAEFDDCEVTIGPGTTT
Ga0318564_1044083013300031831SoilVRSQTYEITFTGQAGATLRAEFDDCDITVGRGMTTLRAELPDE
Ga0310917_1119766323300031833SoilVRSQTYEITFTGQAGATLRAEFDDCDVTVGRGRTTL
Ga0318512_1031323013300031846SoilVRSQLYEITFLGQAGETLRAEFDDCEVTIGPGTTTLRTELPDRGAL
Ga0318512_1043087823300031846SoilVPTQTYEITFAGQAGTTLRAEFDDCQVTVGPSTTTLRADLPDQAA
Ga0318512_1073617113300031846SoilVRSQKYEITFLGQAGETLRAEFDDCEVTIGPGTTTLRAELPDRGAL
Ga0318527_1007254323300031859SoilVPTQTYEITFAGRAGTTLRAEFDDCQVTVGPSTTTL
Ga0306925_1153447123300031890SoilMQPQTYEITFTGQAGATVRAEFDDCTVTIGKGTTTLRAELADQG
Ga0318536_1005391723300031893SoilVPTQTYEITFAGRAGTTLRAEFDDCQVTVGPSTTTLRTD
Ga0306923_1247738223300031910SoilVRSQTYEITFTGEAGATVRAAFDDCQVTTGAGITTLHAELPDQAA
Ga0310916_1099477613300031942SoilVRSQTYEITFLGQAGTTLRAEFDDCEVTIGPGTTTLRAELPD
Ga0310916_1176123923300031942SoilMYEVTFLGQAGETLRAEFDDCEVSIGPGTTTLRTELPD
Ga0310910_1147301113300031946SoilMQPQTYEITFAGQAGAEVCAEFDDCAVTVGLGTTTLRVKLPD
Ga0306926_1085785923300031954SoilVRSPTMYEITFLGQAGETLRAEFDDCEVTIGPGTTTLRAELPDRGAL
Ga0318531_1019839823300031981SoilVQSQTYEITFLGQASSTLSAEFDDCEIIIGPGTTTLRADLPDQGA
Ga0306922_1078602923300032001SoilVRSQIYEITFTGQAGSALQAEFDDCEVTLGPGTTTLRAEV
Ga0318562_1067586813300032008SoilMAREVVNPVRAQTYEITFLGQASTTLRAEFDDCEVTIGPGT
Ga0310911_1083318923300032035SoilMRSHTYEITFMGQAGEALRAEFDDCEVSIGPGTTTLRADL
Ga0318559_1038292423300032039SoilVQSQTYEITFLGQASSTLSAEFDDCEIIIGPGTTTLRADLPDQGALTGLMERIT
Ga0318549_1048149413300032041SoilVRSQTYEITFLGQAGSTLSAEFDDCEITVGPGTTTLRADLPDQGAL
Ga0318506_1041700523300032052SoilVPAQTYEITFTGRAGRTLRAEFDECQVTVGPDTTTLRA
Ga0318570_1003318413300032054SoilVRSQTYEITFAGEAGSALRAEFDDCEVTVGSGTTTLR
Ga0318505_1046357123300032060SoilVPAQTYEITFTGRAGRTLRAEFDDCQVTVGPDTTTLR
Ga0318505_1062679613300032060SoilVVNPVRAQTYEITFLGQASTTLRAEFDDCEVTIGPGTTTLRADLPDRG
Ga0318510_1034260823300032064SoilMRGVAPVRSQTYEITFAGRAGSVLRAEFDDCEVTMGFDTTT
Ga0318524_1062184223300032067SoilVRSQVYEITFLGQAGRTLSAVFDDCEITIGPGTTTLR
Ga0318525_1001917023300032089SoilVQSQTYEITFLGQAGSTLSAEFDDCEVIIGPGTTTLRVDLPDQ
Ga0318525_1049666813300032089SoilVRSQTYEITFLGQAGSTLSAEFDDCEITVGPGTTT
Ga0318525_1052196723300032089SoilVRSQTYEITFTGEAGSTLRAEFDDCEVTVGPGTTTLRAE
Ga0318518_1046000123300032090SoilVPAQTYEITFTGRAGRTLRAEFDDCQVTVGPDTTSLRADLPDQV
Ga0311301_1006001743300032160Peatlands SoilMRSQTHEITFIGKAGVTLCAEFADCAITMGPGTTALRAQLPD
Ga0311301_1066418113300032160Peatlands SoilMRCQTYEITFVGQAGTTLCAEFDDCAITIGPGTTTLRAQLP
Ga0306920_10274388913300032261SoilVRSQTYEITFLGQAGSTLSAEFDDCEITVGPGTTTL
Ga0306920_10317312023300032261SoilVNPVRSQTYEITFLGQAGRTLSAVFDDCEVTIGPGTTTLRAS
Ga0306920_10410221913300032261SoilVRSQTYEITFLGQAGSTLRAEFEDCEVTIGPGTTTLRAELP
Ga0335085_1087546823300032770SoilVQAQTYEITFLGQAGTVLRTEFDDCEVTIGPGTTTLRAE
Ga0335080_1041520913300032828SoilVRSQIYEITFTGQAGSALRAEFDDCEVTLGPGTTTLRAQVP
Ga0335081_1087591613300032892SoilMFEITFAGQAGPVLRAEFDDCEVTVGPATTTLRAELPDP
Ga0335081_1152256223300032892SoilMRSQTYEITFRGEAGATLRAEFDDCEVTIGPGTTILRAEL
Ga0335074_1051557513300032895SoilMRAQTYEITFLGQAGATLRAEFDDCEVMLGPGTTTLRAELP
Ga0335083_1093217923300032954SoilMRSQTYEITFSGQAGTTLRAEFDDCEVTIGPGTTILRAEVPDQA
Ga0335076_1010015843300032955SoilMQSQTYEITFAGQAGATVRAEFDDCAVTIGRGTTTLRAELPDQGA
Ga0335084_1008496513300033004SoilMRSQTYEITFTGQAGPTLRAEFDDCQVTTGPGTTTLRAELP
Ga0335073_1192330413300033134SoilVRAQKYEITFLGRASSTLCAEFDDCEITIGPGTTTLRTELPDQG
Ga0335077_1004567513300033158SoilVRSQTYEITFLGQAGETLRAEFDDCEVTIGPGTTTLRAELPDRGALSGL
Ga0310914_1070129113300033289SoilVRSQTYEITFLGQAGSTLSAEFDDCEITIGPGTTTLRADLPDQGALTGLME
Ga0310914_1127240923300033289SoilVRSQTYEITFLGQAGTTLRAEFDDCEVTVGPGTTTLRAEL
Ga0318519_1098595613300033290SoilVRTQTYEITFLGQASTTLRAEFDDCEVTIGPGTTTLRAELP


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.