| Basic Information | |
|---|---|
| Family ID | F025065 |
| Family Type | Metagenome |
| Number of Sequences | 203 |
| Average Sequence Length | 54 residues |
| Representative Sequence | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGVE |
| Number of Associated Samples | 97 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 74.26 % |
| % of genes near scaffold ends (potentially truncated) | 41.87 % |
| % of genes from short scaffolds (< 2000 bps) | 81.77 % |
| Associated GOLD sequencing projects | 78 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (66.502 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere (13.301 % of family members) |
| Environment Ontology (ENVO) | Unclassified (63.054 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (87.192 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 72.73% β-sheet: 0.00% Coil/Unstructured: 27.27% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 203 Family Scaffolds |
|---|---|---|
| PF04404 | ERF | 13.79 |
| PF01381 | HTH_3 | 3.45 |
| PF09588 | YqaJ | 3.45 |
| PF13392 | HNH_3 | 2.96 |
| PF02831 | gpW | 1.97 |
| PF11300 | DUF3102 | 1.97 |
| PF05772 | NinB | 1.97 |
| PF01844 | HNH | 0.99 |
| PF12844 | HTH_19 | 0.99 |
| PF01520 | Amidase_3 | 0.99 |
| PF14549 | P22_Cro | 0.49 |
| PF05565 | Sipho_Gp157 | 0.49 |
| PF07120 | DUF1376 | 0.49 |
| PF00145 | DNA_methylase | 0.49 |
| PF07589 | PEP-CTERM | 0.49 |
| PF13560 | HTH_31 | 0.49 |
| PF02178 | AT_hook | 0.49 |
| PF03807 | F420_oxidored | 0.49 |
| PF13419 | HAD_2 | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
|---|---|---|---|
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| COG0270 | DNA-cytosine methylase | Replication, recombination and repair [L] | 0.49 |
| COG3756 | Uncharacterized conserved protein YdaU, DUF1376 family | Function unknown [S] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 66.50 % |
| All Organisms | root | All Organisms | 33.50 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002459|JGI24751J29686_10107472 | Not Available | 584 | Open in IMG/M |
| 3300004114|Ga0062593_100034081 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2949 | Open in IMG/M |
| 3300004156|Ga0062589_101710196 | Not Available | 628 | Open in IMG/M |
| 3300004643|Ga0062591_100064829 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2174 | Open in IMG/M |
| 3300004643|Ga0062591_100968956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 805 | Open in IMG/M |
| 3300004643|Ga0062591_102676891 | Not Available | 527 | Open in IMG/M |
| 3300005093|Ga0062594_100200771 | Not Available | 1390 | Open in IMG/M |
| 3300005093|Ga0062594_103301908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 507 | Open in IMG/M |
| 3300005288|Ga0065714_10047013 | Not Available | 624 | Open in IMG/M |
| 3300005288|Ga0065714_10065286 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 11155 | Open in IMG/M |
| 3300005288|Ga0065714_10114697 | Not Available | 1425 | Open in IMG/M |
| 3300005288|Ga0065714_10139680 | Not Available | 1182 | Open in IMG/M |
| 3300005288|Ga0065714_10367170 | Not Available | 619 | Open in IMG/M |
| 3300005288|Ga0065714_10524902 | Not Available | 511 | Open in IMG/M |
| 3300005290|Ga0065712_10015486 | Not Available | 1749 | Open in IMG/M |
| 3300005290|Ga0065712_10045948 | Not Available | 875 | Open in IMG/M |
| 3300005290|Ga0065712_10069580 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 7025 | Open in IMG/M |
| 3300005290|Ga0065712_10071329 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5336 | Open in IMG/M |
| 3300005290|Ga0065712_10225532 | Not Available | 1027 | Open in IMG/M |
| 3300005290|Ga0065712_10277927 | Not Available | 893 | Open in IMG/M |
| 3300005290|Ga0065712_10458476 | All Organisms → cellular organisms → Bacteria | 680 | Open in IMG/M |
| 3300005293|Ga0065715_10536458 | Not Available | 751 | Open in IMG/M |
| 3300005328|Ga0070676_11582886 | Not Available | 506 | Open in IMG/M |
| 3300005330|Ga0070690_100520408 | Not Available | 893 | Open in IMG/M |
| 3300005330|Ga0070690_101168277 | Not Available | 613 | Open in IMG/M |
| 3300005331|Ga0070670_100010986 | All Organisms → cellular organisms → Bacteria | 7734 | Open in IMG/M |
| 3300005331|Ga0070670_100042038 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 3928 | Open in IMG/M |
| 3300005331|Ga0070670_100177546 | Not Available | 1848 | Open in IMG/M |
| 3300005331|Ga0070670_100308035 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1386 | Open in IMG/M |
| 3300005331|Ga0070670_100560358 | Not Available | 1020 | Open in IMG/M |
| 3300005331|Ga0070670_100797894 | Not Available | 853 | Open in IMG/M |
| 3300005331|Ga0070670_102263228 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 501 | Open in IMG/M |
| 3300005340|Ga0070689_102041555 | Not Available | 525 | Open in IMG/M |
| 3300005343|Ga0070687_100178571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1270 | Open in IMG/M |
| 3300005353|Ga0070669_100076291 | All Organisms → cellular organisms → Bacteria | 2488 | Open in IMG/M |
| 3300005353|Ga0070669_101886517 | Not Available | 522 | Open in IMG/M |
| 3300005354|Ga0070675_100016473 | Not Available | 5869 | Open in IMG/M |
| 3300005354|Ga0070675_100043108 | All Organisms → cellular organisms → Bacteria | 3686 | Open in IMG/M |
| 3300005354|Ga0070675_100435813 | Not Available | 1174 | Open in IMG/M |
| 3300005354|Ga0070675_100692818 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 928 | Open in IMG/M |
| 3300005355|Ga0070671_100000451 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 28559 | Open in IMG/M |
| 3300005355|Ga0070671_101643186 | Not Available | 570 | Open in IMG/M |
| 3300005356|Ga0070674_101342646 | Not Available | 639 | Open in IMG/M |
| 3300005356|Ga0070674_101804449 | Not Available | 555 | Open in IMG/M |
| 3300005364|Ga0070673_100694626 | Not Available | 934 | Open in IMG/M |
| 3300005364|Ga0070673_101761848 | Not Available | 586 | Open in IMG/M |
| 3300005365|Ga0070688_100177555 | Not Available | 1474 | Open in IMG/M |
| 3300005365|Ga0070688_101720392 | Not Available | 514 | Open in IMG/M |
| 3300005456|Ga0070678_100781239 | Not Available | 866 | Open in IMG/M |
| 3300005457|Ga0070662_100863799 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 771 | Open in IMG/M |
| 3300005459|Ga0068867_101344512 | Not Available | 661 | Open in IMG/M |
| 3300005466|Ga0070685_10300467 | Not Available | 1082 | Open in IMG/M |
| 3300005466|Ga0070685_10352388 | Not Available | 1007 | Open in IMG/M |
| 3300005466|Ga0070685_10729907 | Not Available | 725 | Open in IMG/M |
| 3300005468|Ga0070707_101249705 | Not Available | 709 | Open in IMG/M |
| 3300005615|Ga0070702_100698379 | Not Available | 773 | Open in IMG/M |
| 3300005615|Ga0070702_101752477 | Not Available | 518 | Open in IMG/M |
| 3300005719|Ga0068861_101246169 | Not Available | 721 | Open in IMG/M |
| 3300005840|Ga0068870_10723512 | Not Available | 689 | Open in IMG/M |
| 3300005841|Ga0068863_100977403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 849 | Open in IMG/M |
| 3300005841|Ga0068863_101439716 | Not Available | 697 | Open in IMG/M |
| 3300005842|Ga0068858_100319246 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Azospirillaceae → Skermanella → Skermanella rosea | 1484 | Open in IMG/M |
| 3300005844|Ga0068862_100865016 | Not Available | 887 | Open in IMG/M |
| 3300005844|Ga0068862_102653592 | Not Available | 513 | Open in IMG/M |
| 3300006196|Ga0075422_10019192 | All Organisms → cellular organisms → Bacteria | 2310 | Open in IMG/M |
| 3300006196|Ga0075422_10274029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 716 | Open in IMG/M |
| 3300006237|Ga0097621_100455693 | Not Available | 1153 | Open in IMG/M |
| 3300006358|Ga0068871_101315257 | Not Available | 680 | Open in IMG/M |
| 3300006358|Ga0068871_102247779 | Not Available | 520 | Open in IMG/M |
| 3300006854|Ga0075425_100987370 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 961 | Open in IMG/M |
| 3300006854|Ga0075425_102670203 | Not Available | 551 | Open in IMG/M |
| 3300006871|Ga0075434_102616799 | Not Available | 505 | Open in IMG/M |
| 3300009094|Ga0111539_10967682 | Not Available | 990 | Open in IMG/M |
| 3300009148|Ga0105243_11656149 | Not Available | 668 | Open in IMG/M |
| 3300009156|Ga0111538_10422957 | All Organisms → Viruses → Predicted Viral | 1687 | Open in IMG/M |
| 3300009176|Ga0105242_10565814 | Not Available | 1092 | Open in IMG/M |
| 3300009176|Ga0105242_11974511 | Not Available | 625 | Open in IMG/M |
| 3300009176|Ga0105242_12272999 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 588 | Open in IMG/M |
| 3300009177|Ga0105248_10236898 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2054 | Open in IMG/M |
| 3300009177|Ga0105248_11810851 | Not Available | 692 | Open in IMG/M |
| 3300009177|Ga0105248_12096945 | Not Available | 643 | Open in IMG/M |
| 3300009545|Ga0105237_11825547 | Not Available | 616 | Open in IMG/M |
| 3300009553|Ga0105249_10479208 | Not Available | 1287 | Open in IMG/M |
| 3300009553|Ga0105249_11386100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 775 | Open in IMG/M |
| 3300010397|Ga0134124_12269317 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300010403|Ga0134123_11466502 | Not Available | 725 | Open in IMG/M |
| 3300010403|Ga0134123_11829155 | Not Available | 661 | Open in IMG/M |
| 3300011119|Ga0105246_10576653 | Not Available | 968 | Open in IMG/M |
| 3300012885|Ga0157287_1022956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 831 | Open in IMG/M |
| 3300012900|Ga0157292_10069579 | Not Available | 989 | Open in IMG/M |
| 3300012900|Ga0157292_10155397 | Not Available | 732 | Open in IMG/M |
| 3300012916|Ga0157310_10019612 | Not Available | 1739 | Open in IMG/M |
| 3300012961|Ga0164302_11156911 | Not Available | 615 | Open in IMG/M |
| 3300013296|Ga0157374_10029918 | Not Available | 4940 | Open in IMG/M |
| 3300013296|Ga0157374_10289529 | Not Available | 1618 | Open in IMG/M |
| 3300013296|Ga0157374_10535629 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 1178 | Open in IMG/M |
| 3300013296|Ga0157374_11457519 | Not Available | 708 | Open in IMG/M |
| 3300013296|Ga0157374_11704053 | Not Available | 655 | Open in IMG/M |
| 3300013296|Ga0157374_11809203 | Not Available | 636 | Open in IMG/M |
| 3300013296|Ga0157374_12435333 | Not Available | 551 | Open in IMG/M |
| 3300013306|Ga0163162_10793115 | Not Available | 1065 | Open in IMG/M |
| 3300013306|Ga0163162_13112784 | Not Available | 533 | Open in IMG/M |
| 3300013306|Ga0163162_13121226 | All Organisms → cellular organisms → Bacteria | 532 | Open in IMG/M |
| 3300013308|Ga0157375_10107803 | Not Available | 2879 | Open in IMG/M |
| 3300013308|Ga0157375_10454997 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 1446 | Open in IMG/M |
| 3300013308|Ga0157375_11217875 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 883 | Open in IMG/M |
| 3300013308|Ga0157375_12251896 | Not Available | 649 | Open in IMG/M |
| 3300013308|Ga0157375_12469741 | Not Available | 620 | Open in IMG/M |
| 3300013308|Ga0157375_13244162 | Not Available | 542 | Open in IMG/M |
| 3300014325|Ga0163163_10189169 | Not Available | 2107 | Open in IMG/M |
| 3300014745|Ga0157377_10240473 | Not Available | 1168 | Open in IMG/M |
| 3300014968|Ga0157379_11319678 | Not Available | 697 | Open in IMG/M |
| 3300014969|Ga0157376_10001293 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 16485 | Open in IMG/M |
| 3300014969|Ga0157376_10257164 | Not Available | 1634 | Open in IMG/M |
| 3300014969|Ga0157376_10258074 | Not Available | 1631 | Open in IMG/M |
| 3300014969|Ga0157376_10333548 | Not Available | 1446 | Open in IMG/M |
| 3300014969|Ga0157376_10431374 | Not Available | 1281 | Open in IMG/M |
| 3300014969|Ga0157376_11259395 | Not Available | 769 | Open in IMG/M |
| 3300014969|Ga0157376_11293987 | Not Available | 759 | Open in IMG/M |
| 3300014969|Ga0157376_11732782 | Not Available | 660 | Open in IMG/M |
| 3300014969|Ga0157376_11994314 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium pachyrhizi | 618 | Open in IMG/M |
| 3300017792|Ga0163161_10280469 | Not Available | 1307 | Open in IMG/M |
| 3300017792|Ga0163161_10778882 | Not Available | 802 | Open in IMG/M |
| 3300017792|Ga0163161_11748568 | Not Available | 552 | Open in IMG/M |
| 3300019356|Ga0173481_10117951 | Not Available | 1048 | Open in IMG/M |
| 3300019362|Ga0173479_10055400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1319 | Open in IMG/M |
| 3300022892|Ga0247753_1022589 | Not Available | 711 | Open in IMG/M |
| 3300022893|Ga0247787_1028261 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylobacteriaceae → Microvirga → Microvirga mediterraneensis | 776 | Open in IMG/M |
| 3300022901|Ga0247788_1011918 | Not Available | 1465 | Open in IMG/M |
| 3300023071|Ga0247752_1071721 | Not Available | 568 | Open in IMG/M |
| 3300023168|Ga0247748_1034268 | Not Available | 742 | Open in IMG/M |
| 3300023168|Ga0247748_1047158 | Not Available | 649 | Open in IMG/M |
| 3300023260|Ga0247798_1002895 | Not Available | 2046 | Open in IMG/M |
| 3300024232|Ga0247664_1129269 | Not Available | 590 | Open in IMG/M |
| 3300025290|Ga0207673_1011001 | Not Available | 1169 | Open in IMG/M |
| 3300025315|Ga0207697_10000731 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 18636 | Open in IMG/M |
| 3300025315|Ga0207697_10012893 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3495 | Open in IMG/M |
| 3300025315|Ga0207697_10030535 | Not Available | 2205 | Open in IMG/M |
| 3300025315|Ga0207697_10045082 | Not Available | 1815 | Open in IMG/M |
| 3300025315|Ga0207697_10157740 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 989 | Open in IMG/M |
| 3300025315|Ga0207697_10375782 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 631 | Open in IMG/M |
| 3300025893|Ga0207682_10310211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 740 | Open in IMG/M |
| 3300025900|Ga0207710_10421345 | Not Available | 687 | Open in IMG/M |
| 3300025903|Ga0207680_10286374 | Not Available | 1146 | Open in IMG/M |
| 3300025908|Ga0207643_10023242 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3418 | Open in IMG/M |
| 3300025908|Ga0207643_10102468 | Not Available | 1679 | Open in IMG/M |
| 3300025908|Ga0207643_10196630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1226 | Open in IMG/M |
| 3300025918|Ga0207662_10160153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
| 3300025918|Ga0207662_10716934 | Not Available | 702 | Open in IMG/M |
| 3300025918|Ga0207662_11269137 | Not Available | 523 | Open in IMG/M |
| 3300025923|Ga0207681_10066147 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2501 | Open in IMG/M |
| 3300025925|Ga0207650_10001391 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 17456 | Open in IMG/M |
| 3300025925|Ga0207650_10054264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales | 2972 | Open in IMG/M |
| 3300025925|Ga0207650_10169744 | Not Available | 1733 | Open in IMG/M |
| 3300025925|Ga0207650_10196193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1615 | Open in IMG/M |
| 3300025925|Ga0207650_10242514 | Not Available | 1457 | Open in IMG/M |
| 3300025925|Ga0207650_11155719 | Not Available | 659 | Open in IMG/M |
| 3300025925|Ga0207650_11340107 | Not Available | 609 | Open in IMG/M |
| 3300025926|Ga0207659_10026173 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3933 | Open in IMG/M |
| 3300025926|Ga0207659_10099245 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2192 | Open in IMG/M |
| 3300025926|Ga0207659_10291247 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1338 | Open in IMG/M |
| 3300025926|Ga0207659_11286984 | Not Available | 628 | Open in IMG/M |
| 3300025926|Ga0207659_11703564 | Not Available | 537 | Open in IMG/M |
| 3300025927|Ga0207687_11948279 | Not Available | 502 | Open in IMG/M |
| 3300025930|Ga0207701_10102907 | Not Available | 2559 | Open in IMG/M |
| 3300025930|Ga0207701_10756604 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 820 | Open in IMG/M |
| 3300025931|Ga0207644_10000376 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 29113 | Open in IMG/M |
| 3300025934|Ga0207686_10260674 | Not Available | 1271 | Open in IMG/M |
| 3300025934|Ga0207686_10369783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1084 | Open in IMG/M |
| 3300025934|Ga0207686_11117315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 643 | Open in IMG/M |
| 3300025935|Ga0207709_10001573 | Not Available | 15615 | Open in IMG/M |
| 3300025935|Ga0207709_10030687 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3129 | Open in IMG/M |
| 3300025935|Ga0207709_10327972 | Not Available | 1148 | Open in IMG/M |
| 3300025936|Ga0207670_10595550 | Not Available | 907 | Open in IMG/M |
| 3300025936|Ga0207670_11333054 | Not Available | 609 | Open in IMG/M |
| 3300025940|Ga0207691_10094647 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2673 | Open in IMG/M |
| 3300025941|Ga0207711_10206264 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1795 | Open in IMG/M |
| 3300025941|Ga0207711_10579166 | Not Available | 1047 | Open in IMG/M |
| 3300025941|Ga0207711_10621219 | Not Available | 1008 | Open in IMG/M |
| 3300025942|Ga0207689_10421435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Caulobacterales → Caulobacteraceae → Asticcacaulis → unclassified Asticcacaulis → Asticcacaulis sp. YBE204 | 1114 | Open in IMG/M |
| 3300025942|Ga0207689_11371704 | Not Available | 593 | Open in IMG/M |
| 3300025960|Ga0207651_10611559 | Not Available | 953 | Open in IMG/M |
| 3300025960|Ga0207651_11932661 | Not Available | 530 | Open in IMG/M |
| 3300025961|Ga0207712_10445981 | Not Available | 1097 | Open in IMG/M |
| 3300025986|Ga0207658_10884282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 813 | Open in IMG/M |
| 3300026023|Ga0207677_11328331 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → Rhodoplanes → Rhodoplanes piscinae | 661 | Open in IMG/M |
| 3300026088|Ga0207641_10265255 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1609 | Open in IMG/M |
| 3300026088|Ga0207641_10684025 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1009 | Open in IMG/M |
| 3300026088|Ga0207641_11302472 | Not Available | 727 | Open in IMG/M |
| 3300026088|Ga0207641_11573843 | Not Available | 659 | Open in IMG/M |
| 3300026088|Ga0207641_12041188 | Not Available | 574 | Open in IMG/M |
| 3300026089|Ga0207648_10099571 | All Organisms → cellular organisms → Bacteria | 2546 | Open in IMG/M |
| 3300026089|Ga0207648_11219275 | Not Available | 707 | Open in IMG/M |
| 3300026095|Ga0207676_10036770 | Not Available | 3727 | Open in IMG/M |
| 3300026095|Ga0207676_10113313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2273 | Open in IMG/M |
| 3300026095|Ga0207676_10493565 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1161 | Open in IMG/M |
| 3300026095|Ga0207676_11494182 | Not Available | 672 | Open in IMG/M |
| 3300026121|Ga0207683_10601533 | Not Available | 1018 | Open in IMG/M |
| 3300026121|Ga0207683_11453799 | Not Available | 633 | Open in IMG/M |
| 3300027907|Ga0207428_10001887 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 21316 | Open in IMG/M |
| 3300028379|Ga0268266_10737300 | Not Available | 950 | Open in IMG/M |
| 3300031740|Ga0307468_101757760 | Not Available | 585 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 13.30% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 11.33% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 7.39% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 6.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 6.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.91% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 5.42% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 4.93% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 3.94% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.94% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.45% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.45% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 2.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 1.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 1.48% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.99% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 0.49% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Host-Associated | Open in IMG/M |
| 3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Environmental | Open in IMG/M |
| 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Environmental | Open in IMG/M |
| 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006196 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 | Host-Associated | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Host-Associated | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
| 3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012885 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 | Environmental | Open in IMG/M |
| 3300012900 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S179-409R-1 | Environmental | Open in IMG/M |
| 3300012916 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S213-509R-2 | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
| 3300019362 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S104-311B-1 (version 2) | Environmental | Open in IMG/M |
| 3300022892 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S169-409R-5 | Environmental | Open in IMG/M |
| 3300022893 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S126-311R-4 | Environmental | Open in IMG/M |
| 3300022901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4 | Environmental | Open in IMG/M |
| 3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
| 3300023168 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S064-202C-5 | Environmental | Open in IMG/M |
| 3300023260 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6 | Environmental | Open in IMG/M |
| 3300024232 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK05 | Environmental | Open in IMG/M |
| 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 | Host-Associated | Open in IMG/M |
| 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
| 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24751J29686_101074722 | 3300002459 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELD |
| Ga0062593_1000340815 | 3300004114 | Soil | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGAEG* |
| Ga0062589_1017101963 | 3300004156 | Soil | MTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAAC |
| Ga0062591_1000648294 | 3300004643 | Soil | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQAGGY* |
| Ga0062591_1009689563 | 3300004643 | Soil | MTPKQHFRHLQFKLEIAEFGMGMPYDGERVKELREQVEQARKEAEHMDSDGFTEQAGGY* |
| Ga0062591_1026768911 | 3300004643 | Soil | MTPKQHFRALQIRLEIAEFGMGMPYDGERVKELREQVEQARKDAAC |
| Ga0062594_1002007711 | 3300005093 | Soil | IRLEIAEFGMGMPLDRERVKELREQVEQARQDAAEALVEAELARITSDGAE* |
| Ga0062594_1033019083 | 3300005093 | Soil | IAEFGMGMPLDRERVKELRAQVEQARQDAAEALVEAELDRITSDGVE* |
| Ga0065714_100470132 | 3300005288 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEXGMGMPLDRERVKELREQVEQARKDAEHMDSDGFDEQAGGY* |
| Ga0065714_1006528612 | 3300005288 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARQDAAEALVEAELARITSDGAE* |
| Ga0065714_101146971 | 3300005288 | Miscanthus Rhizosphere | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDG |
| Ga0065714_101396802 | 3300005288 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEYGMGMPLDRERVKELREQVEQARKEAELDTMTSDGVE* |
| Ga0065714_103671702 | 3300005288 | Miscanthus Rhizosphere | MTPKQHFRRLQLKLEIAEFGMALPRDEERVRELRAQLEQAKKDAADEVE |
| Ga0065714_105249021 | 3300005288 | Miscanthus Rhizosphere | MTPKQHFRRLQFKLELAEFGMAMPYDADRVKELREQVEQARKDAELDTMTSDGNE* |
| Ga0065712_100154865 | 3300005290 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDEVQS* |
| Ga0065712_100459482 | 3300005290 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPYDGERVKELREQVEQARKDADEEVQS* |
| Ga0065712_1006958017 | 3300005290 | Miscanthus Rhizosphere | MTPKQHFRRLQLKLEIAEFGMALPRDEERVRELRAQLEQAKKDAADEVEQ* |
| Ga0065712_1007132912 | 3300005290 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAELDASDGAE* |
| Ga0065712_102255321 | 3300005290 | Miscanthus Rhizosphere | MTPKQHFRRLQLKLEIAEFGMGMPLDREHVKELREQVEQARKDAEHMDSDGFDEQMGGY* |
| Ga0065712_102779274 | 3300005290 | Miscanthus Rhizosphere | HFRRLQLRLEIAEFGMGMPYDAERVKELREQVEQARKDAEQDSDGEVVS* |
| Ga0065712_104584762 | 3300005290 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEWGMGMPLDRERVKELREQVEQARKDAELDTMTSDGNE* |
| Ga0065715_105364581 | 3300005293 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGF |
| Ga0070676_115828861 | 3300005328 | Miscanthus Rhizosphere | AKTGDQMTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAELDTMTSDGVE* |
| Ga0070690_1005204081 | 3300005330 | Switchgrass Rhizosphere | MTPKQHFRSLQIRLEIAEFGMGMPLDRERVKELRAQVEQARQDAAEALVEAELDRITSDGVE* |
| Ga0070690_1011682772 | 3300005330 | Switchgrass Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEHARKEAEHMDSDGFTEQQGGY* |
| Ga0070670_10001098610 | 3300005331 | Switchgrass Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDAMTSDGVE* |
| Ga0070670_1000420388 | 3300005331 | Switchgrass Rhizosphere | MTPKQHFRALQFKLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTITSDGVE* |
| Ga0070670_1001775461 | 3300005331 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEL |
| Ga0070670_1003080352 | 3300005331 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAESVIEDDQ* |
| Ga0070670_1005603583 | 3300005331 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEYGMGMPLDRKRVKELREQVEQARKDAELDTMTSDGVE* |
| Ga0070670_1007978943 | 3300005331 | Switchgrass Rhizosphere | MTPKQHFRRLQLRLEIAEWGMGMPLDRERVKELREQVEQARK |
| Ga0070670_1022632282 | 3300005331 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDAITSDGTEP* |
| Ga0070689_1020415551 | 3300005340 | Switchgrass Rhizosphere | DMTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGVEP* |
| Ga0070687_1001785711 | 3300005343 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRECVKELREQVEQARKDAELDTMTSDGMEQS* |
| Ga0070669_1000762916 | 3300005353 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGVE* |
| Ga0070669_1018865172 | 3300005353 | Switchgrass Rhizosphere | MENDMTPKQHFRRLQLRLEIAEFGMGMPYDAERVKELREQVEQARKDAE |
| Ga0070675_1000164734 | 3300005354 | Miscanthus Rhizosphere | VTPKQHFRRLQLKLEIAEFGMGMPLDRERVKELREQVEQARKDAELDAMTSDGVE* |
| Ga0070675_1000431082 | 3300005354 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEYGMGMPLDRERVKELREQVEQARKDAEHMDSDGFTEQAGGY* |
| Ga0070675_1004358133 | 3300005354 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQQGGY* |
| Ga0070675_1006928182 | 3300005354 | Miscanthus Rhizosphere | MTPKQHFRRLQFKLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQAGGY* |
| Ga0070671_10000045123 | 3300005355 | Switchgrass Rhizosphere | MTPKQHFRSLQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGTEP* |
| Ga0070671_1016431862 | 3300005355 | Switchgrass Rhizosphere | MTPKQHFRRLQFKLELAEFGMAMPYDADRVKELREQVEQARKDAELDTMTSDGVE* |
| Ga0070674_1013426462 | 3300005356 | Miscanthus Rhizosphere | MTPKQHFRRLQFKLEIAQYGMGMPYDAERVKELREQVEQARKDAELDTMTSDGVE* |
| Ga0070674_1018044491 | 3300005356 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDG |
| Ga0070673_1006946263 | 3300005364 | Switchgrass Rhizosphere | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGSE* |
| Ga0070673_1017618482 | 3300005364 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMALPLDRERVKELREQVEQARKDAELDTMTSDGMEQS* |
| Ga0070688_1001775556 | 3300005365 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAELD |
| Ga0070688_1017203921 | 3300005365 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMALPLDRERVKELREQVEQARKDAELDTMTSD |
| Ga0070678_1007812393 | 3300005456 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPYDAERVKELREQVEQARKDAEQDSDGEVVS* |
| Ga0070662_1008637991 | 3300005457 | Corn Rhizosphere | TPKQHFRALQIRLEIAEFGMGMPYDAERVKELREQVEQARQDAAEALVEAELDRITSDGVE* |
| Ga0068867_1013445122 | 3300005459 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAELDTMTSDGVE* |
| Ga0070685_103004671 | 3300005466 | Switchgrass Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPYDAERVKELREQVEQARKDAEHMDSDGF |
| Ga0070685_103523883 | 3300005466 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGVEP* |
| Ga0070685_107299071 | 3300005466 | Switchgrass Rhizosphere | GATDMTPKQHFRALQIRLEIAEFGMALPRDEERVRSLRAQLEQAKKDAEEEVEQ* |
| Ga0070707_1012497052 | 3300005468 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPKQHFRSLQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGAEG* |
| Ga0070702_1006983793 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRDRVKELREQVEQARKDAELDTMTSDGVE* |
| Ga0070702_1017524771 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAE |
| Ga0068861_1012461691 | 3300005719 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQAR |
| Ga0068870_107235122 | 3300005840 | Miscanthus Rhizosphere | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGVE* |
| Ga0068863_1009774031 | 3300005841 | Switchgrass Rhizosphere | HFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDGMTSDGVE* |
| Ga0068863_1014397162 | 3300005841 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMALPLDRERVKELREQVEQARKDAELMDSDGFDEQQGGY* |
| Ga0068858_1003192461 | 3300005842 | Switchgrass Rhizosphere | MTPMQHFRALQIRLEIAEFGMGMPYDGERVKELREQVEQARKD |
| Ga0068862_1008650162 | 3300005844 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDAMTSDGVE* |
| Ga0068862_1026535922 | 3300005844 | Switchgrass Rhizosphere | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELD |
| Ga0075422_100191922 | 3300006196 | Populus Rhizosphere | MTPKQHFRRLQLRLEIAEYGMGMPLDRERVKELREQVEQARKDAERMDSDGFTEQAGGY* |
| Ga0075422_102740292 | 3300006196 | Populus Rhizosphere | MTPKQHFRRLQLKLEIAEFGMGMPLDREHVKELREQVEQARKDAEHMDSDGFTEQAGGY* |
| Ga0097621_1004556931 | 3300006237 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVE |
| Ga0068871_1013152573 | 3300006358 | Miscanthus Rhizosphere | MTPKQHFRRLQFKLEIAEFGMGMPFDRERVNELREQVEQARKEAERMDSDGFNEQAGGY* |
| Ga0068871_1022477792 | 3300006358 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQMGGY* |
| Ga0075425_1009873703 | 3300006854 | Populus Rhizosphere | MTPKQHFRALQFKLEIAEFGMALPYDAERVKELREQVEQARKDAELDTMTSDGVEP* |
| Ga0075425_1026702031 | 3300006854 | Populus Rhizosphere | VTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAE |
| Ga0075434_1026167993 | 3300006871 | Populus Rhizosphere | MTPKQHFRRLQLKLEIAEFGMGMPLDREHVKELREQVEQARKDAE |
| Ga0111539_109676822 | 3300009094 | Populus Rhizosphere | VTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDAMTSDGVE* |
| Ga0105243_116561491 | 3300009148 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRDRVKELREQVEQARKDAELDT |
| Ga0111538_104229572 | 3300009156 | Populus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELRDQVEQARKEAEHMDSDGFTEQAGGY* |
| Ga0105242_105658144 | 3300009176 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKEAEHMDSD |
| Ga0105242_119745112 | 3300009176 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMALPRDEELVRSLRAQLEQAKKDAAEEVEQ* |
| Ga0105242_122729992 | 3300009176 | Miscanthus Rhizosphere | TPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDVELDAIISDGTEP* |
| Ga0105248_102368984 | 3300009177 | Switchgrass Rhizosphere | MTPKQHFRALQILLEIAEFEMGMPLDRECVKELREQVEQARKDAELDAMTSDGAEQ* |
| Ga0105248_118108511 | 3300009177 | Switchgrass Rhizosphere | MTPKQHFRHLQFKLEIAEFGMGMPYDGERVKELREQVEQARKEAEHMDSDGFTEQ |
| Ga0105248_120969451 | 3300009177 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMALPRDEELVRLLRAQLEQARKDAAEEVEQ* |
| Ga0105237_118255472 | 3300009545 | Corn Rhizosphere | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDASDGAE* |
| Ga0105249_104792081 | 3300009553 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGGE* |
| Ga0105249_113861003 | 3300009553 | Switchgrass Rhizosphere | VTPKQHFRALQIRPEIAEFGMGMPLDRERVKELREQVEQARKDVELDAIISDGTEP* |
| Ga0134124_122693171 | 3300010397 | Terrestrial Soil | ALDRSQPDKEGVMTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKEAEHMDSDGFTEQAGGY* |
| Ga0134123_114665021 | 3300010403 | Terrestrial Soil | MTPKQHFRRLQLKLEIAEFGMGMPLDREHVKELREQVEQARKDAEHMDSDGFDEQMG |
| Ga0134123_118291551 | 3300010403 | Terrestrial Soil | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGAEG* |
| Ga0105246_105766532 | 3300011119 | Miscanthus Rhizosphere | DMTPKQHFRRLQLKLEIAEFGMGMPLDREHVKELREQVEQARKDAEHMDSDGFDEQMGGY |
| Ga0157287_10229561 | 3300012885 | Soil | TPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQAGGY* |
| Ga0157292_100695791 | 3300012900 | Soil | MTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAA |
| Ga0157292_101553973 | 3300012900 | Soil | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELMDSDGFDEQQG |
| Ga0157310_100196126 | 3300012916 | Soil | MTPKQHFRSLQIRLEIAEYGMGMPLDRERVKELREQVEQARKD |
| Ga0164302_111569112 | 3300012961 | Soil | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDSMTSDGRE* |
| Ga0157374_1002991812 | 3300013296 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAECGMGMPLDRERVKELREQVEQARKDA |
| Ga0157374_102895293 | 3300013296 | Miscanthus Rhizosphere | MENDMTPKQHFRRLQLKLEIAEFGMALPRDEERVRELRAQLEQAKKDAADEVEQ* |
| Ga0157374_105356292 | 3300013296 | Miscanthus Rhizosphere | VTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDVELDAIISDGTEP* |
| Ga0157374_114575191 | 3300013296 | Miscanthus Rhizosphere | MTPKQHFRALQIRLESAEYGMALPRDEERVRSLRAQLEQAKKDAAEEVKQ* |
| Ga0157374_117040531 | 3300013296 | Miscanthus Rhizosphere | TGDQMTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAELDASDGAE* |
| Ga0157374_118092032 | 3300013296 | Miscanthus Rhizosphere | MTPKQHFRRLQFKLEIAEFGMGMPLDRERVKELREQVEQARKDAELLDSDGFNEQQGGY* |
| Ga0157374_124353331 | 3300013296 | Miscanthus Rhizosphere | MTPKQHFRRLQFKLELAEFGMAMPYDADRVKELREQVEQARKDAELDTMTSD |
| Ga0163162_107931153 | 3300013306 | Switchgrass Rhizosphere | MTPKQHFRHLQFKLEIAEFGMGMPYDGERVKELREQVEQARKEAEHMDRDGFTEQAGGY* |
| Ga0163162_131127842 | 3300013306 | Switchgrass Rhizosphere | MTPKQHFRSLQLRLEIAEFGMALPRDEELVRLLRAQLEQARKDAAEEVEQ* |
| Ga0163162_131212261 | 3300013306 | Switchgrass Rhizosphere | MPPNQHFRALQIRLEIAEWGMGMPLDRERVKELREQVEQARKDAELDTMTSDGNE* |
| Ga0157375_101078031 | 3300013308 | Miscanthus Rhizosphere | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSD |
| Ga0157375_104549973 | 3300013308 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTITSDGVE* |
| Ga0157375_112178752 | 3300013308 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELRAQVEQARQDAAEALVEAELDRITSDGVE* |
| Ga0157375_122518962 | 3300013308 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRECVKELREQVEQARKDAELD |
| Ga0157375_124697412 | 3300013308 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEYGMGMPLDRDRVKELREQVEQARKDAEHMDSDGFNEQAGGY* |
| Ga0157375_132441622 | 3300013308 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPYDGERVKELREQVEQARKEAEH |
| Ga0163163_101891693 | 3300014325 | Switchgrass Rhizosphere | MTPKQHFRRLQLRLEIAEWGMGMPLDRERVKELREQVEQARKEAEHMDSDGFNEQQGGY* |
| Ga0157377_102404735 | 3300014745 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKD |
| Ga0157379_113196782 | 3300014968 | Switchgrass Rhizosphere | MTPKQHFRSLQIRLEIAEFGMALPRDEELVRSLRAQLEQAKKDAEQEVEQ* |
| Ga0157376_1000129321 | 3300014969 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELATSDGAE* |
| Ga0157376_102571641 | 3300014969 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARK |
| Ga0157376_102580744 | 3300014969 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRECVKELREQVEQARKDAELDAMTSDGAEQ* |
| Ga0157376_103335481 | 3300014969 | Miscanthus Rhizosphere | MTPKQHFRRLQFKLEIAEFGMGMPFDRERVNELREQVEQARKAAELMDSDGFDEQQGGY* |
| Ga0157376_104313744 | 3300014969 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQMGG* |
| Ga0157376_112593952 | 3300014969 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFDEQAGGY* |
| Ga0157376_112939872 | 3300014969 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGSE* |
| Ga0157376_117327823 | 3300014969 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEEAERA |
| Ga0157376_119943142 | 3300014969 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKDLREQVE* |
| Ga0163161_102804695 | 3300017792 | Switchgrass Rhizosphere | MTPKQHFRRLQLRLEIAEYGMGMPLDRERVKELREQVEQARKDAEHMDSDGFTEQAGGY |
| Ga0163161_107788822 | 3300017792 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAELDASDGAE |
| Ga0163161_117485682 | 3300017792 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAE |
| Ga0173481_101179512 | 3300019356 | Soil | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGAEG |
| Ga0173479_100554004 | 3300019362 | Soil | MTPKQHFRRLQLRLEIAEFGMGMPLYRERVKELREQVEQARKDAEHMDSDGFNEQAGGY |
| Ga0247753_10225891 | 3300022892 | Soil | LQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGAEG |
| Ga0247787_10282613 | 3300022893 | Soil | QIRLEIAEFGMGMPLDRERVKELREQVEQARKEAERMDSDGFTEQAGGY |
| Ga0247788_10119184 | 3300022901 | Soil | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQAGGY |
| Ga0247752_10717211 | 3300023071 | Soil | PKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAELDTMTSDGAEG |
| Ga0247748_10342683 | 3300023168 | Soil | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQMGGY |
| Ga0247748_10471582 | 3300023168 | Soil | MTPKQHFRRLQLKLEIAEFGMGMPLDREHVKELREQVEQARKDAEHMDSDGFDEQMGGY |
| Ga0247798_10028951 | 3300023260 | Soil | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELD |
| Ga0247664_11292693 | 3300024232 | Soil | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDS |
| Ga0207673_10110015 | 3300025290 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGSEQL |
| Ga0207697_1000073114 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARQDAAEALVEAELARITSDGAE |
| Ga0207697_100128937 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEYGMGMPLDRERVKELREQVEQARKEAELDTMTSDGVE |
| Ga0207697_100305356 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGVE |
| Ga0207697_100450825 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | VTPKQHFRRLQLKLEIAEFGMGMPLDRERVKELREQVEQARKDAELDAMTSDGVE |
| Ga0207697_101577401 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | GSQMTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKEAEHMDSDGFTEQAGGY |
| Ga0207697_103757823 | 3300025315 | Corn, Switchgrass And Miscanthus Rhizosphere | KQHFRSLQIRLEIAEFGMGMPLDRERVKELRAQVEQARQDAAEALVEAELDRITSDGVE |
| Ga0207682_103102112 | 3300025893 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEWGMGMPLDRERVKELREQVEQARKDAEHMDSDGFDEQAGGY |
| Ga0207642_105461284 | 3300025899 | Miscanthus Rhizosphere | FGMGMPLDRERVKELRAQVEQARQDAAEALVEAELDRITSDGVE |
| Ga0207710_104213453 | 3300025900 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDASDGAE |
| Ga0207680_102863741 | 3300025903 | Switchgrass Rhizosphere | MTPKQHFRSLQIRLEIAEFGMGMPLDRERVKELRAQVEQARQDAAEALVEAELDRITSDGVE |
| Ga0207643_100232428 | 3300025908 | Miscanthus Rhizosphere | HFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAELDASDGAE |
| Ga0207643_101024685 | 3300025908 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFDEQAGGY |
| Ga0207643_101966302 | 3300025908 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDAITSDGTEP |
| Ga0207662_101601533 | 3300025918 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRECVKELREQVEQARKDAELDTMTSDGMEQS |
| Ga0207662_107169343 | 3300025918 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEEAE |
| Ga0207662_112691371 | 3300025918 | Switchgrass Rhizosphere | RLEIAEFGMGMPLDRERVKELRAQVEQARQDAAEALVEAELDRITSDGVE |
| Ga0207681_100661471 | 3300025923 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGVE |
| Ga0207650_1000139125 | 3300025925 | Switchgrass Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDAMTSDGVE |
| Ga0207650_100542646 | 3300025925 | Switchgrass Rhizosphere | MTPKQHFRALQFKLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTITSDGVE |
| Ga0207650_101697442 | 3300025925 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMRMPLDRERVKELREQVEQARKDAELDTMTSDGGE |
| Ga0207650_101961933 | 3300025925 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAESVIEDDQ |
| Ga0207650_102425141 | 3300025925 | Switchgrass Rhizosphere | MTPKQHFRRLQLRLEIAEWGMGMPLDRERVKELREQVEQARKEAEHMDSDGFNEQQGGY |
| Ga0207650_111557192 | 3300025925 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEYGMGMPLDRKRVKELREQVEQARKDAELDTMTSDGVE |
| Ga0207650_113401074 | 3300025925 | Switchgrass Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQQGGY |
| Ga0207659_100261733 | 3300025926 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQQGGY |
| Ga0207659_100992455 | 3300025926 | Miscanthus Rhizosphere | MTPKQHFRRLQLKLEIAEFGMALPRDEERVRELRAQLEQAKKDAADEVEQ |
| Ga0207659_102912474 | 3300025926 | Miscanthus Rhizosphere | TPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQAGGY |
| Ga0207659_112869843 | 3300025926 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKEAEHMDSDGFNEQAGGY |
| Ga0207659_117035641 | 3300025926 | Miscanthus Rhizosphere | MTPKQHFRHLQFKLEIAEFGMGMPYDGERVKELREQVEQARKEAEHMDSDGFTEQAGGY |
| Ga0207687_119482792 | 3300025927 | Miscanthus Rhizosphere | MTPKQHFRRLQFKLELAEFGMAMPYDADRVKELREQVEQARKDAELDTMTSDGVE |
| Ga0207701_101029077 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKEAEHMDSDGFTEQQGGY |
| Ga0207701_107566041 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | QHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDVELDAIISDGTEP |
| Ga0207644_1000037632 | 3300025931 | Switchgrass Rhizosphere | MTPKQHFRSLQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGTEP |
| Ga0207686_102606743 | 3300025934 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPYDAERVKELREQVEQARKDAEQDSDGEVVS |
| Ga0207686_103697833 | 3300025934 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRDRVKELREQVEQARKDAELDTMTSDGVE |
| Ga0207686_111173151 | 3300025934 | Miscanthus Rhizosphere | NGNKTVTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDVELDAIISDGTE |
| Ga0207709_1000157326 | 3300025935 | Miscanthus Rhizosphere | MTPKQHFRSLQIRLEIAEFGMGMPLDRERVKELRAQVEQARQDAAEALVEA |
| Ga0207709_100306871 | 3300025935 | Miscanthus Rhizosphere | SAKTGDQMTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAELDASDGAE |
| Ga0207709_103279722 | 3300025935 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPYDAERVKELREQVEQARKDAEHMDSDGFDEQMGGY |
| Ga0207670_105955504 | 3300025936 | Switchgrass Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAEQDSDGEVVS |
| Ga0207670_113330544 | 3300025936 | Switchgrass Rhizosphere | TPKQHFRHLQFKLEIAEFGMGMPYDGERVKELREQVEQARKEAEHMDSDGFTEQAGGY |
| Ga0207691_100946475 | 3300025940 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMALPLDRERVKELREQVEQARKDAELDTMTSDGMEQS |
| Ga0207711_102062644 | 3300025941 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRECVKELREQVEQARKDAELDAMTSDGAEQ |
| Ga0207711_105791664 | 3300025941 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGF |
| Ga0207711_106212191 | 3300025941 | Switchgrass Rhizosphere | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAE |
| Ga0207689_104214353 | 3300025942 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEFGMGMPYDAERVKELREQVEHARKEAEHMDSDGFTEQAGGY |
| Ga0207689_113717041 | 3300025942 | Miscanthus Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHM |
| Ga0207651_106115593 | 3300025960 | Switchgrass Rhizosphere | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGSE |
| Ga0207651_119326612 | 3300025960 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAESV |
| Ga0207712_104459813 | 3300025961 | Switchgrass Rhizosphere | VTPKQHFRRLQLRLEIAEFGMGMPLDRERVKELREQVEQARKEAEHMDSDGFNEQAGGY |
| Ga0207658_108842822 | 3300025986 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPYDAERVKELREQVEQARKDAELDTMTSDGVE |
| Ga0207677_113283311 | 3300026023 | Miscanthus Rhizosphere | VTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQ |
| Ga0207641_102652554 | 3300026088 | Switchgrass Rhizosphere | HFRALQIRLEIAEFGMALPLDRERVKELREQVEQARKDAELDTMTSDGMEQS |
| Ga0207641_106840252 | 3300026088 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDGMTSDGVE |
| Ga0207641_113024724 | 3300026088 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMAMPLDRERVKELREQVEQARKDAELDA |
| Ga0207641_115738431 | 3300026088 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMALPLDRERVKELREQVEQAR |
| Ga0207641_120411881 | 3300026088 | Switchgrass Rhizosphere | MTPKQHFRALQFKLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTI |
| Ga0207648_100995712 | 3300026089 | Miscanthus Rhizosphere | MTPKQHFRRLQLRLEIAEYGMGMPLDRDRVKELREQVEQARKDAEHMDSDGFNEQAGGY |
| Ga0207648_112192752 | 3300026089 | Miscanthus Rhizosphere | VTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGVE |
| Ga0207676_100367701 | 3300026095 | Switchgrass Rhizosphere | MTPKQHFRALQFKLEIAEFGMGMPLDRERVKELREQVEQARKDAE |
| Ga0207676_101133132 | 3300026095 | Switchgrass Rhizosphere | MTPKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGGE |
| Ga0207676_104935655 | 3300026095 | Switchgrass Rhizosphere | PLGAVMTPKQHFRHLQFKLEIAEFGMGMPYDGERVKELREQVEQARKEAEHMDSDGFTEQAGGY |
| Ga0207676_114941821 | 3300026095 | Switchgrass Rhizosphere | PKQHFRALQIRLEIAEFGMGMPLDRERVKELREQVEQARKDAEHMDSDGFNEQQGGY |
| Ga0207683_106015333 | 3300026121 | Miscanthus Rhizosphere | MTPKQHFRALQLRLEIAEFGMGMPLDRERVKELREQVEQARKDAELDTMTSDGV |
| Ga0207683_114537991 | 3300026121 | Miscanthus Rhizosphere | AMTPKQHFRRLQFKLELAEFGMAMPYDADRVKELREQVEQARKDAELDTMTSDGVE |
| Ga0207428_1000188727 | 3300027907 | Populus Rhizosphere | MTPKQHFRRLQLRLEIAEYGMGMPLDRERVKELREQVEQARKDAERMDSDGFTEQAGGY |
| Ga0268266_107373001 | 3300028379 | Switchgrass Rhizosphere | AEFGMGMPLDRERVKELREQVEQARQDAAEALVEAELARITSDGAE |
| Ga0307468_1017577602 | 3300031740 | Hardwood Forest Soil | MTPKQHFRHLQFKLEIAEFGMGMPLDRERVKELREQVEQARKEAELLDSDGFTEQAGGY |
| ⦗Top⦘ |