 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F025057 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 203 |
| Average Sequence Length | 43 residues |
| Representative Sequence | PTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Number of Associated Samples | 180 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 2.46 % |
| % of genes near scaffold ends (potentially truncated) | 94.09 % |
| % of genes from short scaffolds (< 2000 bps) | 94.09 % |
| Associated GOLD sequencing projects | 171 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (81.773 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (15.271 % of family members) |
| Environment Ontology (ENVO) | Unclassified (35.468 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (38.916 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 2.38% β-sheet: 0.00% Coil/Unstructured: 97.62% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 203 Family Scaffolds |
|---|---|---|
| PF02801 | Ketoacyl-synt_C | 86.70 |
| PF00550 | PP-binding | 3.45 |
| PF13561 | adh_short_C2 | 2.46 |
| PF02618 | YceG | 0.99 |
| PF00106 | adh_short | 0.49 |
| PF13458 | Peripla_BP_6 | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
|---|---|---|---|
| COG1559 | Endolytic transglycosylase MltG, terminates peptidoglycan polymerization | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 81.77 % |
| All Organisms | root | All Organisms | 18.23 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 15.27% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 8.37% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.90% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.94% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 2.96% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.96% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.46% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.46% |
| Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 2.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.46% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 2.46% |
| Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.97% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.97% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.97% |
| Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.97% |
| Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 1.97% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.97% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.48% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.48% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.48% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 0.99% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.99% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.99% |
| Serpentine Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil | 0.99% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.99% |
| Untreated Peat Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil | 0.99% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.99% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.99% |
| Freshwater | Environmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater | 0.49% |
| Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.49% |
| Glacier Forefield Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil | 0.49% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Permafrost Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.49% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.49% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.49% |
| Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 0.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.49% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.49% |
| Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 0.49% |
| Plant Litter | Environmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter | 0.49% |
| Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.49% |
| Environmental → Unclassified → Unclassified → Unclassified → Unclassified → | 0.49% | |
| Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Arabidopsis Root | Host-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Miscanthus Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.49% |
| Plant Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Plant Roots | 0.49% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 0.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.49% |
| Root Nodules | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules | 0.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2124908016 | Sample 642 | Environmental | Open in IMG/M |
| 2170459013 | Grass soil microbial communities from Rothamsted Park, UK - July 2010 direct MP BIO 1O1 lysis soil at the rocks surface 0-21cm | Environmental | Open in IMG/M |
| 3300001661 | Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly) | Environmental | Open in IMG/M |
| 3300002183 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-22A | Environmental | Open in IMG/M |
| 3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
| 3300003505 | Forest soil microbial communities from Harvard Forest LTER, USA - Combined assembly of forest soil metaG samples (ASSEMBLY_DATE=20140924) | Environmental | Open in IMG/M |
| 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
| 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Host-Associated | Open in IMG/M |
| 3300004153 | Grasslands soil microbial communities from Hopland, California, USA (version 2) | Environmental | Open in IMG/M |
| 3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
| 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
| 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005511 | Combined assembly of arab plate scrape MF_Col (Combined Assembly) | Host-Associated | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005598 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 | Environmental | Open in IMG/M |
| 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Host-Associated | Open in IMG/M |
| 3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
| 3300006034 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
| 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) | Host-Associated | Open in IMG/M |
| 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Host-Associated | Open in IMG/M |
| 3300007258 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 | Environmental | Open in IMG/M |
| 3300007819 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-1-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009083 | Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - MAT-04 (megahit assembly) | Environmental | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Host-Associated | Open in IMG/M |
| 3300010042 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010045 | Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010326 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Wat_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010333 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_40cm_2_24_1 metaG | Environmental | Open in IMG/M |
| 3300010337 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09082015 | Environmental | Open in IMG/M |
| 3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
| 3300011271 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4B metaG | Environmental | Open in IMG/M |
| 3300012189 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4A metaG | Environmental | Open in IMG/M |
| 3300012202 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaG | Environmental | Open in IMG/M |
| 3300012207 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_115_16 metaG | Environmental | Open in IMG/M |
| 3300012209 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_80_16 metaG | Environmental | Open in IMG/M |
| 3300012349 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Sage2_R_115_16 metaG | Environmental | Open in IMG/M |
| 3300012354 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_60_16 metaG | Environmental | Open in IMG/M |
| 3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012361 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_60_16 metaG | Environmental | Open in IMG/M |
| 3300012363 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4A metaG | Environmental | Open in IMG/M |
| 3300012683 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaG | Environmental | Open in IMG/M |
| 3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
| 3300012891 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S148-409B-2 | Environmental | Open in IMG/M |
| 3300012912 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S163-409C-2 | Environmental | Open in IMG/M |
| 3300012915 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S103-311B-2 | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012977 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Glu_20cm_5_24_1 metaG | Environmental | Open in IMG/M |
| 3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
| 3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
| 3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
| 3300014169 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaG | Environmental | Open in IMG/M |
| 3300014322 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 | Environmental | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014655 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_10_metaG | Environmental | Open in IMG/M |
| 3300014829 | Permafrost microbial communities from Nunavut, Canada - A10_35cm_6M | Environmental | Open in IMG/M |
| 3300014838 | Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300015053 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
| 3300015160 | Arctic soil microbial communities from a glacier forefield, Russell Glacier, Kangerlussuaq, Greenland (Sample G7C, Adjacent to main proglacial river, mid transect (Watson river)) | Environmental | Open in IMG/M |
| 3300015201 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S014-104B-1 (version 2) | Environmental | Open in IMG/M |
| 3300015242 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Host-Associated | Open in IMG/M |
| 3300015264 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
| 3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
| 3300017657 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_09212015 | Environmental | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017966 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MG | Environmental | Open in IMG/M |
| 3300018024 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100 | Environmental | Open in IMG/M |
| 3300018043 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10 | Environmental | Open in IMG/M |
| 3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300019889 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2 | Environmental | Open in IMG/M |
| 3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300021170 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-M | Environmental | Open in IMG/M |
| 3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
| 3300021363 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2 | Environmental | Open in IMG/M |
| 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Host-Associated | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
| 3300022720 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022756 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1 | Environmental | Open in IMG/M |
| 3300022908 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L221-509R-5 | Environmental | Open in IMG/M |
| 3300023058 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2m1 | Environmental | Open in IMG/M |
| 3300023272 | Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L171-409R-4 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025479 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-3 shallow-092012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025533 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-1 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026057 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - WestPond_CattailA_D1 (SPAdes) | Environmental | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026304 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026331 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes) | Environmental | Open in IMG/M |
| 3300026489 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-A | Environmental | Open in IMG/M |
| 3300026524 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_150 (SPAdes) | Environmental | Open in IMG/M |
| 3300026548 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_155 (SPAdes) | Environmental | Open in IMG/M |
| 3300027439 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM3_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027496 | Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028047 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes) | Environmental | Open in IMG/M |
| 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028536 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Hybrid Assembly) | Environmental | Open in IMG/M |
| 3300028782 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_193 | Environmental | Open in IMG/M |
| 3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300029911 | III_Bog_N2 coassembly | Environmental | Open in IMG/M |
| 3300029988 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3 | Environmental | Open in IMG/M |
| 3300029990 | I_Fen_N2 coassembly | Environmental | Open in IMG/M |
| 3300030050 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E2_4 | Environmental | Open in IMG/M |
| 3300030051 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2 | Environmental | Open in IMG/M |
| 3300030114 | I_Fen_E2 coassembly | Environmental | Open in IMG/M |
| 3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
| 3300030339 | III_Bog_N1 coassembly | Environmental | Open in IMG/M |
| 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Host-Associated | Open in IMG/M |
| 3300031232 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_3 | Environmental | Open in IMG/M |
| 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Host-Associated | Open in IMG/M |
| 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
| 3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
| 3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
| 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Host-Associated | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031847 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D4 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031943 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D2 | Environmental | Open in IMG/M |
| 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Host-Associated | Open in IMG/M |
| 3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
| 3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
| 3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
| 3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
| 3300032515 | FICUS49499 Metatranscriptome Czech Republic combined assembly (additional data) | Environmental | Open in IMG/M |
| 3300033433 | Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF15MN | Environmental | Open in IMG/M |
| 3300034159 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_0210_18 | Environmental | Open in IMG/M |
| 3300034170 | Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16 | Environmental | Open in IMG/M |
| 3300034177 | Sediment microbial communities from East River floodplain, Colorado, United States - 17_j17 | Environmental | Open in IMG/M |
| 3300034268 | Forest soil microbial communities from Eldorado National Forest, California, USA - SNFC_MG_FRD_1.2 | Environmental | Open in IMG/M |
| 3300034669 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8R3 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| OU_01553530 | 2124908016 | MIRMVMMALPTTTKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT | |
| N57_04596000 | 2170459013 | Grass Soil | MMALPTTTNGLRARSDRLGGGGTCSGSNAARGLRGEMGGLSVIDAT |
| JGI12053J15887_100870943 | 3300001661 | Forest Soil | RARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| JGI12053J15887_104249521 | 3300001661 | Forest Soil | ARSERFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| JGI24145J26757_100504102 | 3300002183 | Arctic Peat Soil | RARSERFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| JGI25612J43240_10250491 | 3300002886 | Grasslands Soil | TTTKGLRARSDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT* |
| JGIcombinedJ51221_104744802 | 3300003505 | Forest Soil | IALPTTMNGLRARSDRLGGGGTCSGSNAARGLLGEMGGLSLIDAT* |
| JGI25404J52841_100158061 | 3300003659 | Tabebuia Heterophylla Rhizosphere | MALPTTTKGLRARSDRLGGGGTCSGSNAARGLRGEMGGLSLIDAT* |
| Ga0055524_10451311 | 3300003775 | Arabidopsis Root | VMMALPTTTNGLRARSDRFGGGGSCSGSSAARGLRGEMGGLSLIETT* |
| Ga0063455_1012904701 | 3300004153 | Soil | NGLRARSERFGGGGTCSGSKAARGLLGEIGALSLIDATRILAGSMVSPVR* |
| Ga0062589_1010775352 | 3300004156 | Soil | TMTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0068868_1019126541 | 3300005338 | Miscanthus Rhizosphere | TMNGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0070688_1016855291 | 3300005365 | Switchgrass Rhizosphere | ALPTTTNGLRARSDRFGGGGSCSGSSAARGLRGEMGGLSLIEAT* |
| Ga0070705_1011211482 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | APIIRMIRIVMMALPTTTKGLRARSDRLGGGGTCSGSNAARGLRGEMGGLSLIDAT* |
| Ga0070662_1001257461 | 3300005457 | Corn Rhizosphere | VMMALPTTTKGLRARSDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT* |
| Ga0077121_102714631 | 3300005511 | Arabidopsis Rhizosphere | LRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIEAT* |
| Ga0070665_1010718502 | 3300005548 | Switchgrass Rhizosphere | KGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIEAT* |
| Ga0066706_102202121 | 3300005598 | Soil | LRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0068870_113216182 | 3300005840 | Miscanthus Rhizosphere | TTNGFRARSDRFSGGGTCSGSSAARGLRGEMGGLSLIDATWFLPV* |
| Ga0066789_103054071 | 3300005994 | Soil | LPKTTNGLRARADRFGGGGTRSGSSAARGLLGEMGGLSLIDVT* |
| Ga0066656_102255271 | 3300006034 | Soil | GLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0075029_1009624571 | 3300006052 | Watersheds | LRARSDRRGGGGTCSGSSAARGLLGEMGGLSLIDAT* |
| Ga0075015_1010177252 | 3300006102 | Watersheds | LPMITNGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSVIDAT* |
| Ga0097621_1009239512 | 3300006237 | Miscanthus Rhizosphere | TTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0099825_10298511 | 3300006941 | Root Nodules | GLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIEAT* |
| Ga0099793_101552341 | 3300007258 | Vadose Zone Soil | TTVMIALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0104322_1075262 | 3300007819 | Permafrost Soil | ITTNGLRARSDRFGGGGTCSGSSAARGLLGEMGGLSLIDAT* |
| Ga0105047_1000000865 | 3300009083 | Freshwater | MALPMMTNGLRARSDRFGGGGSCSGSSAARGLLGEIGGLSLINAT* |
| Ga0105247_102772722 | 3300009101 | Switchgrass Rhizosphere | MIRMVMMALPTMTNGLRARSDSYGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0105247_114970842 | 3300009101 | Switchgrass Rhizosphere | AAIMQIRMMVMMALPTTTKGFRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0066709_1008380682 | 3300009137 | Grasslands Soil | ALPMTTKGLRARSERLGGGGTCSGSNAARGLRGEMGGLSLIDAT* |
| Ga0066709_1017585451 | 3300009137 | Grasslands Soil | ARSDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT* |
| Ga0066709_1033072401 | 3300009137 | Grasslands Soil | IALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0075423_107135291 | 3300009162 | Populus Rhizosphere | TNGLRARSERFGGGGTCSGSSAARGLRGEMGGLSLIDATWFLPVQS* |
| Ga0105241_110111961 | 3300009174 | Corn Rhizosphere | NGLRARSDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT* |
| Ga0105242_131872682 | 3300009176 | Miscanthus Rhizosphere | PAAIMQIRKMVMMALPTTTKGFRARSDRLGGGGTCSGASAARGLRGEMGGLSLIDAT* |
| Ga0105237_125803832 | 3300009545 | Corn Rhizosphere | MQIRKMVMMALPTTTKGFRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0105238_102089263 | 3300009551 | Corn Rhizosphere | RSKVMMALPTTTKGLRARSERFGGGGTCSGSSAARGLRGEMGGLSLIEAT* |
| Ga0126314_108800252 | 3300010042 | Serpentine Soil | GLRARSDRFGGGGSCSGSNAARGLRGEMGGLSLIDTT* |
| Ga0126380_103109721 | 3300010043 | Tropical Forest Soil | MPIIEISTIVMMALPTMTKGLRARSERLGGGGTFSGSNAARGLRGEMGGLSLIDAT* |
| Ga0126311_112483292 | 3300010045 | Serpentine Soil | TNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0126382_106236491 | 3300010047 | Tropical Forest Soil | IIKTSTIVMMALPTTTNGLRARSERLGGGGTFSGSNAARGLRGEMGGL* |
| Ga0126373_124638221 | 3300010048 | Tropical Forest Soil | KGLRARSERFGGGGTCSGSSAARGLRGEMGGLSLIDATWILSL* |
| Ga0134065_102241602 | 3300010326 | Grasslands Soil | VMIALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLINAT* |
| Ga0134080_100616321 | 3300010333 | Grasslands Soil | ARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0134062_100232081 | 3300010337 | Grasslands Soil | LPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGDLSLIDAT* |
| Ga0126372_112753672 | 3300010360 | Tropical Forest Soil | IALPTMINGLRARSDRRGGGTCSGSSAARGLRGEMGGRSLIDAT* |
| Ga0134125_114604032 | 3300010371 | Terrestrial Soil | VMMALPTTTKGLRARSERFGGGGTCSGSSAARGLRGEMGGLSLIEAT* |
| Ga0105239_113216012 | 3300010375 | Corn Rhizosphere | LPTTTKGLRARSERLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0134126_115368262 | 3300010396 | Terrestrial Soil | AITSGLRTRAERFGGGGTCSGSSAARGLRGEMGGLSLIDVT* |
| Ga0105246_111323331 | 3300011119 | Miscanthus Rhizosphere | IVMMALPTTTKGLRARSDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT* |
| Ga0137391_103788261 | 3300011270 | Vadose Zone Soil | LRARSDRFGGGGTCSGSSAARGIRGEMGGLSLIDAT* |
| Ga0137393_116949041 | 3300011271 | Vadose Zone Soil | TTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137388_110167732 | 3300012189 | Vadose Zone Soil | ALPKTTNGLRARADRFGGGGTRSGSSAARGLLGEMGGLSLIDAT* |
| Ga0137363_101207231 | 3300012202 | Vadose Zone Soil | IPTSRIVMMALPTTTNGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137363_105383992 | 3300012202 | Vadose Zone Soil | IKANTIVMMALPTTTNGLRARSDRFGGGGTCSGSNATRGLRGEMGGLSLIDAT* |
| Ga0137363_112718532 | 3300012202 | Vadose Zone Soil | AAPTPIIETSTTVMIALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137381_107879121 | 3300012207 | Vadose Zone Soil | NSVMMALPTTTKGLRARSERFGGGGTCSGSSAARGLRGEMGGLSLIEAT* |
| Ga0137379_103400162 | 3300012209 | Vadose Zone Soil | RARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDTT* |
| Ga0137387_106947922 | 3300012349 | Vadose Zone Soil | GLRARSERLGGGGTCSGSSAARGLRGEMGGLSLIDTT* |
| Ga0137366_106234012 | 3300012354 | Vadose Zone Soil | MALSPTTNGLLARYERFGGGGTRSGSSAARRLLGEMGGLSLIDAT* |
| Ga0137371_112140702 | 3300012356 | Vadose Zone Soil | VMIALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137385_101973292 | 3300012359 | Vadose Zone Soil | VMMALPTTTNGLRARSDRFGGGGTCSGSSAARGRLGEMGGLSLIDAT* |
| Ga0137360_105589061 | 3300012361 | Vadose Zone Soil | VMMALPTTTNGLRARSDRRGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137360_112333132 | 3300012361 | Vadose Zone Soil | GLRARSDRRGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137360_117476332 | 3300012361 | Vadose Zone Soil | PIIETSTMVMIALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137390_109146801 | 3300012363 | Vadose Zone Soil | TALPKTTNGLRARADRFGGGGTRSGSSAARGLLGEMGGLSLIDVT* |
| Ga0137398_104655601 | 3300012683 | Vadose Zone Soil | LPMTTKGLRARAERRGGGGTFSGSNAARGLRGEMGGLSLIDAT* |
| Ga0137397_107560332 | 3300012685 | Vadose Zone Soil | VIMALPTTTNGLRARSERFGGGGTRSGSSAARGLLGEMGGLSLIDAT* |
| Ga0137397_109901012 | 3300012685 | Vadose Zone Soil | MYAPPPPIMTTNMIVMIALPTTTKGLRARSDRLGGGGTCSGSSAARGDLGEMGGLSLIDAT* |
| Ga0157305_102114212 | 3300012891 | Soil | MMALPITTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDATWFLPV* |
| Ga0157306_100554521 | 3300012912 | Soil | RMVMMALPTTTKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0157302_103264191 | 3300012915 | Soil | NGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137413_102947692 | 3300012924 | Vadose Zone Soil | RARSERFGGGGTCSGSSAARGLRGDMGGLSLIDAT* |
| Ga0137413_103273362 | 3300012924 | Vadose Zone Soil | PTTTKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137413_107909952 | 3300012924 | Vadose Zone Soil | MALPTTTNGLRARSDRFGGGGTCSGSSAARALRGEMGGLSLIDAT* |
| Ga0137416_118772901 | 3300012927 | Vadose Zone Soil | STIVMIALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137404_114902792 | 3300012929 | Vadose Zone Soil | SIATRMMVMIALPAMTSGLRARAERLSGGGTCAGSKAARGLLGEMGGLSLIDAT* |
| Ga0164300_100971301 | 3300012951 | Soil | TTKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0164298_110029962 | 3300012955 | Soil | APPSPTINMSTIVMMALPATIHGLRARADRFGGGGTCSGSSAARGLRGEMGGLSLIGAT* |
| Ga0164303_105340071 | 3300012957 | Soil | TMVITALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0164302_117125392 | 3300012961 | Soil | IMVMMALPAITSGLRARSDRFGGGGTCSGSSAARGLLGEMGGLSLIDAT* |
| Ga0134087_106602962 | 3300012977 | Grasslands Soil | RVMMALPAMTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIEAT* |
| Ga0164309_109112961 | 3300012984 | Soil | KGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDVT* |
| Ga0164304_101373782 | 3300012986 | Soil | TALPNTTSGLRARSERFGGGGTCSGSSAARGLRGDMGGLSLIDAT* |
| Ga0164304_105102831 | 3300012986 | Soil | PTPIIKTSTMVMMALPTTTNGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0157374_123235642 | 3300013296 | Miscanthus Rhizosphere | MALPTMTNGLRARSDRFGGGGTCSGSSAARGLRGEIGGLSLIDAT* |
| Ga0157378_104411381 | 3300013297 | Miscanthus Rhizosphere | IRMVMMALPTTTKGLRARSERLGGGGTCSGSNAARGLRGEMGGLSLIDAT* |
| Ga0157378_112361252 | 3300013297 | Miscanthus Rhizosphere | NVMMALPTTTKGLRARSERFGVGGTCSGSSAARGVRGEMGGLSLIEAT* |
| Ga0157378_120357841 | 3300013297 | Miscanthus Rhizosphere | AIRRMVMMALPTTMKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0157372_116076862 | 3300013307 | Corn Rhizosphere | RARSERLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0157375_124186642 | 3300013308 | Miscanthus Rhizosphere | APIIRMIRMVMMALPTTTKGLRARSDRLGGGGTCSGSNAARGLRGEMGGLSLIDAT* |
| Ga0120125_11824052 | 3300014056 | Permafrost | MYAPPAPIIKTNTMVIMALPITTNGLRARSDRLGGGGTCSGSSAARGLLGEMGGLSLIDAT* |
| Ga0181538_105787412 | 3300014162 | Bog | LRARSDRLGGGGTCSGSSAARGDLGEMGGLSLIDAT* |
| Ga0181532_100713451 | 3300014164 | Bog | PMPIINTSTTVIIALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0181531_102232161 | 3300014169 | Bog | MTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLMDAT* |
| Ga0075355_10922251 | 3300014322 | Natural And Restored Wetlands | TTVIMALPTTTNGFRARSDRLGGGGSCSGSSAARGLRGEMGGLTLIDAT* |
| Ga0163163_102469063 | 3300014325 | Switchgrass Rhizosphere | LPTITKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIEAT* |
| Ga0157380_124644491 | 3300014326 | Switchgrass Rhizosphere | TKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0181516_101774631 | 3300014655 | Bog | ALPTTTNGLRARSERFGGGGTCSGSSAARGLLGEMGGLSLIDAT* |
| Ga0120104_10964742 | 3300014829 | Permafrost | TKGLRARSDRFGGGGTCSGSSAARGLLGEMGGLSLIDAT* |
| Ga0182030_108549981 | 3300014838 | Bog | MVMTALPKTTNGLRARSERFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0137405_13987044 | 3300015053 | Vadose Zone Soil | MVIMALPTTTNGLRAAFGALRRAAGPLGSSAARGLLGEMGGLSLIDAT* |
| Ga0167642_10077381 | 3300015160 | Glacier Forefield Soil | PTTTNGLRARSDLLGGGGTCSGSSAARGDRGEMGGLSLIDAT* |
| Ga0173478_100252721 | 3300015201 | Soil | STIVMMALPTMTNGLRARSERFGGGGTCSGSSAARGLRGEMGGLSLIDATWFLPV* |
| Ga0137412_102571423 | 3300015242 | Vadose Zone Soil | LPTMTNGLRARSDRFGGGGTCSGSSAARGLLGEMGGLSLIDAT* |
| Ga0137412_106049201 | 3300015242 | Vadose Zone Soil | LPTMTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLINAT* |
| Ga0182007_102145762 | 3300015262 | Rhizosphere | RARSDRLGGGGTCSGSSAARGLRGEMGGLSLIEAT* |
| Ga0137403_102701463 | 3300015264 | Vadose Zone Soil | RPAPIISTSTIVMIALPMTTKGLRARSERLGGGGTCSGSNAARGLRGEMGGRSLIDAT* |
| Ga0134085_101357962 | 3300015359 | Grasslands Soil | GNAIIRMIRMVMMALPTTTKGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT* |
| Ga0182035_110988812 | 3300016341 | Soil | IKTSTIVMMALPTTTNGLRARSERFGGGGTFSGSNAARGLRGEMGGL |
| Ga0134074_11891052 | 3300017657 | Grasslands Soil | LPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0163161_108801311 | 3300017792 | Switchgrass Rhizosphere | TTTNGLRARSERLGGGGNCSGSSAARGLRGEMGGLSLIDAT |
| Ga0187776_113556541 | 3300017966 | Tropical Peatland | PNTMNGLRARSDRRGGGGTFSGSSAARGLRGEMGGLSLIDAT |
| Ga0187881_103847502 | 3300018024 | Peatland | MIALPAITNGLRARSDRFGGGGTCSGSSAARGLLGEMGGLSLIDAT |
| Ga0187887_100499951 | 3300018043 | Peatland | GLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLMDAT |
| Ga0190272_118857572 | 3300018429 | Soil | PTTTKGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0190274_133481831 | 3300018476 | Soil | TKGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0193743_10137272 | 3300019889 | Soil | MMALPTTTNGLRARSDRFGGGGTCSGSSAARGLLGEMGGLSLIDAT |
| Ga0179596_102391821 | 3300021086 | Vadose Zone Soil | PTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0210400_109707652 | 3300021170 | Soil | TTTNGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0210405_1001258110 | 3300021171 | Soil | RARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0193699_103163832 | 3300021363 | Soil | ALPTMTNGLRARSDRLGGGGTCSGSSAARGLLGEMGGLSLIDAT |
| Ga0213876_107841571 | 3300021384 | Plant Roots | LRARSERFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0210393_108992332 | 3300021401 | Soil | LRARSERFGGVGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0210393_115968041 | 3300021401 | Soil | GLRARSERCGGGGTCSGSSAARGLLGEMGGLSLIDAT |
| Ga0210383_109367891 | 3300021407 | Soil | LPTTTNGLRARSDRRGGGGTCSGSSAARGLRGEIGGLSLIDAT |
| Ga0210383_116647091 | 3300021407 | Soil | LRARSDRLGGGGTCSGSNAARGLLGEMGGLSLIDAT |
| Ga0242672_10995131 | 3300022720 | Soil | NGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0222622_101976812 | 3300022756 | Groundwater Sediment | GLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0247779_10094745 | 3300022908 | Plant Litter | MNGLRARSERFGGGGTCSGSSAARGLLGEIGGLSLIDAT |
| Ga0193714_10158972 | 3300023058 | Soil | LRARSERFGGGGTRSGSSAARGLLGEMGGLSLIDAT |
| Ga0247760_10606261 | 3300023272 | Plant Litter | RARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0207656_103192572 | 3300025321 | Corn Rhizosphere | PITTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0208588_10794561 | 3300025479 | Arctic Peat Soil | KMTKGLRARSERRGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0208584_10451621 | 3300025533 | Arctic Peat Soil | RTKMMVMTALPTTTNGLRARSERFGGGGTCSGSNAARGLLGEMGGLSLIDAT |
| Ga0207688_105892622 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | RMVMMALPTTTKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDT |
| Ga0207680_106493801 | 3300025903 | Switchgrass Rhizosphere | IIRMIRIVMMALPTTTKGLRARSDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0207681_114704131 | 3300025923 | Switchgrass Rhizosphere | PTTTKGLRARSDRLGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0207694_100705291 | 3300025924 | Corn Rhizosphere | TTKGLRARSDRFGGGGTCSGSSAARGLLGEMGGLSLIDAI |
| Ga0207694_105931861 | 3300025924 | Corn Rhizosphere | TTKGLRARSERLGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0207650_102929661 | 3300025925 | Switchgrass Rhizosphere | APIIRIIRMVMMALPTTTKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0207650_103387602 | 3300025925 | Switchgrass Rhizosphere | TTTKGLRARCDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0207687_115614711 | 3300025927 | Miscanthus Rhizosphere | PTTTKGLRARSDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0207664_103113881 | 3300025929 | Agricultural Soil | MTAWPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0207686_108182381 | 3300025934 | Miscanthus Rhizosphere | TKGLRARSDRLGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0207670_104378091 | 3300025936 | Switchgrass Rhizosphere | RARSDRLGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0207667_108214191 | 3300025949 | Corn Rhizosphere | STIVMTALPATIHGLRARADRFGGGGTCSGSSAARGLRGEMGGLSLIGAT |
| Ga0207712_102428352 | 3300025961 | Switchgrass Rhizosphere | TKGLRARSDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0208294_10044691 | 3300026057 | Natural And Restored Wetlands | FRARSDRLGGGGSCSGSSAARGLRGEMGGLTLIDAT |
| Ga0207648_110155191 | 3300026089 | Miscanthus Rhizosphere | VMMALPTTTKGLRARSDRLGGGGTCSGSNAARGLRGEMGGLSLIGAT |
| Ga0209240_10420332 | 3300026304 | Grasslands Soil | MVMIALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0209240_11290251 | 3300026304 | Grasslands Soil | TNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0209240_11605532 | 3300026304 | Grasslands Soil | TTTNGLRARSERFGGGGTRSGSSAARGLLGEMGGLSLIDAT |
| Ga0209240_12220891 | 3300026304 | Grasslands Soil | MVMTALPKTTNGLRARADRFGGGGTRSGSSAARGLLGEMGGLSLIDVT |
| Ga0209267_11420422 | 3300026331 | Soil | MIALPTTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIHAT |
| Ga0257160_10228041 | 3300026489 | Soil | TTTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0209690_11265931 | 3300026524 | Soil | ALPTTTKGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0209161_105357511 | 3300026548 | Soil | TTNGFRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDVT |
| Ga0209332_10098283 | 3300027439 | Forest Soil | LRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0208987_10749952 | 3300027496 | Forest Soil | LRARSDLRGGGGTCSGSSAARGDRGEMGGLSLIDAT |
| Ga0209526_101406523 | 3300028047 | Forest Soil | KGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0268264_118208591 | 3300028381 | Switchgrass Rhizosphere | PTTTKGLRARSERLGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0137415_114469201 | 3300028536 | Vadose Zone Soil | RARSDRFGGGGTCSGSSAARGLRGEMGGLSLIEAT |
| Ga0307306_101687971 | 3300028782 | Soil | LPTMTNGLRARTDRIGGGGTCSGSSAARGLLGEMGGLSLIDAT |
| Ga0222749_103260221 | 3300029636 | Soil | RARSDRFGGGGTCSGSSAARGLRGEMGGRSLIDAT |
| Ga0311361_109808151 | 3300029911 | Bog | RARSDRLGGGGTCSGSSAARGLLGEMGGLSLIDAT |
| Ga0302190_101048741 | 3300029988 | Bog | TNGLRARSERFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0311336_103312711 | 3300029990 | Fen | MMALPTMTNGLRARSDRLGGGGTCSGSNAARGLLGEIGGLSLIDAT |
| Ga0302255_10772122 | 3300030050 | Fen | MVMMALPTMTNGLRARYDRRGGGGTCSGSSAALGLRGEMGGLSVIDAT |
| Ga0302195_104918102 | 3300030051 | Bog | GLRARSERFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0311333_114280291 | 3300030114 | Fen | PTITNGLRARSDRLGGGGSCSGSSAARGLRGEMGGLSLIDAT |
| Ga0311349_106970791 | 3300030294 | Fen | NGLRARSDRLGGGGTCSGSNAARGLLGEMGGLSLIDAT |
| Ga0311360_112369032 | 3300030339 | Bog | NGLRARSERFGGGGTCSGSSAARGLLGEMGGLSLIDAT |
| Ga0307512_104036591 | 3300030522 | Ectomycorrhiza | GLRARSDRFGGGGTCSGSSAARGLLGDMGGRSLIDAT |
| Ga0302323_1004345622 | 3300031232 | Fen | MTNGLRARSDRLGGGGTCSGSNAARGLLGEMGGLSLIDAT |
| Ga0265332_101841762 | 3300031238 | Rhizosphere | KGLRARSERRGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0307513_103006252 | 3300031456 | Ectomycorrhiza | PTMTNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0307513_107718981 | 3300031456 | Ectomycorrhiza | TKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0302326_129060361 | 3300031525 | Palsa | RARSDRLGGGGTCSGSSAARGDRGEMGGLSLIDAT |
| Ga0310915_109277531 | 3300031573 | Soil | KTSTIVMMALPTTTNGLRARSERLGGGGTFSGSNAARGLRGEMGGL |
| Ga0318542_104675502 | 3300031668 | Soil | MMALPTTTNGLRARSERFGGGGTFSGSNAARGLRGEMGGL |
| Ga0307474_113047102 | 3300031718 | Hardwood Forest Soil | MVMTALPITTNGLRARSERFGGGGTCSGSSAARGLLGEMGGLSLIDAT |
| Ga0307516_105243402 | 3300031730 | Ectomycorrhiza | TTKGLRARSDRLGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0307475_102071191 | 3300031754 | Hardwood Forest Soil | LRARSERLGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0318497_105113291 | 3300031805 | Soil | RARSERLGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0307473_109210842 | 3300031820 | Hardwood Forest Soil | SERLGGGGTCSGSSAARGLRGEMGGLSLIDATWFLPVQS |
| Ga0310907_101624032 | 3300031847 | Soil | LPTTTKGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0306925_101547971 | 3300031890 | Soil | TITNGLRARSDRRGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0318520_110484362 | 3300031897 | Soil | IVKTALPNTTKGLRARSDRRGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0310885_107923341 | 3300031943 | Soil | RARSDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0307411_109510871 | 3300032005 | Rhizosphere | TTTKGLRARSDRRGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0310895_104278511 | 3300032122 | Soil | TTTNGLRARSDRLGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0307470_108894631 | 3300032174 | Hardwood Forest Soil | ALPTTTKGLRARSDRLGGGGTFSGSSAARGLRGEMGGLSLIDAT |
| Ga0307471_1024133442 | 3300032180 | Hardwood Forest Soil | TTKGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| Ga0306920_1025481742 | 3300032261 | Soil | KGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLIEAT |
| Ga0348332_143861032 | 3300032515 | Plant Litter | TNGLRARSDRFGGGGTCSGSSAARGLRGEMGGLSLMDAT |
| Ga0326726_104477292 | 3300033433 | Peat Soil | MNSTTVMMALPTTTNGLRARSDRLGGGGTFSGSSAARGLLGEMGGLSLIDAT |
| Ga0370509_0292938_472_591 | 3300034159 | Untreated Peat Soil | TQGLRARSDRFGGGGTCSGSSAARGLLGEIGGLSLIGAT |
| Ga0370487_0102037_2_142 | 3300034170 | Untreated Peat Soil | MMALPTTTKGLRARSDRRGGGGSCSGSSAARGLRGEMGGLSLIDAT |
| Ga0364932_0296407_469_609 | 3300034177 | Sediment | MMALPTTTKGLRARSDRFGGGGTCSGSNAARGLRGEMGGLSLIDAT |
| Ga0372943_0782366_2_139 | 3300034268 | Soil | MALPTTTKGLRARSERFGGGGTCSGSSAARGLRGEMGGLSLIEAT |
| Ga0314794_170579_4_150 | 3300034669 | Soil | MVMMALPTTTKGLRARSDRLGGGGTCSGSSAARGLRGEMGGLSLIDAT |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |