| Basic Information | |
|---|---|
| Family ID | F024971 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 203 |
| Average Sequence Length | 53 residues |
| Representative Sequence | VDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG |
| Number of Associated Samples | 122 |
| Number of Associated Scaffolds | 203 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 50.74 % |
| % of genes near scaffold ends (potentially truncated) | 26.60 % |
| % of genes from short scaffolds (< 2000 bps) | 95.07 % |
| Associated GOLD sequencing projects | 105 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.30 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (50.246 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (13.793 % of family members) |
| Environment Ontology (ENVO) | Unclassified (52.709 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (78.325 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 7.89% Coil/Unstructured: 92.11% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.30 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 203 Family Scaffolds |
|---|---|---|
| PF04679 | DNA_ligase_A_C | 10.34 |
| PF01068 | DNA_ligase_A_M | 4.43 |
| PF13396 | PLDc_N | 3.94 |
| PF13649 | Methyltransf_25 | 3.45 |
| PF00916 | Sulfate_transp | 2.96 |
| PF13563 | 2_5_RNA_ligase2 | 1.48 |
| PF02371 | Transposase_20 | 0.99 |
| PF01022 | HTH_5 | 0.99 |
| PF14329 | DUF4386 | 0.99 |
| PF01610 | DDE_Tnp_ISL3 | 0.99 |
| PF09851 | SHOCT | 0.99 |
| PF12867 | DinB_2 | 0.99 |
| PF05175 | MTS | 0.49 |
| PF01408 | GFO_IDH_MocA | 0.49 |
| PF13551 | HTH_29 | 0.49 |
| PF13546 | DDE_5 | 0.49 |
| PF02887 | PK_C | 0.49 |
| PF13424 | TPR_12 | 0.49 |
| PF12840 | HTH_20 | 0.49 |
| PF13340 | DUF4096 | 0.49 |
| PF13676 | TIR_2 | 0.49 |
| PF04545 | Sigma70_r4 | 0.49 |
| PF02894 | GFO_IDH_MocA_C | 0.49 |
| PF02219 | MTHFR | 0.49 |
| PF00872 | Transposase_mut | 0.49 |
| PF01740 | STAS | 0.49 |
| PF08388 | GIIM | 0.49 |
| PF05762 | VWA_CoxE | 0.49 |
| PF00561 | Abhydrolase_1 | 0.49 |
| PF01494 | FAD_binding_3 | 0.49 |
| PF13586 | DDE_Tnp_1_2 | 0.49 |
| PF07859 | Abhydrolase_3 | 0.49 |
| PF00873 | ACR_tran | 0.49 |
| PF00206 | Lyase_1 | 0.49 |
| PF00425 | Chorismate_bind | 0.49 |
| PF12847 | Methyltransf_18 | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 203 Family Scaffolds |
|---|---|---|---|
| COG1793 | ATP-dependent DNA ligase | Replication, recombination and repair [L] | 14.78 |
| COG1423 | ATP-dependent RNA circularization protein, DNA/RNA ligase (PAB1020) family | Replication, recombination and repair [L] | 4.43 |
| COG0659 | Sulfate permease or related transporter, MFS superfamily | Inorganic ion transport and metabolism [P] | 2.96 |
| COG2233 | Xanthine/uracil permease | Nucleotide transport and metabolism [F] | 2.96 |
| COG2252 | Xanthine/guanine/uracil/vitamin C permease GhxP/GhxQ, nucleobase:cation symporter 2 ( NCS2) family | Nucleotide transport and metabolism [F] | 2.96 |
| COG0654 | 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases | Energy production and conversion [C] | 0.99 |
| COG3464 | Transposase | Mobilome: prophages, transposons [X] | 0.99 |
| COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.99 |
| COG0469 | Pyruvate kinase | Carbohydrate transport and metabolism [G] | 0.49 |
| COG0578 | Glycerol-3-phosphate dehydrogenase | Energy production and conversion [C] | 0.49 |
| COG0644 | Dehydrogenase (flavoprotein) | Energy production and conversion [C] | 0.49 |
| COG0657 | Acetyl esterase/lipase | Lipid transport and metabolism [I] | 0.49 |
| COG0665 | Glycine/D-amino acid oxidase (deaminating) | Amino acid transport and metabolism [E] | 0.49 |
| COG0673 | Predicted dehydrogenase | General function prediction only [R] | 0.49 |
| COG0685 | 5,10-methylenetetrahydrofolate reductase | Amino acid transport and metabolism [E] | 0.49 |
| COG3328 | Transposase (or an inactivated derivative) | Mobilome: prophages, transposons [X] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 50.25 % |
| Unclassified | root | N/A | 49.75 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300002568|C688J35102_119176779 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 650 | Open in IMG/M |
| 3300002568|C688J35102_119418024 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 691 | Open in IMG/M |
| 3300002568|C688J35102_120309100 | Not Available | 982 | Open in IMG/M |
| 3300004081|Ga0063454_100049212 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1663 | Open in IMG/M |
| 3300004081|Ga0063454_100717198 | Not Available | 757 | Open in IMG/M |
| 3300005093|Ga0062594_100910407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 832 | Open in IMG/M |
| 3300005327|Ga0070658_11173603 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
| 3300005327|Ga0070658_11517848 | Not Available | 581 | Open in IMG/M |
| 3300005328|Ga0070676_11071565 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → unclassified Kutzneria → Kutzneria sp. 744 | 608 | Open in IMG/M |
| 3300005329|Ga0070683_100371140 | Not Available | 1363 | Open in IMG/M |
| 3300005329|Ga0070683_100409379 | Not Available | 1293 | Open in IMG/M |
| 3300005329|Ga0070683_101261381 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 710 | Open in IMG/M |
| 3300005331|Ga0070670_100280744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 1454 | Open in IMG/M |
| 3300005337|Ga0070682_100296532 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1185 | Open in IMG/M |
| 3300005337|Ga0070682_101712900 | Not Available | 546 | Open in IMG/M |
| 3300005339|Ga0070660_101322624 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 612 | Open in IMG/M |
| 3300005340|Ga0070689_100737679 | Not Available | 862 | Open in IMG/M |
| 3300005347|Ga0070668_101707932 | Not Available | 578 | Open in IMG/M |
| 3300005354|Ga0070675_101124320 | Not Available | 722 | Open in IMG/M |
| 3300005356|Ga0070674_100100410 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2107 | Open in IMG/M |
| 3300005364|Ga0070673_100330321 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1349 | Open in IMG/M |
| 3300005365|Ga0070688_101764998 | Not Available | 507 | Open in IMG/M |
| 3300005366|Ga0070659_101019389 | Not Available | 727 | Open in IMG/M |
| 3300005436|Ga0070713_100205138 | Not Available | 1782 | Open in IMG/M |
| 3300005437|Ga0070710_11281112 | Not Available | 544 | Open in IMG/M |
| 3300005441|Ga0070700_101400196 | Not Available | 591 | Open in IMG/M |
| 3300005456|Ga0070678_100532608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1041 | Open in IMG/M |
| 3300005466|Ga0070685_10359424 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 998 | Open in IMG/M |
| 3300005535|Ga0070684_100197238 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1833 | Open in IMG/M |
| 3300005544|Ga0070686_101379303 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 591 | Open in IMG/M |
| 3300005548|Ga0070665_100188110 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2066 | Open in IMG/M |
| 3300005548|Ga0070665_100205836 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 1968 | Open in IMG/M |
| 3300005548|Ga0070665_100227388 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1865 | Open in IMG/M |
| 3300005548|Ga0070665_100330967 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1528 | Open in IMG/M |
| 3300005577|Ga0068857_100139279 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2193 | Open in IMG/M |
| 3300005578|Ga0068854_100345657 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia sediminis | 1216 | Open in IMG/M |
| 3300005578|Ga0068854_102200506 | Not Available | 510 | Open in IMG/M |
| 3300005614|Ga0068856_100266398 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1729 | Open in IMG/M |
| 3300005614|Ga0068856_102644824 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 507 | Open in IMG/M |
| 3300005618|Ga0068864_101380503 | Not Available | 706 | Open in IMG/M |
| 3300005618|Ga0068864_102645795 | Not Available | 507 | Open in IMG/M |
| 3300005719|Ga0068861_100468033 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1133 | Open in IMG/M |
| 3300005719|Ga0068861_101514452 | All Organisms → cellular organisms → Bacteria | 659 | Open in IMG/M |
| 3300005834|Ga0068851_10151059 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1270 | Open in IMG/M |
| 3300005841|Ga0068863_100392106 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1357 | Open in IMG/M |
| 3300005842|Ga0068858_101292812 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Corynebacteriales → Nocardiaceae | 718 | Open in IMG/M |
| 3300005843|Ga0068860_102062055 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 592 | Open in IMG/M |
| 3300005843|Ga0068860_102422788 | Not Available | 545 | Open in IMG/M |
| 3300005844|Ga0068862_102647456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 513 | Open in IMG/M |
| 3300006028|Ga0070717_11259148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia autotrophica | 673 | Open in IMG/M |
| 3300006806|Ga0079220_10139330 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1322 | Open in IMG/M |
| 3300006806|Ga0079220_10727256 | All Organisms → cellular organisms → Bacteria | 735 | Open in IMG/M |
| 3300006954|Ga0079219_10360213 | Not Available | 940 | Open in IMG/M |
| 3300006954|Ga0079219_10553973 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 825 | Open in IMG/M |
| 3300009011|Ga0105251_10161127 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1011 | Open in IMG/M |
| 3300009011|Ga0105251_10388566 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 640 | Open in IMG/M |
| 3300009094|Ga0111539_10468778 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1466 | Open in IMG/M |
| 3300009094|Ga0111539_10931228 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia sediminis | 1010 | Open in IMG/M |
| 3300009094|Ga0111539_12206160 | Not Available | 639 | Open in IMG/M |
| 3300009094|Ga0111539_12705499 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 575 | Open in IMG/M |
| 3300009098|Ga0105245_10217758 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae → Frankia → Frankia canadensis | 1841 | Open in IMG/M |
| 3300009098|Ga0105245_10256797 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → unclassified Pseudonocardiales → Pseudonocardiales bacterium | 1699 | Open in IMG/M |
| 3300009098|Ga0105245_12257789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 598 | Open in IMG/M |
| 3300009098|Ga0105245_12355284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 586 | Open in IMG/M |
| 3300009098|Ga0105245_13128884 | Not Available | 513 | Open in IMG/M |
| 3300009101|Ga0105247_10307830 | Not Available | 1101 | Open in IMG/M |
| 3300009101|Ga0105247_11846528 | Not Available | 504 | Open in IMG/M |
| 3300009148|Ga0105243_12224663 | Not Available | 585 | Open in IMG/M |
| 3300009156|Ga0111538_10440867 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1650 | Open in IMG/M |
| 3300009156|Ga0111538_11833372 | Not Available | 763 | Open in IMG/M |
| 3300009156|Ga0111538_12844095 | Not Available | 606 | Open in IMG/M |
| 3300009174|Ga0105241_10163804 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1830 | Open in IMG/M |
| 3300009174|Ga0105241_10975311 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 791 | Open in IMG/M |
| 3300009176|Ga0105242_12963617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 525 | Open in IMG/M |
| 3300009553|Ga0105249_12472729 | Not Available | 592 | Open in IMG/M |
| 3300009553|Ga0105249_12808828 | Not Available | 558 | Open in IMG/M |
| 3300010331|Ga0123336_10379148 | Not Available | 726 | Open in IMG/M |
| 3300010371|Ga0134125_12153240 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 606 | Open in IMG/M |
| 3300010373|Ga0134128_11519470 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 737 | Open in IMG/M |
| 3300010375|Ga0105239_11390194 | Not Available | 810 | Open in IMG/M |
| 3300010375|Ga0105239_11937350 | Not Available | 684 | Open in IMG/M |
| 3300010399|Ga0134127_13113102 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 541 | Open in IMG/M |
| 3300010400|Ga0134122_13049104 | Not Available | 523 | Open in IMG/M |
| 3300010400|Ga0134122_13079602 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 521 | Open in IMG/M |
| 3300010401|Ga0134121_12096878 | Not Available | 600 | Open in IMG/M |
| 3300011119|Ga0105246_10265045 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 1371 | Open in IMG/M |
| 3300011119|Ga0105246_10703132 | Not Available | 886 | Open in IMG/M |
| 3300011119|Ga0105246_10980138 | Not Available | 764 | Open in IMG/M |
| 3300011119|Ga0105246_10980751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 764 | Open in IMG/M |
| 3300011119|Ga0105246_11592896 | Not Available | 617 | Open in IMG/M |
| 3300011119|Ga0105246_11896176 | Not Available | 572 | Open in IMG/M |
| 3300011119|Ga0105246_12016369 | Not Available | 557 | Open in IMG/M |
| 3300012212|Ga0150985_102321766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1130 | Open in IMG/M |
| 3300012212|Ga0150985_102563463 | Not Available | 900 | Open in IMG/M |
| 3300012212|Ga0150985_102834256 | Not Available | 514 | Open in IMG/M |
| 3300012212|Ga0150985_104382903 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 771 | Open in IMG/M |
| 3300012212|Ga0150985_112092356 | Not Available | 561 | Open in IMG/M |
| 3300012212|Ga0150985_113794009 | Not Available | 509 | Open in IMG/M |
| 3300012212|Ga0150985_115046935 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 623 | Open in IMG/M |
| 3300012212|Ga0150985_119457102 | Not Available | 647 | Open in IMG/M |
| 3300012212|Ga0150985_122636971 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 559 | Open in IMG/M |
| 3300012469|Ga0150984_104489323 | Not Available | 729 | Open in IMG/M |
| 3300012469|Ga0150984_109135171 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 586 | Open in IMG/M |
| 3300012469|Ga0150984_113566069 | Not Available | 539 | Open in IMG/M |
| 3300012955|Ga0164298_10128573 | Not Available | 1388 | Open in IMG/M |
| 3300012955|Ga0164298_11543389 | Not Available | 520 | Open in IMG/M |
| 3300012957|Ga0164303_10869514 | Not Available | 628 | Open in IMG/M |
| 3300012961|Ga0164302_10051066 | All Organisms → cellular organisms → Bacteria | 2053 | Open in IMG/M |
| 3300012961|Ga0164302_11104756 | Not Available | 626 | Open in IMG/M |
| 3300012985|Ga0164308_12081871 | Not Available | 529 | Open in IMG/M |
| 3300012986|Ga0164304_11144383 | Not Available | 625 | Open in IMG/M |
| 3300012987|Ga0164307_10187512 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1397 | Open in IMG/M |
| 3300012987|Ga0164307_10398502 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1013 | Open in IMG/M |
| 3300012988|Ga0164306_10775262 | Not Available | 770 | Open in IMG/M |
| 3300012989|Ga0164305_10136299 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1643 | Open in IMG/M |
| 3300012989|Ga0164305_11004759 | Not Available | 709 | Open in IMG/M |
| 3300012989|Ga0164305_11988687 | Not Available | 530 | Open in IMG/M |
| 3300012989|Ga0164305_12216817 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 506 | Open in IMG/M |
| 3300013102|Ga0157371_10977501 | Not Available | 645 | Open in IMG/M |
| 3300013102|Ga0157371_11394406 | Not Available | 544 | Open in IMG/M |
| 3300013105|Ga0157369_11379671 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 718 | Open in IMG/M |
| 3300013105|Ga0157369_11617822 | Not Available | 658 | Open in IMG/M |
| 3300013105|Ga0157369_12051578 | Not Available | 580 | Open in IMG/M |
| 3300013296|Ga0157374_11194791 | Not Available | 782 | Open in IMG/M |
| 3300013297|Ga0157378_10401634 | All Organisms → cellular organisms → Bacteria | 1350 | Open in IMG/M |
| 3300013297|Ga0157378_13212838 | Not Available | 508 | Open in IMG/M |
| 3300013306|Ga0163162_10844166 | Not Available | 1031 | Open in IMG/M |
| 3300013306|Ga0163162_11148826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 881 | Open in IMG/M |
| 3300013307|Ga0157372_10242331 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales | 2092 | Open in IMG/M |
| 3300013307|Ga0157372_10653151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia alaniniphila | 1225 | Open in IMG/M |
| 3300013308|Ga0157375_10355685 | Not Available | 1630 | Open in IMG/M |
| 3300013308|Ga0157375_12292510 | Not Available | 644 | Open in IMG/M |
| 3300013308|Ga0157375_12741679 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 589 | Open in IMG/M |
| 3300013308|Ga0157375_12985653 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 565 | Open in IMG/M |
| 3300014325|Ga0163163_11083485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 864 | Open in IMG/M |
| 3300014325|Ga0163163_11089523 | All Organisms → cellular organisms → Bacteria | 862 | Open in IMG/M |
| 3300014326|Ga0157380_11737684 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 682 | Open in IMG/M |
| 3300014745|Ga0157377_11231824 | Not Available | 581 | Open in IMG/M |
| 3300014745|Ga0157377_11592545 | Not Available | 523 | Open in IMG/M |
| 3300014968|Ga0157379_10367456 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1319 | Open in IMG/M |
| 3300014968|Ga0157379_10929763 | Not Available | 826 | Open in IMG/M |
| 3300014968|Ga0157379_11848255 | Not Available | 594 | Open in IMG/M |
| 3300014969|Ga0157376_11234466 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 776 | Open in IMG/M |
| 3300014969|Ga0157376_12714266 | Not Available | 535 | Open in IMG/M |
| 3300015371|Ga0132258_10038203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 10851 | Open in IMG/M |
| 3300017792|Ga0163161_10113925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Amycolatopsis | 2025 | Open in IMG/M |
| 3300017965|Ga0190266_10267821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia autotrophica | 869 | Open in IMG/M |
| 3300017965|Ga0190266_10502092 | Not Available | 707 | Open in IMG/M |
| 3300017965|Ga0190266_10618039 | Not Available | 659 | Open in IMG/M |
| 3300018465|Ga0190269_11981013 | Not Available | 506 | Open in IMG/M |
| 3300018466|Ga0190268_10007026 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2884 | Open in IMG/M |
| 3300018476|Ga0190274_12841677 | Not Available | 580 | Open in IMG/M |
| 3300018481|Ga0190271_10070471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria | 3083 | Open in IMG/M |
| 3300019767|Ga0190267_10167284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 985 | Open in IMG/M |
| 3300019767|Ga0190267_11430142 | Not Available | 527 | Open in IMG/M |
| 3300020082|Ga0206353_11724578 | Not Available | 617 | Open in IMG/M |
| 3300024055|Ga0247794_10296970 | Not Available | 543 | Open in IMG/M |
| 3300025901|Ga0207688_10115826 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1560 | Open in IMG/M |
| 3300025901|Ga0207688_10129024 | All Organisms → cellular organisms → Bacteria | 1481 | Open in IMG/M |
| 3300025901|Ga0207688_10299516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Propionibacteriales → Nocardioidaceae → Nocardioides | 983 | Open in IMG/M |
| 3300025906|Ga0207699_10622925 | Not Available | 787 | Open in IMG/M |
| 3300025907|Ga0207645_10352901 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 985 | Open in IMG/M |
| 3300025908|Ga0207643_10011561 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4767 | Open in IMG/M |
| 3300025908|Ga0207643_10180527 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1277 | Open in IMG/M |
| 3300025908|Ga0207643_10615828 | Not Available | 699 | Open in IMG/M |
| 3300025911|Ga0207654_10813698 | Not Available | 675 | Open in IMG/M |
| 3300025919|Ga0207657_10804316 | Not Available | 727 | Open in IMG/M |
| 3300025921|Ga0207652_11763180 | Not Available | 524 | Open in IMG/M |
| 3300025924|Ga0207694_10744038 | Not Available | 827 | Open in IMG/M |
| 3300025926|Ga0207659_10979360 | Not Available | 727 | Open in IMG/M |
| 3300025932|Ga0207690_10535358 | Not Available | 951 | Open in IMG/M |
| 3300025932|Ga0207690_10725290 | Not Available | 818 | Open in IMG/M |
| 3300025936|Ga0207670_11818330 | Not Available | 518 | Open in IMG/M |
| 3300025942|Ga0207689_11100222 | Not Available | 670 | Open in IMG/M |
| 3300025944|Ga0207661_10571949 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia sediminis | 1036 | Open in IMG/M |
| 3300025944|Ga0207661_11750243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 567 | Open in IMG/M |
| 3300025944|Ga0207661_11796289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerisporangium → unclassified Sphaerisporangium → Sphaerisporangium sp. NEAU-ZS1 | 559 | Open in IMG/M |
| 3300025945|Ga0207679_10461211 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia | 1128 | Open in IMG/M |
| 3300025960|Ga0207651_10949377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 767 | Open in IMG/M |
| 3300025981|Ga0207640_10200900 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 1511 | Open in IMG/M |
| 3300026023|Ga0207677_10516631 | Not Available | 1035 | Open in IMG/M |
| 3300026023|Ga0207677_10959547 | Not Available | 773 | Open in IMG/M |
| 3300026035|Ga0207703_11013307 | Not Available | 797 | Open in IMG/M |
| 3300026067|Ga0207678_10876913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 793 | Open in IMG/M |
| 3300026078|Ga0207702_10854219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 901 | Open in IMG/M |
| 3300026089|Ga0207648_11440071 | Not Available | 648 | Open in IMG/M |
| 3300026095|Ga0207676_10935569 | Not Available | 852 | Open in IMG/M |
| 3300026095|Ga0207676_11030407 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 812 | Open in IMG/M |
| 3300026118|Ga0207675_100624721 | Not Available | 1082 | Open in IMG/M |
| 3300026121|Ga0207683_10622218 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → unclassified Pseudonocardia → Pseudonocardia sp. ICBG601 | 1000 | Open in IMG/M |
| 3300027765|Ga0209073_10039010 | Not Available | 1512 | Open in IMG/M |
| 3300028380|Ga0268265_12653593 | Not Available | 506 | Open in IMG/M |
| 3300028596|Ga0247821_10138808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 1400 | Open in IMG/M |
| 3300028596|Ga0247821_10169104 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1277 | Open in IMG/M |
| 3300028710|Ga0307322_10138422 | Not Available | 643 | Open in IMG/M |
| 3300028716|Ga0307311_10251083 | Not Available | 526 | Open in IMG/M |
| 3300028754|Ga0307297_10157503 | Not Available | 778 | Open in IMG/M |
| 3300028810|Ga0307294_10362554 | Not Available | 538 | Open in IMG/M |
| 3300028876|Ga0307286_10092700 | Not Available | 1056 | Open in IMG/M |
| 3300031740|Ga0307468_100488997 | Not Available | 972 | Open in IMG/M |
| 3300032205|Ga0307472_102383650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae → Sphaerisporangium → unclassified Sphaerisporangium → Sphaerisporangium sp. NEAU-ZS1 | 537 | Open in IMG/M |
| 3300033550|Ga0247829_10198640 | Not Available | 1591 | Open in IMG/M |
| 3300033551|Ga0247830_10232534 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Pseudonocardia → Pseudonocardia sediminis | 1389 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 13.79% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 6.90% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 5.42% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 4.93% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere | 4.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.43% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 3.94% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.94% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.45% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.45% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 3.45% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 2.96% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.96% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 2.96% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 2.46% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.46% |
| Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 2.46% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 2.46% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 1.97% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.97% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.48% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.48% |
| Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 1.48% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.99% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.99% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Soil → Switchgrass Rhizosphere | 0.99% |
| Glacier Valley | Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley | 0.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.49% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
| 3300004081 | Grasslands soil microbial communities from Hopland, California, USA - 2 (version 2) | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
| 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
| 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Environmental | Open in IMG/M |
| 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Environmental | Open in IMG/M |
| 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Host-Associated | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Environmental | Open in IMG/M |
| 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Environmental | Open in IMG/M |
| 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Host-Associated | Open in IMG/M |
| 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
| 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
| 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
| 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
| 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
| 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
| 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
| 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
| 3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
| 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010331 | Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaG | Environmental | Open in IMG/M |
| 3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Host-Associated | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
| 3300012212 | Combined assembly of Hopland grassland soil | Host-Associated | Open in IMG/M |
| 3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
| 3300012955 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MG | Environmental | Open in IMG/M |
| 3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
| 3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
| 3300012985 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MG | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012988 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Host-Associated | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Host-Associated | Open in IMG/M |
| 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Host-Associated | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
| 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
| 3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
| 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Host-Associated | Open in IMG/M |
| 3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
| 3300018465 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 IS | Environmental | Open in IMG/M |
| 3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
| 3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
| 3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
| 3300019767 | Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 T | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024055 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S046-202B-6 | Environmental | Open in IMG/M |
| 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027765 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 (SPAdes) | Environmental | Open in IMG/M |
| 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300028596 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14 | Environmental | Open in IMG/M |
| 3300028710 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380 | Environmental | Open in IMG/M |
| 3300028716 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198 | Environmental | Open in IMG/M |
| 3300028754 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_157 | Environmental | Open in IMG/M |
| 3300028810 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151 | Environmental | Open in IMG/M |
| 3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
| 3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
| 3300033551 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| C688J35102_1191767791 | 3300002568 | Soil | MCAPCSAHADLMDEPEPGWRPGDQILLTLPDGQVVRCRILNLRDDGTVQVVPEHEVILG* |
| C688J35102_1194180242 | 3300002568 | Soil | VDEPEPRWRPGDHILVDVPDGQTIRCRVMNVKDDGTIHVVPEHAVVIR* |
| C688J35102_1203091002 | 3300002568 | Soil | MLIGVDEPDPGWQPGDTIFVDLPDGQCVRCRIVTILEDGTIQVVPEHSVAIT* |
| Ga0063454_1000492122 | 3300004081 | Soil | MLVGVDEPEPGWQPGDTIYVDLPDGQCVRCRIVDVLEDGTLQVVPDHPVTIA* |
| Ga0063454_1007171982 | 3300004081 | Soil | GVDEPDPGWQPGDTIFVDLPDGQCVRCRIVTILEDGTIQVVPEHSVAIT* |
| Ga0062594_1009104072 | 3300005093 | Soil | MLIGVDEPDPGWQPGDTIFVDLPDGQCVRCRIVTILEDGTLQVVPEHPVAIT* |
| Ga0070658_111736031 | 3300005327 | Corn Rhizosphere | MLIGVDEPELGWSPGDTLYVDLPDGQTVRCRILDIAEDGSLQVVPEHPVTIT* |
| Ga0070658_115178481 | 3300005327 | Corn Rhizosphere | RLLALPDQALAVVNEPAREWRLGEQILVTLPDGQVVRCRVVNVLDDGTVQGVPEHEVVIG |
| Ga0070676_110715652 | 3300005328 | Miscanthus Rhizosphere | MLVGVDEPDPGWRPGDTIFVDLPDGQCVRCRIVTILEDGTLPVVPEHSVAIT* |
| Ga0070683_1003711403 | 3300005329 | Corn Rhizosphere | MLGGVDEPDPGWQPGDTIFVDLPDGQCVRCRIVTILEDGTLQVVPEHPVAIT* |
| Ga0070683_1004093793 | 3300005329 | Corn Rhizosphere | MLIGVDEPELGWSPGDTLYVDLPDGQTVRCRILDIGEDGTLQVVPEHPVTIT* |
| Ga0070683_1012613811 | 3300005329 | Corn Rhizosphere | VDEAEPGWRPGDQILIDLPDGQRVRARIVNITDEGTIQVVPEHDVVVGRP* |
| Ga0070670_1002807442 | 3300005331 | Switchgrass Rhizosphere | VDEPEPGWSPGDQILVELPDGQVVRCRIVTITPEGTVQVVPEHEVIIG* |
| Ga0070682_1002965322 | 3300005337 | Corn Rhizosphere | LCPDCSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0070682_1017129002 | 3300005337 | Corn Rhizosphere | MLVDVDEPEPGWRPGDRILVDAPDGQTVRCHVVNVQDDGTIQVVPEHAV |
| Ga0070660_1013226241 | 3300005339 | Corn Rhizosphere | GVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDGTIQVVPEHSVAIT* |
| Ga0070689_1007376791 | 3300005340 | Switchgrass Rhizosphere | MLVDVDEPEPGWRPGDRILVDAPDGQTVRCHVVNVQDDGTIQVVPEHAVAIRAG* |
| Ga0070668_1017079321 | 3300005347 | Switchgrass Rhizosphere | FVNEPAREWRLGEQILVTLPDGQVVRCRVVNVLDESTVQVVPEHEVVIG* |
| Ga0070675_1011243202 | 3300005354 | Miscanthus Rhizosphere | MLIGVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDCTIRVVPEHSVAIT* |
| Ga0070674_1001004104 | 3300005356 | Miscanthus Rhizosphere | MLIGVDEPDPGWQPGDTIFVDLPDGQCVRCRIVTVLEDGAIQVVPDHPVTIA* |
| Ga0070673_1003303211 | 3300005364 | Switchgrass Rhizosphere | RTRMLVGVDDPDLGWQPGDTIYVDLPDGQCVRCRIVTVLEDGAIQVVPDHPVTIA* |
| Ga0070688_1017649981 | 3300005365 | Switchgrass Rhizosphere | MLVGVDEPEPGWRPGDTLYVDLPDGQTVRCRIVDIGEDGTLQVVPEHPVTIT* |
| Ga0070659_1010193892 | 3300005366 | Corn Rhizosphere | MLAVVNEPAREWRLGVQILVTLPDGQVVRCRVVNVLDNGTVQVVPEHEVVIG* |
| Ga0070713_1002051383 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGVDEPDPGWQPGDTIFVDLPDGQCVRCRIVTILEDGTLQVVPEHSVAIT* |
| Ga0070710_112811122 | 3300005437 | Corn, Switchgrass And Miscanthus Rhizosphere | MNEPELGCRPDDYILVDLPDGQTVRCRVVNVKDDGTVQVVPDHAVVIS* |
| Ga0070700_1014001962 | 3300005441 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGVDEPDPGWQPGDTIFVDQSDGQGVQCRIVTIREDCTIRVVPEHSVAIT* |
| Ga0070678_1005326081 | 3300005456 | Miscanthus Rhizosphere | MLVGVDEPEPGWRPGDTLYVDLPDGQTVRCRILDIGEDGTLQVVPEHPVTIT* |
| Ga0070685_103594241 | 3300005466 | Switchgrass Rhizosphere | MLVGVDDPDLGWQPGDTIYVDLPEGQCVRCRIVTVLEDGAIQVVPDHPVTIA* |
| Ga0070684_1001972383 | 3300005535 | Corn Rhizosphere | LAASSALDRPLLIGACLSTADEPEPGWRPGDQILVDMPDGPVVRCRIVNVAEDGTIQVIPEHEVVVR* |
| Ga0070686_1013793031 | 3300005544 | Switchgrass Rhizosphere | LCPDCSTSVGRWRILAFVDEPESGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0070665_1001881102 | 3300005548 | Switchgrass Rhizosphere | VDDPERGWRPGGHILIDLPDAQTLRCRVVLVSEDGTIQVVPEHAIAIGTA* |
| Ga0070665_1002058361 | 3300005548 | Switchgrass Rhizosphere | LCPDCSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVTITPEGTVQV |
| Ga0070665_1002273883 | 3300005548 | Switchgrass Rhizosphere | MLIGVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDGTIQVVPEHSVAIT* |
| Ga0070665_1003309672 | 3300005548 | Switchgrass Rhizosphere | MLVGVDDPDLGWQPGDTIYVDLPDGQCVRCRIVTVLEDGAIQVVPDHPVTIA* |
| Ga0068857_1001392792 | 3300005577 | Corn Rhizosphere | MLGGVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDCTIRVVPEHSVAIT* |
| Ga0068854_1003456572 | 3300005578 | Corn Rhizosphere | MLVDVDGPEPGWRPGDRILVDAPDGQTVRCHVVNVQDDGTIQVVPEHAVAIRAG* |
| Ga0068854_1022005062 | 3300005578 | Corn Rhizosphere | VGEPEPGWRPGDQILVTLPDGQVVRCRIVNVADDGSCQVVPEHEVVIG* |
| Ga0068856_1002663981 | 3300005614 | Corn Rhizosphere | DEPEPGWRPGDQILVDLPDGQVVRCRIVNVAEDGTIQVIPEHEVVVR* |
| Ga0068856_1026448242 | 3300005614 | Corn Rhizosphere | AHAGPVDEAEPGWRPGDQILIDLPDGQRVRARIVNITDEGTIQVVPEHDVVVGRP* |
| Ga0068864_1013805032 | 3300005618 | Switchgrass Rhizosphere | VDEPEPGWRPGDQILVTLPDGQVVRCRIVNVAEDGSYQVVPEHEVVIGKRSPLPPHR* |
| Ga0068864_1026457951 | 3300005618 | Switchgrass Rhizosphere | MLSPTARRRCGQWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNVTPEGTVQVVPEHEVIIG* |
| Ga0068861_1004680331 | 3300005719 | Switchgrass Rhizosphere | VDEAEPGWRPGDQILIDLPDGQTVRARIVNITDEGTIQILPEHDVVVGRP* |
| Ga0068861_1015144522 | 3300005719 | Switchgrass Rhizosphere | MLVGVDEPEPGWRPGDTLYIELPNGQTVRCRIVDILADGTVRVVPEYPITIN* |
| Ga0068851_101510592 | 3300005834 | Corn Rhizosphere | MLTGVDEPDPGWQPGDTIFVDLPDGQCVRCRIVTILEDGTIQVVPEHSVAIT* |
| Ga0068863_1003921063 | 3300005841 | Switchgrass Rhizosphere | MLVDVDEPEPGWRPGDRILVDAPDGQTVRCHVVNVQDDGTIQVVPEHAVAIR |
| Ga0068858_1012928122 | 3300005842 | Switchgrass Rhizosphere | VDEAEPGWRPGDQILIDLPDGQTVRARIVNITDEGTIQVVPEHDVVVGRP* |
| Ga0068860_1020620552 | 3300005843 | Switchgrass Rhizosphere | SVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0068860_1024227881 | 3300005843 | Switchgrass Rhizosphere | LWPTARRRWGLWRILAVVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVII |
| Ga0068862_1026474562 | 3300005844 | Switchgrass Rhizosphere | VDEPEPGWRPGDQILVTLPDGQVVRCRIVNVAEDGSYQVVPEHEVAIGKRPPLPPHR* |
| Ga0070717_112591482 | 3300006028 | Corn, Switchgrass And Miscanthus Rhizosphere | VDDPERGWRPGGHILIDLLDGQTVRCRVVNVSDDGTIQVVPEHALVIGTA* |
| Ga0079220_101393302 | 3300006806 | Agricultural Soil | MLVDVDEPEPGWRPGDTIYVDLPDGQCVRCRIVNVLEDGTVQVVPDHPVTIA* |
| Ga0079220_107272561 | 3300006806 | Agricultural Soil | VDEVEPGWRPGDQILIDLPDGQTVPARIVNITDEGTIQVVPELDVVVGRP* |
| Ga0079219_103602131 | 3300006954 | Agricultural Soil | MLIAVDELEPGWRPGDEILATYQTGKCALSLNVTEDGTVQVVPEHEVVIARSL* |
| Ga0079219_105539731 | 3300006954 | Agricultural Soil | VDEAEPGWRPGDQILIDHPDGQRVRARIVNITDEGTIQVVPEHDVVVGRP* |
| Ga0105251_101611271 | 3300009011 | Switchgrass Rhizosphere | MLVGVDEPEPGWRPGDTIYVDLPDGQCVRCRIVTVLEDGAIQVVPDHPVTIA* |
| Ga0105251_103885661 | 3300009011 | Switchgrass Rhizosphere | LCRDCSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVTITPEGTVQVVPEHEVIIG* |
| Ga0111539_104687782 | 3300009094 | Populus Rhizosphere | MKPGPAKGCWHILVSVDAPEWGWQPGDHIIVDLPDGQRVRCRIVNVTDDGTIQVVPEHALVIR* |
| Ga0111539_109312282 | 3300009094 | Populus Rhizosphere | MLVDVDDPERGWRPGGHILIDLPDGQTVRGRAVNISDDGATQVVLEHAIVIGTA* |
| Ga0111539_122061602 | 3300009094 | Populus Rhizosphere | MLVAVDEPESGWRPGDTICVDLPDGQSVRCRIVAVLDDGTIQVVPEHPVTIA* |
| Ga0111539_127054991 | 3300009094 | Populus Rhizosphere | LCPDCSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNVTPEGTVQVVPEHEVIIG* |
| Ga0105245_102177581 | 3300009098 | Miscanthus Rhizosphere | MEGITVGEPEPGWRPGDQILVTLPDGQVVRCRIVTIADDGSCQVGPEHEVIIG* |
| Ga0105245_102567972 | 3300009098 | Miscanthus Rhizosphere | LCPDCSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGHVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0105245_122577892 | 3300009098 | Miscanthus Rhizosphere | VDEAEPGWRPGDQILIDLPDGQTVPCRIVNITDEGTIQVVPEHDVVVGRP* |
| Ga0105245_123552841 | 3300009098 | Miscanthus Rhizosphere | DLGWQPGDTIYVDLPDGQCVRCRIVTVLEDGAIQVVPDHPVTIA* |
| Ga0105245_131288841 | 3300009098 | Miscanthus Rhizosphere | MLSVVNEPAREWRPGEQILVTLPDGHVVRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0105247_103078301 | 3300009101 | Switchgrass Rhizosphere | MLGGVDEPDPGWRPGDTIFVDLPDGQCVRCRIVTILEDGTIQVVPEHSVAIT* |
| Ga0105247_118465282 | 3300009101 | Switchgrass Rhizosphere | MLIGVDEPEPGWSPGDTLYVDLPDGQTVRCRILDIGEDGTLQVVPEHPVTIT* |
| Ga0105243_122246631 | 3300009148 | Miscanthus Rhizosphere | MLAVVNEPAREWRLGEHILVTLPDSQVVRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0111538_104408672 | 3300009156 | Populus Rhizosphere | VDDPERGWRPGGHILIDLPDGQTVRGRVVNVSEDGTIQVVPEHAIVIGTA* |
| Ga0111538_118333722 | 3300009156 | Populus Rhizosphere | VDEPEPGWSPGDQILVELSDGQVVRCRIVNITPEGTVQVVPEHEVSIG* |
| Ga0111538_128440951 | 3300009156 | Populus Rhizosphere | MLAVVNEPAREWRLGEQILVTLPDGQVVRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0105241_101638043 | 3300009174 | Corn Rhizosphere | MLVDVDEPEPGWRPGDRVLVDAPDGQTVRCHVVNVQDDGTIQVVPEHAVAIRAG* |
| Ga0105241_109753111 | 3300009174 | Corn Rhizosphere | VDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0105242_129636171 | 3300009176 | Miscanthus Rhizosphere | HAGQVAEAEPGWRPGDQILIDIPDGQTVRDRIVNITDEGTIQIVPEHDVVVGRP* |
| Ga0105249_124727291 | 3300009553 | Switchgrass Rhizosphere | VDEPEPGWRPGDQILVTLPDGQVVRCRIVNVAEDGSYQVVPEHEVVIGKSPPLPPHR* |
| Ga0105249_128088282 | 3300009553 | Switchgrass Rhizosphere | MLIGVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDCTIRV |
| Ga0123336_103791482 | 3300010331 | Glacier Valley | MDEPEPGWRPGDNILVALPDGQAVRCTIVNITEDGTIQVVPEHPVTIS* |
| Ga0134125_121532402 | 3300010371 | Terrestrial Soil | LCPDCSTSVDRWRILAVVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0134128_115194702 | 3300010373 | Terrestrial Soil | MLIGVDEPELGWSPGDTLFVDLPDGQTVRCRILDIGEDGTLQVVPEHPVTIT* |
| Ga0105239_113901941 | 3300010375 | Corn Rhizosphere | MRRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEV |
| Ga0105239_119373501 | 3300010375 | Corn Rhizosphere | MLGGVDEPDPGWQPGDTIFVDLPDGQCVRCRIVTILEDGTIQVVPEHSVAIT* |
| Ga0134127_131131021 | 3300010399 | Terrestrial Soil | VISTSDHVVPDCSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0134122_130491041 | 3300010400 | Terrestrial Soil | MLVGVDDPDLGWQPGDTIYVDLPDGQCVRCRIVTVLEDGAIQVVSDHPVTIA* |
| Ga0134122_130796021 | 3300010400 | Terrestrial Soil | WRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0134121_120968781 | 3300010401 | Terrestrial Soil | MRRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQV |
| Ga0105246_102650453 | 3300011119 | Miscanthus Rhizosphere | VDEAERGWRPGDQILIDLPDGQRVRARIVNITDEGTIQVVPEHDVVVGRP* |
| Ga0105246_107031321 | 3300011119 | Miscanthus Rhizosphere | MLIGVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDCTIQVVPEHSVAIT* |
| Ga0105246_109801381 | 3300011119 | Miscanthus Rhizosphere | RVEQILVTLPDGQVVRCRVLSVDEDGGMQVVPEHPVTLG* |
| Ga0105246_109807512 | 3300011119 | Miscanthus Rhizosphere | VDEPEPGWSPGDQILVKLPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0105246_115928961 | 3300011119 | Miscanthus Rhizosphere | TWTSPSGSRPGDLIFVDLPDGQTVRCRVVNVKDDGTIQVVPEHAVVIR* |
| Ga0105246_118961761 | 3300011119 | Miscanthus Rhizosphere | MLVAVDEPEPGWRPGDTIYVDLPDGQTVRCRIVAVQDDGTIHVVPDHSVTIA* |
| Ga0105246_120163691 | 3300011119 | Miscanthus Rhizosphere | MLPIVNEPAREWRPGEQILVTLPDGQVVRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0150985_1023217662 | 3300012212 | Avena Fatua Rhizosphere | MLIGVDEPEPCWRTGDRILVDLPDGQTVRCRVVNDKDDGTIQIVPEHAVAIGTA* |
| Ga0150985_1025634631 | 3300012212 | Avena Fatua Rhizosphere | MLAAVDESEREWHLGVQILVTLPDGQVVRCRVVSSLDDGTVQVVPMHEVVVGSTDGN* |
| Ga0150985_1028342562 | 3300012212 | Avena Fatua Rhizosphere | MLAVVNEPAREWRPGEQILVTLPDGQVFRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0150985_1043829032 | 3300012212 | Avena Fatua Rhizosphere | VDAPEPGWRAGDHILVDLPDGQTIRCRVVNVKDDGTMQVVPEHAVGTGTA* |
| Ga0150985_1120923561 | 3300012212 | Avena Fatua Rhizosphere | VDEAEPGWRPGDQILIDLPDGQTVPARIVNITDEGTIQVVPEHDVVVGRP* |
| Ga0150985_1137940091 | 3300012212 | Avena Fatua Rhizosphere | RRMLAVVNEPAREWRPGEQILITLPDGQVVRCRVVNILDDGTVQVVPEHEVVIG* |
| Ga0150985_1150469351 | 3300012212 | Avena Fatua Rhizosphere | MLVDVDGPERGWRPGDHILVDCPDGQTVRCRTVKHTGDGTVQVVPEQAVFIR* |
| Ga0150985_1194571022 | 3300012212 | Avena Fatua Rhizosphere | MLAVVNEPAREWRPGEQILVTLPDGQVVRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0150985_1226369712 | 3300012212 | Avena Fatua Rhizosphere | SEPRWQPGDRILVDLPDGKTVRCRVVILKKDGSIQVVSEHAVVVR* |
| Ga0150984_1044893231 | 3300012469 | Avena Fatua Rhizosphere | GPAREWRPGEQILVTLPDGQVVRCRVVNILDDGTVQVVPEHEVVIG* |
| Ga0150984_1091351711 | 3300012469 | Avena Fatua Rhizosphere | SEPRWQPGDRILVDLPDGKTVRCRVVILKEDGSIQVVSEHAVVVR* |
| Ga0150984_1135660691 | 3300012469 | Avena Fatua Rhizosphere | PEPCWRTGDRILVDLPDGQTVRCRVVNDKDDGTIQIVPEHAVAIGTA* |
| Ga0164298_101285732 | 3300012955 | Soil | MDEPPTRRMLAVVNEPVREWRLGEQILVTLPDGQVVRCRVVNVLDDGAVQVVPEHEVVIG |
| Ga0164298_115433891 | 3300012955 | Soil | RRYSRLIHAVDVDEPEPGRRPGDRILVDLPDGQTVRCRIVNVKDDGTIQVVPEHAVLVS* |
| Ga0164303_108695141 | 3300012957 | Soil | VEEPERGWRPGDQILVDLPDGQTVRCRVVNIKDDGTIQAVPEHQVVMGSDRRG |
| Ga0164302_100510662 | 3300012961 | Soil | VDEPEPGRRPGDRILVDLPDGQTVRCRIVNVKDDGTIQVVPEHAVLVS* |
| Ga0164302_111047561 | 3300012961 | Soil | VDEPEPGWSPGDQILVELPDGQVVRCRIVNVTPEGNLQVVP |
| Ga0164308_120818711 | 3300012985 | Soil | MLGGVVEPEPGWRLGDQLLVELPDGQIVRCRIVNVSDTGTIQVVPEHEVVI |
| Ga0164304_111443831 | 3300012986 | Soil | VDEPEPGRRPGIRILVDLPEGHVVRCRIVNVMDDGTIQVVPEHAVVIS* |
| Ga0164307_101875122 | 3300012987 | Soil | VNEPARDWRLGEQILVTLPEGQVVRCRVVNVLDDGTVPVVPEHEVVIG* |
| Ga0164307_103985022 | 3300012987 | Soil | VDEPEPGRRPGIRILVDLPEGHVVRCRIVNVMDDGTIQVVPEH |
| Ga0164306_107752622 | 3300012988 | Soil | WRMLAVVDEPEPGWRPGEQILVTLPDGQVVRCRIVNITEDGTVQVVPEHEVILG* |
| Ga0164305_101362992 | 3300012989 | Soil | MLAVVNEPARVWRPGEQILVTLPDGQMVRCRVVNVLDDGTVQVLPEHEVVID* |
| Ga0164305_110047591 | 3300012989 | Soil | VDEAEPGWSLGDQILIDLPDGQTVPGRAVNISDDGATQVVPVHAIVIGTA* |
| Ga0164305_119886871 | 3300012989 | Soil | MLAVVNEPVREWRLGEQILVTLPDGQVVRCRVVNVLDDGAVQVVPEHEVVIG* |
| Ga0164305_122168171 | 3300012989 | Soil | GWSPGDQILVELPDGQVVRCRIVNVTPEGNLQVVPEHEVSIS* |
| Ga0157371_109775011 | 3300013102 | Corn Rhizosphere | LGWQPGDTIYVDLPDGQCVRCRIVTVLEDGAIQVVPDHPVTIA* |
| Ga0157371_113944062 | 3300013102 | Corn Rhizosphere | MLAVVNEPAREWRPGEQILVTLSDGQVVRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0157369_113796711 | 3300013105 | Corn Rhizosphere | MSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIS* |
| Ga0157369_116178221 | 3300013105 | Corn Rhizosphere | VDEPEPGWSPGDQILVELPDGQVVRCRIVNVTPEGTVQVVPEHEVI |
| Ga0157369_120515781 | 3300013105 | Corn Rhizosphere | VDEPEPGWRPGDQILVTLPDGQVVRCRIVNVADDGSYQVVPEHEVVIG* |
| Ga0157374_111947911 | 3300013296 | Miscanthus Rhizosphere | MLVGVDDPDLGWQPGDTIYVDLPDGQCVRCRIVTVLEEGNIQVVPEHPVTTAAVHNSPTSS* |
| Ga0157378_104016342 | 3300013297 | Miscanthus Rhizosphere | MLVAVDEPEPGWRPGDTIYVDLPDGQTVRCRIVAVQDDGTIQVVPDHSVTIA* |
| Ga0157378_132128381 | 3300013297 | Miscanthus Rhizosphere | MLALVNEPAREWRPGEQILITLPDGQVVRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0163162_108441661 | 3300013306 | Switchgrass Rhizosphere | EPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDGTIQVVPEHSVAIT* |
| Ga0163162_111488261 | 3300013306 | Switchgrass Rhizosphere | LCLACSTSVGRWRILAFVDEPEPGWSPSDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0157372_102423316 | 3300013307 | Corn Rhizosphere | VDVPEPGWSLGDQILVELPDGQVVRCRIVNITPEVTVQVIPEHEVTIS* |
| Ga0157372_106531511 | 3300013307 | Corn Rhizosphere | MLIGVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDGIIQVVPEHSVAIT* |
| Ga0157375_103556853 | 3300013308 | Miscanthus Rhizosphere | MLVGVDDPDLGWQPGDTIYVDLPDGQCVRCRIVTVLEDGAIQVV |
| Ga0157375_122925101 | 3300013308 | Miscanthus Rhizosphere | MLIGVDEPDPGWQPGDTIFLDLPDGQCVRCRIVTILEDGTIQVVPEHSVAIT* |
| Ga0157375_127416791 | 3300013308 | Miscanthus Rhizosphere | LGPTGSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0157375_129856532 | 3300013308 | Miscanthus Rhizosphere | VDEAEPGWRPGDQILIDLPDGQTVRARIVNITDEGTIQIVPEHDVVVGRP* |
| Ga0163163_110834851 | 3300014325 | Switchgrass Rhizosphere | VEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0163163_110895231 | 3300014325 | Switchgrass Rhizosphere | VDEAEPGWRPGDQILIDLPDGQRVRARIVNITDDGTIQVVPEHDVVVGRP* |
| Ga0157380_117376842 | 3300014326 | Switchgrass Rhizosphere | LCPDCSTSVGRWRTLAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0157377_112318241 | 3300014745 | Miscanthus Rhizosphere | MLAVVNEPAREWRPGEQILITLPDGQVVRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0157377_115925451 | 3300014745 | Miscanthus Rhizosphere | MRRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG* |
| Ga0157379_103674561 | 3300014968 | Switchgrass Rhizosphere | VDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIS* |
| Ga0157379_109297632 | 3300014968 | Switchgrass Rhizosphere | MLAVVNEPAREWHPREQILVTLPDGQVVRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0157379_118482551 | 3300014968 | Switchgrass Rhizosphere | VDEPKPGWRPGDHILVDLPDGQTVRCRVVNVEDDGTIQGVPEHTVMIR* |
| Ga0157376_112344661 | 3300014969 | Miscanthus Rhizosphere | VNEPARDWRLGEQILVTLPDGRVVRCRVVNVLDDGTVQVVPEHEVVIG* |
| Ga0157376_127142662 | 3300014969 | Miscanthus Rhizosphere | PTCGRILVDVDEPEQGWRPGDHILIDLPDGQTVRCRVVNVKDDGTIQVVPEHAVVIR* |
| Ga0132258_1003820310 | 3300015371 | Arabidopsis Rhizosphere | MLVAVDEPEPGWRPGDTIYVDLPDGQTVRCRIVAVQGDGTIQVVPDHSVTIA* |
| Ga0163161_101139252 | 3300017792 | Switchgrass Rhizosphere | MLVGVDEPEPGWRPGDTLYVDLPDGQTVRCRILDIGEDGTLQVVPEHPVTIT |
| Ga0190266_102678212 | 3300017965 | Soil | MLAASAFAGLKSYRARILIDVDDPERGWRPGGHILIDLPDGQTVRGRAVNISYDGATQVVPVHAIVIGTA |
| Ga0190266_105020921 | 3300017965 | Soil | MLGGVDEPDPGWQPGDTIFVDLPDGQCVRCRIVTILEDGTIQVVPEHSVAIT |
| Ga0190266_106180392 | 3300017965 | Soil | VNEAEPGWSLGDQILIDLPDGQTVPCRIVNITDEGTIQVVPEREVVIGRPRPAAKH |
| Ga0190269_119810131 | 3300018465 | Soil | MLGGVDEPDPGWRPGDTIFVDLPDGHCVRCRIVTILDDGTIQVVPEHPVSIA |
| Ga0190268_100070264 | 3300018466 | Soil | VPGWRPGDYILVDLLDGQTVRCRIVNITEDGTIQVVPEDAVVIR |
| Ga0190274_128416771 | 3300018476 | Soil | MLVGVDEPEPGWRPGDTLYVDLPDGQTVRCRIVDILEDGTVQVVPEHPVKIT |
| Ga0190271_100704714 | 3300018481 | Soil | VVSCALEPWGASEPGWRPGDQVLVDLPDGQVVRCRIVNVTEDGTVQVVPDHDVVLG |
| Ga0190267_101672842 | 3300019767 | Soil | MLVAVDEPEPGWRPRDMIYVDVPDGQSVRCRLVAVLEDGTIQVVPERSVTFV |
| Ga0190267_114301421 | 3300019767 | Soil | MLAVVNEPAREWRPGEQILVTLPDGQVVRCRVVNVLDDGTVQVVPEHEVVIG |
| Ga0206353_117245782 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | VDEPEPGWSPGDQILVKLPDGQVVRCRIVNITPEGTVQVVPEHEVIIG |
| Ga0247794_102969701 | 3300024055 | Soil | VDEAEPGWRPGDQILIDLPDGQRVRARIVNITDEGTIQIVPEHDVVAGRP |
| Ga0207688_101158262 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MLIGVDEPDPGWQPGDTIFLDLPDGQCVRCRIVTILEDGTIQVVPEHSVAIT |
| Ga0207688_101290242 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVGVDDPDLGWQPGDTIYVDLPDGQCVRCRIVTVLEDGAIQVVPDHPVTIA |
| Ga0207688_102995162 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | LCPDCSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG |
| Ga0207699_106229252 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | MLVDVDEPEPGWRPGDRILVDAPDGQTVRCHVVNVQDDGTIQVVPEHAVAIRAG |
| Ga0207645_103529012 | 3300025907 | Miscanthus Rhizosphere | VDEAEPGWRPGDQILIDLPDGQRVRARIVNITDEGTIQVVPEHDVVVGRP |
| Ga0207643_100115612 | 3300025908 | Miscanthus Rhizosphere | MLIGVDEPELGWSPGDTLYVDLPDGQTVRCRILDIGEDGTLQVVPEHPVTIT |
| Ga0207643_101805272 | 3300025908 | Miscanthus Rhizosphere | MLIGVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTILEDGTIQVVPEHSVAIT |
| Ga0207643_106158281 | 3300025908 | Miscanthus Rhizosphere | MLAVVNEPAREWRLGEQILITLPDGQVVRCRVVNILDDGTVQVVPEHEVMIG |
| Ga0207654_108136981 | 3300025911 | Corn Rhizosphere | LCPDCSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVILG |
| Ga0207657_108043161 | 3300025919 | Corn Rhizosphere | LCPDCSTSVGRWRILAFVDEPEPGWSPGDQILVKLPDGQVVRCRIVNITPEGTVQVVPEHEVTIG |
| Ga0207652_117631801 | 3300025921 | Corn Rhizosphere | LAASSALDRPLLIGACLSTADEPEPGWRPGDQILVDMPDGPVVRCRIVNVAEDGTIQVIPEHEVVVR |
| Ga0207694_107440382 | 3300025924 | Corn Rhizosphere | VDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVHVVPEHEVIIG |
| Ga0207659_109793601 | 3300025926 | Miscanthus Rhizosphere | MLIGVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDCTIRVVPEHSVAIT |
| Ga0207690_105353581 | 3300025932 | Corn Rhizosphere | MLIGVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDGTIQVVPEHSVAIT |
| Ga0207690_107252902 | 3300025932 | Corn Rhizosphere | MLAVVNEPAREWRLGVQILVTLPDGQVVRCRVVNVLDNGTVQVVPEHEVVIG |
| Ga0207670_118183301 | 3300025936 | Switchgrass Rhizosphere | MLIGVDEPDPGWQPGDTIFVDQSDGQGVRCRIVTIREDCTIQVVPEHSVAIT |
| Ga0207689_111002221 | 3300025942 | Miscanthus Rhizosphere | VDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIISRRRLPQLVLGQGVLG |
| Ga0207661_105719491 | 3300025944 | Corn Rhizosphere | MLVDVDEPEPGWRPGDRVLVDAPDGQTVRCHVVNVQDDGTIQVVPEHAVAIRAG |
| Ga0207661_117502431 | 3300025944 | Corn Rhizosphere | VDEAEPGWRPGDQILIDLPDGQRVRARIVNITDEGTIQVVPEHDVVVGR |
| Ga0207661_117962891 | 3300025944 | Corn Rhizosphere | GTHPARVDEPEPAWRPGDRILVDLPDGQTVRCRIVNIKDDGMIQVVPEHAVVIDG |
| Ga0207679_104612111 | 3300025945 | Corn Rhizosphere | VDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG |
| Ga0207651_109493772 | 3300025960 | Switchgrass Rhizosphere | RTRMLVGVDDPDLGWQPGDTIYVDLPDGQCVRCRIVTVLEDGAIQVVPDHPVTIA |
| Ga0207640_102009004 | 3300025981 | Corn Rhizosphere | LCPDCSTSVGRRRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVTITPEGTVQVVPEHEVIIG |
| Ga0207677_105166311 | 3300026023 | Miscanthus Rhizosphere | MLALVNEPAREWRPGEQILVTLPDGQVVRCRVVNVLDDGTVQVVPEHGVVIG |
| Ga0207677_109595471 | 3300026023 | Miscanthus Rhizosphere | LCPDCSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVTITPEGTVQVVPEPEVIIG |
| Ga0207703_110133072 | 3300026035 | Switchgrass Rhizosphere | VDDPERGWRPGGHILIDLPDAQTLRCRVVLVSEDGTIQVVPEHAIAIGTA |
| Ga0207678_108769131 | 3300026067 | Corn Rhizosphere | THHVVADCSTSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVTITPEGTVQVVPEHEVIIG |
| Ga0207702_108542192 | 3300026078 | Corn Rhizosphere | RLLIGACLSTVDEPEPGWRPGDQILVDLPDGQVVRCRIVNVAEDGTIQVIPEHEVVVR |
| Ga0207648_114400711 | 3300026089 | Miscanthus Rhizosphere | MLGGVDEPDPGWRPGDTIFVDLPDGQCVRCRIVTILEDGTLQVVPEHPLAIT |
| Ga0207676_109355692 | 3300026095 | Switchgrass Rhizosphere | VDEPEPGWRPGDQILVTLPDGQVVRCRIVNVADDGSCQVVPEHEVVIG |
| Ga0207676_110304072 | 3300026095 | Switchgrass Rhizosphere | MSVGRWRILAFVDEPEPGWSPGDQILVELPDGQVVRCRIVNITPEGTVQVVPEHEVIIG |
| Ga0207675_1006247212 | 3300026118 | Switchgrass Rhizosphere | MLIGVDEPDPGWQPGDTIFVDLPDGQCVRCRIVTILEDGTIQVVPEHSVAIT |
| Ga0207683_106222182 | 3300026121 | Miscanthus Rhizosphere | VDEPEPGWSPGDQILVELPDGQVVRCRIVTITPEGTVQVVPEHQVIIG |
| Ga0209073_100390103 | 3300027765 | Agricultural Soil | MLVDVDEPEPGWRPGDTIYVDLPDGQCVRCRIVNVLEDGTVQVVPDHPVTIA |
| Ga0268265_126535932 | 3300028380 | Switchgrass Rhizosphere | DLGWQPGDTIYVDLPDGQCVRCRIVTVLEDGAIQVVPDHPVTIA |
| Ga0247821_101388081 | 3300028596 | Soil | LDREGRWREVIVDEPDSGWQPGDQILVTLPDGQVVRCRIVNVAEDGSCQVVPEHEVVIGGERLRPL |
| Ga0247821_101691041 | 3300028596 | Soil | ARILVDVDDPERGWRPGGHILIDLPDGQTVRGRAVNISDDGATQVVPVHAIVIGTA |
| Ga0307322_101384221 | 3300028710 | Soil | VDEPEPGWRPGDEILVDLPDGQVARCRIVNVTEDGTVQVVPEHEVVIGESP |
| Ga0307311_102510831 | 3300028716 | Soil | VDEPEPGWRPGDEILVNLPDGQVARCRIVNVTEDGTVQVVPDHDVVIG |
| Ga0307297_101575031 | 3300028754 | Soil | MLIGVDEPDPGWQPGDTIFVDLPDGQCVRCRVVTVLEDGTVQVVSDHPVTIA |
| Ga0307294_103625541 | 3300028810 | Soil | MLVAVDEPEPGWRPGDTIYVDLPDGQTVRCRIVAVLEDGTIQVVPEHSVTIA |
| Ga0307286_100927003 | 3300028876 | Soil | MLIGVDEPDLGWQPGDTIFVDLPDGQCVRCRIVTILEDGTIQVVPEHSVAIT |
| Ga0307468_1004889972 | 3300031740 | Hardwood Forest Soil | MLAVVDEPEREWRPGEQILVTLPAGQVVHCRVLSIDEDGGMQVVPEHPVTLG |
| Ga0307472_1023836501 | 3300032205 | Hardwood Forest Soil | PGPAWRRGDRIVVDLPDGQTVRCRIANIKDDGTIQVVPEHAVVVDG |
| Ga0247829_101986401 | 3300033550 | Soil | SQPAQRQEPTWRPGHQILVDLPDGQVARCRIVNVTDDGTIQVVPEHEVVINDGHL |
| Ga0247830_102325344 | 3300033551 | Soil | VDVDDPERGWRPGGHILIDLPDGQTVPGRAVNISDDGATQVVPVHAIVIGTA |
| ⦗Top⦘ |