Basic Information | |
---|---|
Family ID | F024926 |
Family Type | Metagenome |
Number of Sequences | 204 |
Average Sequence Length | 44 residues |
Representative Sequence | MIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG |
Number of Associated Samples | 150 |
Number of Associated Scaffolds | 204 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 69.61 % |
% of genes near scaffold ends (potentially truncated) | 21.08 % |
% of genes from short scaffolds (< 2000 bps) | 79.90 % |
Associated GOLD sequencing projects | 141 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (75.980 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil (13.235 % of family members) |
Environment Ontology (ENVO) | Unclassified (43.627 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (56.863 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.11% β-sheet: 0.00% Coil/Unstructured: 47.89% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 204 Family Scaffolds |
---|---|---|
PF00486 | Trans_reg_C | 38.24 |
PF00248 | Aldo_ket_red | 25.00 |
PF13432 | TPR_16 | 3.92 |
PF13414 | TPR_11 | 1.47 |
PF01797 | Y1_Tnp | 0.98 |
PF01464 | SLT | 0.49 |
PF13490 | zf-HC2 | 0.49 |
PF07719 | TPR_2 | 0.49 |
PF14534 | DUF4440 | 0.49 |
PF06537 | DHOR | 0.49 |
PF01066 | CDP-OH_P_transf | 0.49 |
PF13276 | HTH_21 | 0.49 |
PF13181 | TPR_8 | 0.49 |
PF16884 | ADH_N_2 | 0.49 |
PF04052 | TolB_N | 0.49 |
PF14294 | DUF4372 | 0.49 |
PF13291 | ACT_4 | 0.49 |
PF01593 | Amino_oxidase | 0.49 |
COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
---|---|---|---|
COG1943 | REP element-mobilizing transposase RayT | Mobilome: prophages, transposons [X] | 0.98 |
COG0558 | Phosphatidylglycerophosphate synthase | Lipid transport and metabolism [I] | 0.49 |
COG0823 | Periplasmic component TolB of the Tol biopolymer transport system | Intracellular trafficking, secretion, and vesicular transport [U] | 0.49 |
COG1183 | Phosphatidylserine synthase | Lipid transport and metabolism [I] | 0.49 |
COG3488 | Uncharacterized conserved protein with two CxxC motifs, DUF1111 family | General function prediction only [R] | 0.49 |
COG5050 | sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases | Lipid transport and metabolism [I] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.98 % |
Unclassified | root | N/A | 24.02 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2170459017|G14TP7Y01AKHZV | Not Available | 536 | Open in IMG/M |
3300000532|CNAas_1018649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 502 | Open in IMG/M |
3300000887|AL16A1W_10067316 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1472 | Open in IMG/M |
3300000891|JGI10214J12806_10421495 | All Organisms → cellular organisms → Bacteria | 2261 | Open in IMG/M |
3300001431|F14TB_103928609 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 818 | Open in IMG/M |
3300002886|JGI25612J43240_1046863 | Not Available | 632 | Open in IMG/M |
3300002907|JGI25613J43889_10000181 | All Organisms → cellular organisms → Bacteria | 13328 | Open in IMG/M |
3300004114|Ga0062593_100766068 | Not Available | 954 | Open in IMG/M |
3300004156|Ga0062589_101592447 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 647 | Open in IMG/M |
3300004157|Ga0062590_100516807 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1023 | Open in IMG/M |
3300004463|Ga0063356_102337833 | Not Available | 816 | Open in IMG/M |
3300004479|Ga0062595_100603813 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 855 | Open in IMG/M |
3300004480|Ga0062592_100384892 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1108 | Open in IMG/M |
3300005178|Ga0066688_10282948 | All Organisms → cellular organisms → Bacteria | 1067 | Open in IMG/M |
3300005289|Ga0065704_10105657 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2105 | Open in IMG/M |
3300005290|Ga0065712_10158243 | Not Available | 1320 | Open in IMG/M |
3300005293|Ga0065715_10154685 | All Organisms → cellular organisms → Bacteria | 1655 | Open in IMG/M |
3300005293|Ga0065715_10928483 | Not Available | 566 | Open in IMG/M |
3300005295|Ga0065707_11059914 | Not Available | 502 | Open in IMG/M |
3300005328|Ga0070676_10769725 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 708 | Open in IMG/M |
3300005330|Ga0070690_100744078 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 756 | Open in IMG/M |
3300005331|Ga0070670_100000914 | All Organisms → cellular organisms → Bacteria | 23199 | Open in IMG/M |
3300005331|Ga0070670_100073139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2944 | Open in IMG/M |
3300005334|Ga0068869_100011478 | All Organisms → cellular organisms → Bacteria | 5811 | Open in IMG/M |
3300005337|Ga0070682_100000027 | All Organisms → cellular organisms → Bacteria | 188799 | Open in IMG/M |
3300005353|Ga0070669_100012440 | All Organisms → cellular organisms → Bacteria | 6038 | Open in IMG/M |
3300005364|Ga0070673_100976067 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 788 | Open in IMG/M |
3300005406|Ga0070703_10456721 | Not Available | 567 | Open in IMG/M |
3300005406|Ga0070703_10611206 | Not Available | 504 | Open in IMG/M |
3300005438|Ga0070701_10719668 | Not Available | 673 | Open in IMG/M |
3300005438|Ga0070701_11281654 | Not Available | 523 | Open in IMG/M |
3300005440|Ga0070705_100281885 | All Organisms → cellular organisms → Bacteria | 1182 | Open in IMG/M |
3300005440|Ga0070705_100523992 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 904 | Open in IMG/M |
3300005440|Ga0070705_101908564 | Not Available | 505 | Open in IMG/M |
3300005444|Ga0070694_100368100 | All Organisms → cellular organisms → Bacteria | 1118 | Open in IMG/M |
3300005444|Ga0070694_100819056 | Not Available | 764 | Open in IMG/M |
3300005445|Ga0070708_100598194 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer | 1040 | Open in IMG/M |
3300005459|Ga0068867_102177763 | Not Available | 526 | Open in IMG/M |
3300005467|Ga0070706_100215091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1794 | Open in IMG/M |
3300005471|Ga0070698_100000405 | All Organisms → cellular organisms → Bacteria | 45717 | Open in IMG/M |
3300005471|Ga0070698_100097741 | All Organisms → cellular organisms → Bacteria | 2912 | Open in IMG/M |
3300005471|Ga0070698_100206814 | All Organisms → cellular organisms → Bacteria | 1898 | Open in IMG/M |
3300005518|Ga0070699_100052666 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3521 | Open in IMG/M |
3300005536|Ga0070697_100002437 | All Organisms → cellular organisms → Bacteria | 14314 | Open in IMG/M |
3300005544|Ga0070686_100008924 | All Organisms → cellular organisms → Bacteria | 5619 | Open in IMG/M |
3300005545|Ga0070695_100654262 | Not Available | 830 | Open in IMG/M |
3300005549|Ga0070704_100943847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 778 | Open in IMG/M |
3300005615|Ga0070702_100344313 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium | 1047 | Open in IMG/M |
3300005616|Ga0068852_101914347 | Not Available | 615 | Open in IMG/M |
3300005617|Ga0068859_101118390 | Not Available | 867 | Open in IMG/M |
3300005618|Ga0068864_101425971 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 695 | Open in IMG/M |
3300005719|Ga0068861_100843789 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 863 | Open in IMG/M |
3300005841|Ga0068863_100067840 | All Organisms → cellular organisms → Bacteria | 3374 | Open in IMG/M |
3300005841|Ga0068863_101873690 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 610 | Open in IMG/M |
3300005844|Ga0068862_100271615 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1551 | Open in IMG/M |
3300005983|Ga0081540_1052703 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2000 | Open in IMG/M |
3300006876|Ga0079217_10634504 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 702 | Open in IMG/M |
3300007004|Ga0079218_11323469 | Not Available | 761 | Open in IMG/M |
3300009098|Ga0105245_10985749 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 887 | Open in IMG/M |
3300009143|Ga0099792_10969348 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300009148|Ga0105243_10782829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 938 | Open in IMG/M |
3300009148|Ga0105243_10901241 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 880 | Open in IMG/M |
3300009174|Ga0105241_10705236 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 922 | Open in IMG/M |
3300009174|Ga0105241_10758621 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 890 | Open in IMG/M |
3300009176|Ga0105242_10861108 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 903 | Open in IMG/M |
3300009176|Ga0105242_11959112 | Not Available | 627 | Open in IMG/M |
3300010371|Ga0134125_12025359 | Not Available | 626 | Open in IMG/M |
3300010373|Ga0134128_10718697 | All Organisms → cellular organisms → Bacteria | 1109 | Open in IMG/M |
3300010397|Ga0134124_10350024 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1391 | Open in IMG/M |
3300010397|Ga0134124_13121198 | Not Available | 507 | Open in IMG/M |
3300010399|Ga0134127_10081350 | All Organisms → cellular organisms → Bacteria | 2784 | Open in IMG/M |
3300010399|Ga0134127_13311799 | Not Available | 527 | Open in IMG/M |
3300010400|Ga0134122_10723038 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 939 | Open in IMG/M |
3300010400|Ga0134122_12264913 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 588 | Open in IMG/M |
3300010400|Ga0134122_12739557 | Not Available | 545 | Open in IMG/M |
3300010400|Ga0134122_12911992 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 532 | Open in IMG/M |
3300010400|Ga0134122_13118323 | Not Available | 518 | Open in IMG/M |
3300010401|Ga0134121_12963684 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 522 | Open in IMG/M |
3300010403|Ga0134123_10056382 | All Organisms → cellular organisms → Bacteria | 2978 | Open in IMG/M |
3300010403|Ga0134123_10256205 | Not Available | 1526 | Open in IMG/M |
3300010403|Ga0134123_10852600 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 911 | Open in IMG/M |
3300010403|Ga0134123_11172052 | Not Available | 797 | Open in IMG/M |
3300010403|Ga0134123_12013995 | Not Available | 636 | Open in IMG/M |
3300010999|Ga0138505_100054248 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 581 | Open in IMG/M |
3300011119|Ga0105246_10820779 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 827 | Open in IMG/M |
3300011119|Ga0105246_11762062 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 590 | Open in IMG/M |
3300011270|Ga0137391_10359738 | All Organisms → cellular organisms → Bacteria | 1249 | Open in IMG/M |
3300011414|Ga0137442_1037102 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 942 | Open in IMG/M |
3300011444|Ga0137463_1015718 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2664 | Open in IMG/M |
3300011998|Ga0120114_1025458 | All Organisms → cellular organisms → Bacteria | 1215 | Open in IMG/M |
3300012034|Ga0137453_1047388 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 772 | Open in IMG/M |
3300012035|Ga0137445_1103146 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 578 | Open in IMG/M |
3300012198|Ga0137364_10358914 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1088 | Open in IMG/M |
3300012198|Ga0137364_10807586 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 709 | Open in IMG/M |
3300012200|Ga0137382_10479772 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 882 | Open in IMG/M |
3300012203|Ga0137399_10625981 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 905 | Open in IMG/M |
3300012208|Ga0137376_10010254 | All Organisms → cellular organisms → Bacteria | 6660 | Open in IMG/M |
3300012211|Ga0137377_10064973 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3405 | Open in IMG/M |
3300012226|Ga0137447_1024991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 950 | Open in IMG/M |
3300012353|Ga0137367_10068636 | All Organisms → cellular organisms → Bacteria | 2635 | Open in IMG/M |
3300012356|Ga0137371_10215236 | Not Available | 1503 | Open in IMG/M |
3300012532|Ga0137373_10058388 | All Organisms → cellular organisms → Bacteria | 3546 | Open in IMG/M |
3300012685|Ga0137397_10013026 | All Organisms → cellular organisms → Bacteria | 5817 | Open in IMG/M |
3300012685|Ga0137397_10159156 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1675 | Open in IMG/M |
3300012685|Ga0137397_10160718 | All Organisms → cellular organisms → Bacteria | 1666 | Open in IMG/M |
3300012685|Ga0137397_10162857 | Not Available | 1655 | Open in IMG/M |
3300012917|Ga0137395_10278663 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1180 | Open in IMG/M |
3300012918|Ga0137396_10407529 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1008 | Open in IMG/M |
3300012918|Ga0137396_11178416 | All Organisms → cellular organisms → Bacteria | 542 | Open in IMG/M |
3300012922|Ga0137394_10608983 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 923 | Open in IMG/M |
3300012923|Ga0137359_10875795 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 775 | Open in IMG/M |
3300012924|Ga0137413_10946448 | Not Available | 672 | Open in IMG/M |
3300012927|Ga0137416_11890897 | Not Available | 546 | Open in IMG/M |
3300012929|Ga0137404_10144037 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1974 | Open in IMG/M |
3300012930|Ga0137407_10010626 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6510 | Open in IMG/M |
3300012930|Ga0137407_11914550 | Not Available | 565 | Open in IMG/M |
3300012944|Ga0137410_10043953 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3161 | Open in IMG/M |
3300012951|Ga0164300_10127692 | All Organisms → cellular organisms → Bacteria | 1159 | Open in IMG/M |
3300012957|Ga0164303_10447886 | Not Available | 812 | Open in IMG/M |
3300013294|Ga0120150_1013444 | All Organisms → cellular organisms → Bacteria | 1719 | Open in IMG/M |
3300013297|Ga0157378_10167998 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2056 | Open in IMG/M |
3300013297|Ga0157378_10231166 | All Organisms → cellular organisms → Bacteria | 1762 | Open in IMG/M |
3300013297|Ga0157378_13041593 | Not Available | 520 | Open in IMG/M |
3300013297|Ga0157378_13041595 | Not Available | 520 | Open in IMG/M |
3300013308|Ga0157375_12600658 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 605 | Open in IMG/M |
3300013765|Ga0120172_1005066 | All Organisms → cellular organisms → Bacteria | 4593 | Open in IMG/M |
3300014056|Ga0120125_1044726 | All Organisms → cellular organisms → Bacteria | 967 | Open in IMG/M |
3300014326|Ga0157380_10049827 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 3305 | Open in IMG/M |
3300014326|Ga0157380_11860139 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300014326|Ga0157380_12930841 | Not Available | 543 | Open in IMG/M |
3300014873|Ga0180066_1024012 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1133 | Open in IMG/M |
3300014883|Ga0180086_1000801 | All Organisms → cellular organisms → Bacteria | 5197 | Open in IMG/M |
3300015254|Ga0180089_1013623 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1437 | Open in IMG/M |
3300015359|Ga0134085_10435342 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 593 | Open in IMG/M |
3300015371|Ga0132258_12802682 | All Organisms → cellular organisms → Bacteria | 1214 | Open in IMG/M |
3300015372|Ga0132256_100466738 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300018000|Ga0184604_10059960 | All Organisms → cellular organisms → Bacteria | 1079 | Open in IMG/M |
3300018027|Ga0184605_10472271 | Not Available | 550 | Open in IMG/M |
3300018027|Ga0184605_10514579 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 520 | Open in IMG/M |
3300018028|Ga0184608_10112657 | Not Available | 1146 | Open in IMG/M |
3300018028|Ga0184608_10271635 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 746 | Open in IMG/M |
3300018051|Ga0184620_10051254 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1161 | Open in IMG/M |
3300018052|Ga0184638_1249853 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 611 | Open in IMG/M |
3300018053|Ga0184626_10058329 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1620 | Open in IMG/M |
3300018061|Ga0184619_10023083 | Not Available | 2572 | Open in IMG/M |
3300018061|Ga0184619_10436248 | Not Available | 587 | Open in IMG/M |
3300018063|Ga0184637_10096256 | All Organisms → cellular organisms → Bacteria | 1821 | Open in IMG/M |
3300018071|Ga0184618_10179830 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 877 | Open in IMG/M |
3300018071|Ga0184618_10248659 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 752 | Open in IMG/M |
3300018072|Ga0184635_10266231 | Not Available | 677 | Open in IMG/M |
3300018076|Ga0184609_10023654 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2464 | Open in IMG/M |
3300018076|Ga0184609_10332348 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 710 | Open in IMG/M |
3300018078|Ga0184612_10412934 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 677 | Open in IMG/M |
3300018079|Ga0184627_10120760 | All Organisms → cellular organisms → Bacteria | 1387 | Open in IMG/M |
3300018081|Ga0184625_10498704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 615 | Open in IMG/M |
3300018429|Ga0190272_10017729 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 3638 | Open in IMG/M |
3300018429|Ga0190272_10046240 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 2485 | Open in IMG/M |
3300018429|Ga0190272_10786171 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 873 | Open in IMG/M |
3300018429|Ga0190272_11980491 | Not Available | 616 | Open in IMG/M |
3300018429|Ga0190272_12004459 | Not Available | 613 | Open in IMG/M |
3300018469|Ga0190270_11634619 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 697 | Open in IMG/M |
3300018469|Ga0190270_12176825 | Not Available | 615 | Open in IMG/M |
3300018476|Ga0190274_10183692 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
3300018476|Ga0190274_12757882 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 588 | Open in IMG/M |
3300018920|Ga0190273_10755972 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 764 | Open in IMG/M |
3300019360|Ga0187894_10099383 | All Organisms → cellular organisms → Bacteria | 1560 | Open in IMG/M |
3300019377|Ga0190264_10047453 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1703 | Open in IMG/M |
3300019377|Ga0190264_10094712 | Not Available | 1380 | Open in IMG/M |
3300019879|Ga0193723_1062665 | All Organisms → cellular organisms → Bacteria | 1081 | Open in IMG/M |
3300019883|Ga0193725_1001677 | All Organisms → cellular organisms → Bacteria | 6404 | Open in IMG/M |
3300019883|Ga0193725_1013436 | All Organisms → cellular organisms → Bacteria | 2296 | Open in IMG/M |
3300019883|Ga0193725_1021119 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1780 | Open in IMG/M |
3300019883|Ga0193725_1028601 | All Organisms → cellular organisms → Bacteria | 1496 | Open in IMG/M |
3300019886|Ga0193727_1037619 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1620 | Open in IMG/M |
3300019997|Ga0193711_1046340 | Not Available | 524 | Open in IMG/M |
3300019998|Ga0193710_1018829 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
3300020060|Ga0193717_1125251 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 784 | Open in IMG/M |
3300021078|Ga0210381_10218315 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 670 | Open in IMG/M |
3300021412|Ga0193736_1054386 | Not Available | 553 | Open in IMG/M |
3300024347|Ga0179591_1118485 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2498 | Open in IMG/M |
3300025910|Ga0207684_10022673 | All Organisms → cellular organisms → Bacteria | 5360 | Open in IMG/M |
3300025910|Ga0207684_11124365 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 653 | Open in IMG/M |
3300025922|Ga0207646_11185952 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 670 | Open in IMG/M |
3300025923|Ga0207681_10024806 | All Organisms → cellular organisms → Bacteria | 3850 | Open in IMG/M |
3300025925|Ga0207650_10000872 | All Organisms → cellular organisms → Bacteria | 22890 | Open in IMG/M |
3300025925|Ga0207650_10284855 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1346 | Open in IMG/M |
3300025931|Ga0207644_11370672 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 594 | Open in IMG/M |
3300025934|Ga0207686_11121128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 642 | Open in IMG/M |
3300025936|Ga0207670_10196929 | Not Available | 1528 | Open in IMG/M |
3300026075|Ga0207708_10276737 | All Organisms → cellular organisms → Bacteria | 1359 | Open in IMG/M |
3300026088|Ga0207641_10022383 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5203 | Open in IMG/M |
3300026089|Ga0207648_10952604 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 803 | Open in IMG/M |
3300026095|Ga0207676_10835785 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 900 | Open in IMG/M |
3300026118|Ga0207675_101433015 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 711 | Open in IMG/M |
3300026285|Ga0209438_1003237 | All Organisms → cellular organisms → Bacteria | 5489 | Open in IMG/M |
3300028705|Ga0307276_10138128 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 614 | Open in IMG/M |
3300028814|Ga0307302_10705510 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 502 | Open in IMG/M |
3300031456|Ga0307513_10446896 | Not Available | 1018 | Open in IMG/M |
3300031456|Ga0307513_10613844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 796 | Open in IMG/M |
3300031720|Ga0307469_10257266 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 1410 | Open in IMG/M |
3300031720|Ga0307469_10993742 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium | 783 | Open in IMG/M |
3300032174|Ga0307470_10256471 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1159 | Open in IMG/M |
3300032180|Ga0307471_100503852 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1359 | Open in IMG/M |
3300033814|Ga0364930_0142958 | All Organisms → cellular organisms → Bacteria | 817 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 13.24% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 12.75% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 11.27% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 9.31% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 8.33% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 4.41% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 3.92% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 3.92% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.45% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 2.45% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.45% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 1.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.47% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 1.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.47% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.47% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.47% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
Ectomycorrhiza | Host-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.49% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.49% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.49% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.49% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 0.49% |
Sediment | Environmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment | 0.49% |
Soil | Environmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil | 0.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 0.49% |
Quercus Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere | 0.49% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.49% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.49% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 0.49% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.49% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.49% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 0.49% |
Switchgrass, Maize And Mischanthus Litter | Engineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2170459017 | Litter degradation ZMR4 | Engineered | Open in IMG/M |
3300000532 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled | Host-Associated | Open in IMG/M |
3300000887 | Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illumina | Environmental | Open in IMG/M |
3300000891 | Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soil | Environmental | Open in IMG/M |
3300001431 | Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemly | Environmental | Open in IMG/M |
3300002886 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm | Environmental | Open in IMG/M |
3300002907 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cm | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 | Host-Associated | Open in IMG/M |
3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 | Host-Associated | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Host-Associated | Open in IMG/M |
3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Environmental | Open in IMG/M |
3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Host-Associated | Open in IMG/M |
3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Host-Associated | Open in IMG/M |
3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Host-Associated | Open in IMG/M |
3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Environmental | Open in IMG/M |
3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Environmental | Open in IMG/M |
3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Environmental | Open in IMG/M |
3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Environmental | Open in IMG/M |
3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Host-Associated | Open in IMG/M |
3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Environmental | Open in IMG/M |
3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Environmental | Open in IMG/M |
3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Environmental | Open in IMG/M |
3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Environmental | Open in IMG/M |
3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300007004 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost | Environmental | Open in IMG/M |
3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Host-Associated | Open in IMG/M |
3300009143 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 | Environmental | Open in IMG/M |
3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010400 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2 | Environmental | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010999 | Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015 | Environmental | Open in IMG/M |
3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Host-Associated | Open in IMG/M |
3300011270 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaG | Environmental | Open in IMG/M |
3300011414 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2 | Environmental | Open in IMG/M |
3300011444 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2 | Environmental | Open in IMG/M |
3300011998 | Permafrost microbial communities from Nunavut, Canada - A30_35cm_6M | Environmental | Open in IMG/M |
3300012034 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2 | Environmental | Open in IMG/M |
3300012035 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2 | Environmental | Open in IMG/M |
3300012198 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaG | Environmental | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012203 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaG | Environmental | Open in IMG/M |
3300012208 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaG | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
3300012353 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaG | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012918 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaG | Environmental | Open in IMG/M |
3300012922 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaG | Environmental | Open in IMG/M |
3300012923 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaG | Environmental | Open in IMG/M |
3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012930 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300013294 | Permafrost microbial communities from Nunavut, Canada - A3_65cm_0M | Environmental | Open in IMG/M |
3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300013765 | Permafrost microbial communities from Nunavut, Canada - A30_80cm_6M | Environmental | Open in IMG/M |
3300014056 | Permafrost microbial communities from Nunavut, Canada - A20_5cm_0M | Environmental | Open in IMG/M |
3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
3300014873 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10D | Environmental | Open in IMG/M |
3300014883 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10D | Environmental | Open in IMG/M |
3300015254 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10D | Environmental | Open in IMG/M |
3300015359 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015 | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300018000 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coex | Environmental | Open in IMG/M |
3300018027 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coex | Environmental | Open in IMG/M |
3300018028 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coex | Environmental | Open in IMG/M |
3300018051 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1 | Environmental | Open in IMG/M |
3300018052 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2 | Environmental | Open in IMG/M |
3300018053 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1 | Environmental | Open in IMG/M |
3300018061 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1 | Environmental | Open in IMG/M |
3300018063 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2 | Environmental | Open in IMG/M |
3300018071 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1 | Environmental | Open in IMG/M |
3300018072 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2 | Environmental | Open in IMG/M |
3300018076 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coex | Environmental | Open in IMG/M |
3300018078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coex | Environmental | Open in IMG/M |
3300018079 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1 | Environmental | Open in IMG/M |
3300018081 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1 | Environmental | Open in IMG/M |
3300018429 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018476 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 T | Environmental | Open in IMG/M |
3300018920 | Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 IS | Environmental | Open in IMG/M |
3300019360 | White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaG | Environmental | Open in IMG/M |
3300019377 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 T | Environmental | Open in IMG/M |
3300019879 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2 | Environmental | Open in IMG/M |
3300019883 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2 | Environmental | Open in IMG/M |
3300019886 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2 | Environmental | Open in IMG/M |
3300019997 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2 | Environmental | Open in IMG/M |
3300019998 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1 | Environmental | Open in IMG/M |
3300020060 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2 | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021412 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1 | Environmental | Open in IMG/M |
3300024347 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) | Environmental | Open in IMG/M |
3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026285 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes) | Environmental | Open in IMG/M |
3300028705 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115 | Environmental | Open in IMG/M |
3300028814 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183 | Environmental | Open in IMG/M |
3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Host-Associated | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300033814 | Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
4ZMR_02730950 | 2170459017 | Switchgrass, Maize And Mischanthus Litter | MIAPRQIAGGMEFLLTVGISAVAGLLAFLLVSLVVNVLGLSGA |
CNAas_10186492 | 3300000532 | Quercus Rhizosphere | MIAPKSLTGGMEFLVTVGVSAVAGLLAFLFVSLIVC |
AL16A1W_100673162 | 3300000887 | Permafrost | MIAPKHLAEGMEFLITLAVSVVAGLLAFLFVSLVANILGLSGS* |
JGI10214J12806_104214952 | 3300000891 | Soil | MIAPKQVAGGMEFLVTVGVSALAGLLAFLLVSLVVNVLGLSGG* |
F14TB_1039286092 | 3300001431 | Soil | MIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVLGLSGEVEGGE |
JGI25612J43240_10468631 | 3300002886 | Grasslands Soil | MIMEALPMIAPKQVAGGMEFLVTVGVSAIAGLLAFLFVSLVVTLLGLSGG* |
JGI25613J43889_1000018111 | 3300002907 | Grasslands Soil | MIAPKQVAGGMEFLVTVGVSAIAGLLAFLFVSLVVTLLGLSGG* |
Ga0062593_1007660682 | 3300004114 | Soil | APRQIAGGMEFLLTVGISAVAGLLAFLLVSLVVNVLGLSGA* |
Ga0062589_1015924472 | 3300004156 | Soil | SSLVKQLMIMEALPMIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVANVLGLSGG* |
Ga0062590_1005168071 | 3300004157 | Soil | KQLMIMEALPMIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVVNVLGLSGG* |
Ga0063356_1023378331 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MIVPKNLAEGMEFLITVALSAFAGLLAFLFVSLVVNVLGLSGN* |
Ga0062595_1006038132 | 3300004479 | Soil | MITSKNFAGGMEFLVTVGVSAIAGLLAFLLVSLIANVFGL* |
Ga0062592_1003848921 | 3300004480 | Soil | MIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVANVLGLSGG* |
Ga0066688_102829482 | 3300005178 | Soil | MIAPKNLAEGTEFVVTIIVSAVAGLLAFLFVSLIVNILGL* |
Ga0065704_101056573 | 3300005289 | Switchgrass Rhizosphere | MIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVVNVLGLSGG* |
Ga0065712_101582432 | 3300005290 | Miscanthus Rhizosphere | MIMEALPVIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLSGG* |
Ga0065715_101546852 | 3300005293 | Miscanthus Rhizosphere | MIAPKQVAGGMEFLVTVGVSAVAGLLAFLLVSLVVNVLGLSGG* |
Ga0065715_109284831 | 3300005293 | Miscanthus Rhizosphere | MIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLSGG* |
Ga0065707_110599141 | 3300005295 | Switchgrass Rhizosphere | APKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVVNVLGLSGG* |
Ga0070676_107697251 | 3300005328 | Miscanthus Rhizosphere | MEALPMIAPKQVAGGMEFLLTVGISAVAGLLAFLLVSLVVNVLGLSGA* |
Ga0070690_1007440781 | 3300005330 | Switchgrass Rhizosphere | MIARKNMAGGMEFLVTVGISAAAGLLAFLFVSLVAHVLGLTNG* |
Ga0070670_10000091425 | 3300005331 | Switchgrass Rhizosphere | MIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNALGLFSG* |
Ga0070670_1000731391 | 3300005331 | Switchgrass Rhizosphere | MIAPKDSAGSMEFLVTVGVSAVAGLLAFLLVSLVVNVLGLSGG* |
Ga0068869_1000114786 | 3300005334 | Miscanthus Rhizosphere | MIAPKQVAGGMEFVLTVGLSAVAGLLAFLLVSLVVNVFGLSGG* |
Ga0070682_10000002744 | 3300005337 | Corn Rhizosphere | MIAPKNMAGGMEFLVTVGISAAAGLLAFLFVSVVVHLLGLTNG* |
Ga0070669_1000124406 | 3300005353 | Switchgrass Rhizosphere | MIARKNVAGGMEFLITIGVSAVAGLLAFLLVSVVVNALGLFSG* |
Ga0070673_1009760671 | 3300005364 | Switchgrass Rhizosphere | MIARKNMTGGMEFLMTVGISAAAGLLAFLLVSIVAHMLGLTNG* |
Ga0070703_104567211 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | EALPMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG* |
Ga0070703_106112062 | 3300005406 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKNAAAGMEFLVTVGVSAIAGLLAFLFVSLIANILGLSGG* |
Ga0070701_107196682 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSLIANLLGL* |
Ga0070701_112816541 | 3300005438 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKLKNLDEGTEFAVTIVVSAAAGLLAFLFVALIVYMLGL* |
Ga0070705_1002818852 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIARKNVNGGMEFLVTVGVSAVAGLLAFLLVSVVVHVLGLFSG* |
Ga0070705_1005239922 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVQVLGLFGP* |
Ga0070705_1019085642 | 3300005440 | Corn, Switchgrass And Miscanthus Rhizosphere | MIARKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG* |
Ga0070694_1003681002 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKQVAGGMEFLVTVGLSAVAGLLAFLLVSLVVNVFGLSGQ* |
Ga0070694_1008190562 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | MEALPMIAPKNLAEGTEFLVTIAVSAVAGLAAFLLVALIVNMLGL* |
Ga0070708_1005981941 | 3300005445 | Corn, Switchgrass And Miscanthus Rhizosphere | MIKQKNLDGGTEFLVTMVVSVVAGLLAFLFVALMVKMLGL* |
Ga0068867_1021777631 | 3300005459 | Miscanthus Rhizosphere | MIARKNMTGGMEFLMTVGISAAAGLLAFLLVSIVAHMLGLTAG* |
Ga0070706_1002150913 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKNVAGGMEFLVTVGVSALAGLLAFLFVSLLVSVLGLSGG* |
Ga0070698_10000040533 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKQVAGGMEFLVTVGVSALAGLLAFLFVSLVVSVLGLS* |
Ga0070698_1000977412 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKNLAEGTEFLVTIILSAVAGLLAFLFVSLIVKILGL* |
Ga0070698_1002068142 | 3300005471 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKNLAEGTEFVVTILVSAIAGLVAFLFVSLIVRILGL* |
Ga0070699_1000526663 | 3300005518 | Corn, Switchgrass And Miscanthus Rhizosphere | MEALPMIAPKNLAEGTEFLVTIILSAVAGLLAFLFVSLIVKILGL* |
Ga0070697_10000243710 | 3300005536 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKNLAEGTEFLATIIVSAVAGLLAFLLVSLIVNILGL* |
Ga0070686_1000089245 | 3300005544 | Switchgrass Rhizosphere | LPMITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSLIANILGL* |
Ga0070695_1006542622 | 3300005545 | Corn, Switchgrass And Miscanthus Rhizosphere | MEALPMIAPKNLAEGTEFLVTIVVSAVAGLAAFLLVALIVYLLGL* |
Ga0070704_1009438472 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKTLAEGTEFLVTIVVSAVAGLAAFLLVALIVYLLGL* |
Ga0070702_1003443131 | 3300005615 | Corn, Switchgrass And Miscanthus Rhizosphere | MIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNVLGLFSGY* |
Ga0068852_1019143471 | 3300005616 | Corn Rhizosphere | MIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVN |
Ga0068859_1011183902 | 3300005617 | Switchgrass Rhizosphere | MEALPMIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNALGLFSG* |
Ga0068864_1014259712 | 3300005618 | Switchgrass Rhizosphere | MIMEALPMIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVVNVLGLSGG* |
Ga0068861_1008437891 | 3300005719 | Switchgrass Rhizosphere | MEALPMIAPKNFAEGTEFVVTILVSAVAGLLAFLLVALIVQVLGL* |
Ga0068863_1000678402 | 3300005841 | Switchgrass Rhizosphere | MIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNVLGLFSG* |
Ga0068863_1018736901 | 3300005841 | Switchgrass Rhizosphere | MIMETLPMIAPRQIAGGMEFLLTVGISAVAGLLAFLLVSLVVNVLGLSGA* |
Ga0068862_1002716153 | 3300005844 | Switchgrass Rhizosphere | MIAPKDSAGSMEFLVTIGVSAVAGLLAFLLVSLVVNVLGLSGG* |
Ga0081540_10527031 | 3300005983 | Tabebuia Heterophylla Rhizosphere | MIARKNVAGGMEFLLTVGLSAVAGLLAFLLVALVVNVLGLSG* |
Ga0079217_106345042 | 3300006876 | Agricultural Soil | MIVPKNLAEGMEFLLTVGLSAFAGLLAFLFVSLIVNVLGLSGT* |
Ga0079218_113234692 | 3300007004 | Agricultural Soil | MIAPKNLAEGTEFLATIILSAVAGLLAFLFVSLIVKILGL* |
Ga0105245_109857492 | 3300009098 | Miscanthus Rhizosphere | MIAPKQVAGGMEFLLTVGISAVAGLLAFLLVSLVVNVLGLSGA* |
Ga0099792_109693482 | 3300009143 | Vadose Zone Soil | MEALPMIAPKNLAEGTEFVVTILVSAIAGLVAFLCVSLIVRILGL* |
Ga0105243_107828292 | 3300009148 | Miscanthus Rhizosphere | MIAPKDSTESMEFLVTVGVSAVAGMLAFLLVSLVVNVLGLSGG* |
Ga0105243_109012411 | 3300009148 | Miscanthus Rhizosphere | MIARKNVNGGMEFLITVGVSAVAGLLAFLLVSVVVHVLGLVGG* |
Ga0105241_107052362 | 3300009174 | Corn Rhizosphere | MIAPKNIAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG* |
Ga0105241_107586213 | 3300009174 | Corn Rhizosphere | MIAPKNVAGGMEFLVTVGVSAIAGLLAFLFVSLVVSVLGLSGG* |
Ga0105242_108611081 | 3300009176 | Miscanthus Rhizosphere | MIMEALPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLFVTLVVNVLGLSGG* |
Ga0105242_119591121 | 3300009176 | Miscanthus Rhizosphere | MIARKNVNGGMEFLVTVGVSAVAGLLAFLLVSVVVHVLGLVGG* |
Ga0134125_120253592 | 3300010371 | Terrestrial Soil | MIARKNVAGGMEFLLTVGVSALAGLLAFLFVSVVVQVLGLFSG* |
Ga0134128_107186972 | 3300010373 | Terrestrial Soil | MIARKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLSGG* |
Ga0134124_103500241 | 3300010397 | Terrestrial Soil | MIAPRQIAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLSGG* |
Ga0134124_131211981 | 3300010397 | Terrestrial Soil | MIARKNVNGGMEFLITVGVSAVAGLLAFLFVSVVVQVLGLFSG* |
Ga0134127_100813502 | 3300010399 | Terrestrial Soil | MEALPMIAPKQVAGGMEFLVTVGLSAVAGLLAFLLVSLVVNVFGLSGQ* |
Ga0134127_133117992 | 3300010399 | Terrestrial Soil | MIARKNVAGGMEFLVTVGVSAVAGLLAFLLVSVVVQVLGLFSG* |
Ga0134122_107230381 | 3300010400 | Terrestrial Soil | MIAPKTLTGGMEFLVTVGVSAVAGLLAFLFVSLIVCLFGLGN* |
Ga0134122_122649131 | 3300010400 | Terrestrial Soil | MRLEGLPMIVPKNYAEGMEFLLTVIVSAFAGLMAFLLVLLIVYVLGLNSC* |
Ga0134122_127395571 | 3300010400 | Terrestrial Soil | MIAPKQVAGGMEFLLTVGLSAVAGLLAFLFVSLVVNVLGLSGV* |
Ga0134122_129119921 | 3300010400 | Terrestrial Soil | MEALPMITPKISVNCSAKRRNFAEGTEFLLTIVVSAVAGLAAFLLVALIVYLLGL* |
Ga0134122_131183231 | 3300010400 | Terrestrial Soil | PMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVILVVNVLGLSNG* |
Ga0134121_129636842 | 3300010401 | Terrestrial Soil | MIMEALPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLSGG* |
Ga0134123_100563823 | 3300010403 | Terrestrial Soil | MIARKNAAAGMEFLVTVGVSAIAGLLAFLFVSLIANILGLSGG* |
Ga0134123_102562052 | 3300010403 | Terrestrial Soil | MIAPKTLTGGMEFLVTVGVSAVAGLLAFLFVSLIVCLFGLGS* |
Ga0134123_108526002 | 3300010403 | Terrestrial Soil | MIARKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGL |
Ga0134123_111720522 | 3300010403 | Terrestrial Soil | IARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNALGLFSG* |
Ga0134123_120139951 | 3300010403 | Terrestrial Soil | MEALPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVQLVVKIFGLTG* |
Ga0138505_1000542482 | 3300010999 | Soil | MIARKNVTGGMEFLITVGVSAVAGLLAFLLVSVVVNVLGLFSG* |
Ga0105246_108207791 | 3300011119 | Miscanthus Rhizosphere | IMEALPMIAPKDSAGSMEFLVTVGVSAVAGLLAFLLVSLVVNVLGLSGG* |
Ga0105246_117620622 | 3300011119 | Miscanthus Rhizosphere | MIARKNVAGGMEFLITVGVSAMAGLLAFLFVSMVVHVLGL |
Ga0137391_103597382 | 3300011270 | Vadose Zone Soil | MEALPMIAPKNLAEGTEFVVTIVVSAVAGLLAFLFVSLIVKILGL* |
Ga0137442_10371022 | 3300011414 | Soil | MIMEALPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVLGLSGG* |
Ga0137463_10157182 | 3300011444 | Soil | MEVSPMVVPKNVAEGMEFLATVGLSAVAGLLAFLLVTLVVKALGLSSG* |
Ga0120114_10254582 | 3300011998 | Permafrost | MIAPKNLAEGTEFVVTIVVSAVAGLLAFLFVLLMVNILGL* |
Ga0137453_10473882 | 3300012034 | Soil | MIAPKNLAEGTEFLVTMILSAAAGLLAFLFVSLIVNMLGL* |
Ga0137445_11031461 | 3300012035 | Soil | MIAPKNLAEGTEFLVTMILSAAAGLLAFLFVSLIVNMLG |
Ga0137364_103589141 | 3300012198 | Vadose Zone Soil | MVFMEALPMIMPKNLAEGMEFLVTVVLSALAGLLAFLLVSIVATILGLAGS* |
Ga0137364_108075861 | 3300012198 | Vadose Zone Soil | MEALPMIAPKNLAGGMEFIVTVGLSAVAGLLAFLFVSLVVRVLGLSGS* |
Ga0137382_104797721 | 3300012200 | Vadose Zone Soil | MEALPMIAPKNLAEGTEFVVTILVSAVAGLLAFLFVLLMVNILGL* |
Ga0137399_106259812 | 3300012203 | Vadose Zone Soil | MIARKNVAGGMEFLATVGISAVAGLLAFLLVSLVVNILGLTSG* |
Ga0137376_100102543 | 3300012208 | Vadose Zone Soil | MEALPMIAPKNLAEGTEFVVTILVSAIAGLVAFLFVSLIVRILGL* |
Ga0137377_100649733 | 3300012211 | Vadose Zone Soil | MIMPKNLAEGMEFLVTVVLSALAGLLAFLFVSIVATILGLAGS* |
Ga0137447_10249912 | 3300012226 | Soil | MIMEALPMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG* |
Ga0137367_100686364 | 3300012353 | Vadose Zone Soil | MEALPMIVPKNLAEGMEFLITVALSAFAGLLAFLFVSLVVNVLGLSGN* |
Ga0137371_102152362 | 3300012356 | Vadose Zone Soil | MIMPKNLAEGMEFLVTVVLSALAGLLAFLLVSIVATILGLAGS* |
Ga0137373_100583882 | 3300012532 | Vadose Zone Soil | MEVLPMIVPKNLAEGMEFLITVALSAFAGLLAFLFVSLVVNVLGLSGN* |
Ga0137397_100130266 | 3300012685 | Vadose Zone Soil | MEALPMIAPEKVAEGTEFVVTIVVSAVAGLLAFLFVWLIVNILGL* |
Ga0137397_101591561 | 3300012685 | Vadose Zone Soil | MKEIFCNALETLPMIKQKNLDEGTEFAVTIVVSAVAGLLAFLFVALIVNMLGL* |
Ga0137397_101607182 | 3300012685 | Vadose Zone Soil | MEDLPMIAPKHQAEGMEFLITVVLSAFAGLAAFLLVSLVVNILGLSGS* |
Ga0137397_101628571 | 3300012685 | Vadose Zone Soil | MEALPMIAPKNLAEGTEFVVTILVSAVAGLVAFLFVSLIVRILGL* |
Ga0137395_102786631 | 3300012917 | Vadose Zone Soil | MEALPMIAPKNLAEGTEFVVTIIVSAVAGLLAFLFVSLIVNILGL* |
Ga0137396_104075292 | 3300012918 | Vadose Zone Soil | MEALPMITTKNLAEGMEFLITLVLSAVAGLLAFLFVSL |
Ga0137396_111784161 | 3300012918 | Vadose Zone Soil | MIAPKNLAAGMEFFMTVFVSAVAGLLAFLLVCLVVNVIGLSGG* |
Ga0137394_106089832 | 3300012922 | Vadose Zone Soil | MEALPMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG* |
Ga0137359_108757951 | 3300012923 | Vadose Zone Soil | MVFVEALPMIMPKNLAEGMEFLVTVVLSALAGLLAFLLVSIVATILGLAGS* |
Ga0137413_109464481 | 3300012924 | Vadose Zone Soil | MITPKHLAGGMEFLVTVGLSAVAGLLAFLLVSLVVNILGLAAG* |
Ga0137416_118908971 | 3300012927 | Vadose Zone Soil | MIKQKNLDEGTEFAVTIVVSAVAGLLAFLFVALIVNMLGL* |
Ga0137404_101440372 | 3300012929 | Vadose Zone Soil | MITPKDFAEGMELLITLALSLVAGLLAFLFVSLVVNVLGLSGG* |
Ga0137407_100106266 | 3300012930 | Vadose Zone Soil | MITPKDVAEGMELLITLVLSLVAGLLAFLFVSLVVNILGLSGS* |
Ga0137407_119145501 | 3300012930 | Vadose Zone Soil | MEALPMITPKDLAEGMELLITLVLSLVAGLLAFLFVSLVVNILGLSGS* |
Ga0137410_100439532 | 3300012944 | Vadose Zone Soil | MEALPMIAPKNLAGGMEFLITVGLSAIAGLLAFLFVTLVVSVLGLSGG* |
Ga0164300_101276922 | 3300012951 | Soil | MIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVLGLSG* |
Ga0164303_104478861 | 3300012957 | Soil | LIMEALPMIAPKNFAEGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG* |
Ga0120150_10134443 | 3300013294 | Permafrost | SAQRLVRRLSPMIAPKHLAEGMEFLITLAVSVVAGLLAFLFVSLVANILGLSGS* |
Ga0157378_101679981 | 3300013297 | Miscanthus Rhizosphere | MITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSL |
Ga0157378_102311662 | 3300013297 | Miscanthus Rhizosphere | MIAPKNLAEGTEFLVTIVVSAVAGLAAFLLVALIVYLLGL* |
Ga0157378_130415931 | 3300013297 | Miscanthus Rhizosphere | ALPMITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSLIANLLGL* |
Ga0157378_130415951 | 3300013297 | Miscanthus Rhizosphere | ALPMITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSLIANILGL* |
Ga0157375_126006581 | 3300013308 | Miscanthus Rhizosphere | MEALPMIAPKTLAEGTEFLVTIIVSLVAGLAAFLLVALIVYLLGL* |
Ga0120172_10050665 | 3300013765 | Permafrost | RLVRRLSPMIAPKHLAEGMEFLITLAVSVVAGLLAFLFVSLVANILGLSGS* |
Ga0120125_10447263 | 3300014056 | Permafrost | NLAEGTEFVVTIVVSAVAGLLAFLFVLLMVNILGL* |
Ga0157380_100498273 | 3300014326 | Switchgrass Rhizosphere | MITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSLIANILGL* |
Ga0157380_118601391 | 3300014326 | Switchgrass Rhizosphere | MIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSAVVRLFGLAG* |
Ga0157380_129308411 | 3300014326 | Switchgrass Rhizosphere | MIARKNMTGGMEFLMTVGISAAAGLLAFLLVSIVAHMLGLTTG* |
Ga0180066_10240122 | 3300014873 | Soil | MIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG* |
Ga0180086_10008012 | 3300014883 | Soil | MEALPMIVPKNLAEGMEFLITVALSAFAGVLAFLFVSLVVNLLGLSGS* |
Ga0180089_10136233 | 3300015254 | Soil | MIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLVLSGG* |
Ga0134085_104353422 | 3300015359 | Grasslands Soil | MIAPKNLAEGTEFVVTIVVSAVAGLLAFLFVLLMV |
Ga0132258_128026822 | 3300015371 | Arabidopsis Rhizosphere | MIAPKQVAGGMEFLVTVGVSALAGLLAFLFVSLVVNVLGLSGG* |
Ga0132256_1004667382 | 3300015372 | Arabidopsis Rhizosphere | MIMEALPMIAPKQVAGGMEFLVTVGVSALAGLLAFLFVSLVVNVLGLSGG* |
Ga0184604_100599602 | 3300018000 | Groundwater Sediment | MIARKNVDGGMEFLLTVGVSAVAGLLAFLFVTVVVHVLGLFSG |
Ga0184605_104722711 | 3300018027 | Groundwater Sediment | MEALPMIARKNVDGGMEFLLTVGVSAVAGLLAFLLVTVVVHVLGLFSG |
Ga0184605_105145791 | 3300018027 | Groundwater Sediment | MITSKNLAEGMEFLITLVLSAVAGLLAFLFVSLIVNVLGLAGN |
Ga0184608_101126571 | 3300018028 | Groundwater Sediment | MIARKNVDGGIEFLLTVGVSAVAGLLAFLFVTVVVHVLGLFSG |
Ga0184608_102716351 | 3300018028 | Groundwater Sediment | MEGLPMIAPKNQAEGMEFLITVVLSAFAGLVAFLLVSLVVNILGLSGS |
Ga0184620_100512541 | 3300018051 | Groundwater Sediment | MIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVANVFGLSGG |
Ga0184638_12498532 | 3300018052 | Groundwater Sediment | MIALKNFAGGMEFLITVGVSAVAGLLAFLFVSLIVSVLGLGS |
Ga0184626_100583292 | 3300018053 | Groundwater Sediment | MIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG |
Ga0184619_100230833 | 3300018061 | Groundwater Sediment | KIMEALPMIARKNVDGGMEFLLTVGVSAVAGLLAFLLVTLVVQVLGLFSG |
Ga0184619_104362481 | 3300018061 | Groundwater Sediment | MLRMEALPMIAPEKVAEGTEFVVTIVVSAVAGLLAFLFVWLVVNILGL |
Ga0184637_100962562 | 3300018063 | Groundwater Sediment | MTVPKNLAEGMEFLITVVLSAFAGLLAFLFVSLVVNILGLSGS |
Ga0184618_101798301 | 3300018071 | Groundwater Sediment | MEALPMIARKNVDGGMEFLLTVGVSAVAGLLAFLLVTLVVQVLGLFSG |
Ga0184618_102486591 | 3300018071 | Groundwater Sediment | MIAPKNLAEGTEFVVTIAVSAVAGLLAFIFVELIVSILGL |
Ga0184635_102662312 | 3300018072 | Groundwater Sediment | MIAPKNVAGSMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG |
Ga0184609_100236543 | 3300018076 | Groundwater Sediment | MIAPKQVAGGMEFVLTVGLSAVAGLLAFLLVSLVVNVFGLSGG |
Ga0184609_103323481 | 3300018076 | Groundwater Sediment | KNVAGGMEFLVTVGVSAIAGLLAFLFVSLVVSVLGLSGG |
Ga0184612_104129341 | 3300018078 | Groundwater Sediment | MIAPKNVAVGMEFLVTVGVSAVAGLLAFLFVSLVVSVL |
Ga0184627_101207601 | 3300018079 | Groundwater Sediment | MTVPKNLAEGMEFLITVALSAFAGLLAFLFVSLVVNILGLSGS |
Ga0184625_104987042 | 3300018081 | Groundwater Sediment | MIMEALPMIAPKNVAGSMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG |
Ga0190272_100177292 | 3300018429 | Soil | MIALKNFAGGMEFLITVGVSAGVGVLTFLFALLIFCVLGPGC |
Ga0190272_100462401 | 3300018429 | Soil | MIAPKNLAAGTEFLITIGVCAIAGLLMFLLVALIVSVLGLA |
Ga0190272_107861712 | 3300018429 | Soil | MIAPKTMAEGTEFLVTILVSAVAGLLAFLLVALIVNLLGL |
Ga0190272_119804911 | 3300018429 | Soil | MIAPKNLAGGTEFFITIGVCAFAGLLMFMLVALIFCFVGLA |
Ga0190272_120044592 | 3300018429 | Soil | METLPMIAPKDLAGGTEFFITIGVCAFAGLLMFVLVALIFCLVGLA |
Ga0190270_116346192 | 3300018469 | Soil | MIAPKNIAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG |
Ga0190270_121768252 | 3300018469 | Soil | MIARKNVDGGMEFLVTVGISAAAGLLAFLLVSVVVHVLGLFSG |
Ga0190274_101836922 | 3300018476 | Soil | MIAPKNLAEGTEFLVTIVVSAVAGLAAFLLVALIVYLLGL |
Ga0190274_127578821 | 3300018476 | Soil | PMIARKNVDGGMEFLVTVGVSAVAGLLAFLLVSVVVHVLGLSG |
Ga0190273_107559722 | 3300018920 | Soil | MIARKNVEGGMEFLLTVGVSAVAGLLAFLFVTVVVHVLGLFSG |
Ga0187894_100993832 | 3300019360 | Microbial Mat On Rocks | MIARKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVAKLFGLA |
Ga0190264_100474531 | 3300019377 | Soil | MIARKNVDGGMEFLVTVGVSAAAGLLAFLLVSVVVHVLGLF |
Ga0190264_100947122 | 3300019377 | Soil | MIARKNVEGGMEFLLTVGVSAVAGLLAFLFVTVVVHVLGLFSC |
Ga0193723_10626652 | 3300019879 | Soil | MIARKNVAGGMEFLATVGISAVAGLLAFLLVSLVVNILGLTSG |
Ga0193725_10016773 | 3300019883 | Soil | MIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLTGG |
Ga0193725_10134361 | 3300019883 | Soil | MITPKDAAEGMELLITLALSLVAGLLAFLFVSLVVNVLGLSGG |
Ga0193725_10211192 | 3300019883 | Soil | MIARKQVAGGVEFLLIVGASAVAGLLAFLFVSLVVNILGLSGG |
Ga0193725_10286013 | 3300019883 | Soil | MIAPKNLAGGMEFLLTVGLSAIAGLLAFLFVSLIVRVLGLGS |
Ga0193727_10376192 | 3300019886 | Soil | MIAPKNVAGGMEFLVTVGVSALAGLLAFLFVSLVVSLLGLSGG |
Ga0193711_10463402 | 3300019997 | Soil | MIAPKQVAGGMEFVLTVGLSAVAGLLAFLLVSLVVNVFGLSG |
Ga0193710_10188291 | 3300019998 | Soil | MNQSMIMEALPMIAPKQVAGGMEFVLTVGLSAVAGLLAFLLVSLVVNVFGLSG |
Ga0193717_11252512 | 3300020060 | Soil | MIAPKALAGGMEFLVTVGVSAIAGLLAFFLVVLVVSVLGLGC |
Ga0210381_102183152 | 3300021078 | Groundwater Sediment | MEALPMIVSKNLAEGLEFLLTVALSAFAGLLAFLLVSLVVNLLGLSGS |
Ga0193736_10543863 | 3300021412 | Soil | MIARKNVDGGMEFLVTVGVSAAAGLLAFLLVSVVVHVL |
Ga0179591_11184858 | 3300024347 | Vadose Zone Soil | MEALPMIARKNVAGGMEFLLTVGLSAIAGLLAFLFVSLLVTLLGLG |
Ga0207684_100226735 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKNVAGGMEFLVTVGVSALAGLLAFLFVSLLVSVLGLSGG |
Ga0207684_111243652 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKNAAAGMEFLVTVGVSAIAGLLAFLFVSLIANILGLSGG |
Ga0207646_111859522 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKNAAAGMEFLVTVGVSAIAGLLAFLFVSLIA |
Ga0207681_100248061 | 3300025923 | Switchgrass Rhizosphere | MIARKNVAGGMEFLITIGVSAVAGLLAFLLVSVVVNALGLFSG |
Ga0207650_1000087221 | 3300025925 | Switchgrass Rhizosphere | MIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNALGLFSG |
Ga0207650_102848552 | 3300025925 | Switchgrass Rhizosphere | MIARKNMTGGMEFLMTVGISAAAGLLAFLLVSIVAHLLGLTTG |
Ga0207644_113706722 | 3300025931 | Switchgrass Rhizosphere | SLIMEALPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVLGLSG |
Ga0207686_111211281 | 3300025934 | Miscanthus Rhizosphere | MIARKNVNGGMEFLVTVGVSAVAGLLAFLLVSVVVHVLGLVGG |
Ga0207670_101969292 | 3300025936 | Switchgrass Rhizosphere | MIARKNMAGGMEFLVTVGISAAAGLLAFLFVSLVAHVLGLTNG |
Ga0207708_102767372 | 3300026075 | Corn, Switchgrass And Miscanthus Rhizosphere | MIAPKQVAGGMEFLVTVGVSAVAGLLAFLLVSLVVNVLGLSGG |
Ga0207641_100223832 | 3300026088 | Switchgrass Rhizosphere | MIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNVLGLFSG |
Ga0207648_109526042 | 3300026089 | Miscanthus Rhizosphere | MIARKNMTGGMEFLMTVGISAAAGLLAFLLVSIVAHMLGLTAG |
Ga0207676_108357852 | 3300026095 | Switchgrass Rhizosphere | MIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVVNVLGLSGG |
Ga0207675_1014330152 | 3300026118 | Switchgrass Rhizosphere | MIAPKNFAEGTEFVVTILVSAVAGLLAFLLVALIVQVL |
Ga0209438_10032373 | 3300026285 | Grasslands Soil | MIAPKQVAGGMEFLVTVGVSAIAGLLAFLFVSLVVTLLGLSGG |
Ga0307276_101381281 | 3300028705 | Soil | MIVPKNFTEGMEFLITVALSAFAGLLAFLFVSLVVNVLGLSGR |
Ga0307302_107055101 | 3300028814 | Soil | MEALPMIAPKNLAGGMEFLVTVGVSAVAGLLAFLLVSLIVTVLGLGS |
Ga0307513_104468961 | 3300031456 | Ectomycorrhiza | LMIMEALPMIAPKQVAGGIEFLLTVGLSAVAGLLAFLLVILVVNVLGLSTG |
Ga0307513_106138442 | 3300031456 | Ectomycorrhiza | MIAPKQVAGGMEFLLTVGLSAVAGLLAFLFVSLVVKIFGLSG |
Ga0307469_102572662 | 3300031720 | Hardwood Forest Soil | MIARKQVAGGMEFLLTVGASAVAGLLAFLFVSLVVNILGLS |
Ga0307469_109937421 | 3300031720 | Hardwood Forest Soil | KDFAERMEFLITVSLSAFAGLLAFLLVSLVVNILGLS |
Ga0307470_102564711 | 3300032174 | Hardwood Forest Soil | MRLEGLPMIVPKNYAEGVEFLLTVIVSAFAGLLAFLLVLLIVYILGLNSC |
Ga0307471_1005038521 | 3300032180 | Hardwood Forest Soil | MEALPMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG |
Ga0364930_0142958_634_780 | 3300033814 | Sediment | MEALPMIVPKNLAEGMEFLITVALSAFAGLLAFLFVSLVVNILGLSGN |
⦗Top⦘ |