NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F024926

Metagenome Family F024926

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024926
Family Type Metagenome
Number of Sequences 204
Average Sequence Length 44 residues
Representative Sequence MIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG
Number of Associated Samples 150
Number of Associated Scaffolds 204

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 69.61 %
% of genes near scaffold ends (potentially truncated) 21.08 %
% of genes from short scaffolds (< 2000 bps) 79.90 %
Associated GOLD sequencing projects 141
AlphaFold2 3D model prediction Yes
3D model pTM-score0.53

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.980 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil
(13.235 % of family members)
Environment Ontology (ENVO) Unclassified
(43.627 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(56.863 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 52.11%    β-sheet: 0.00%    Coil/Unstructured: 47.89%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.53
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 204 Family Scaffolds
PF00486Trans_reg_C 38.24
PF00248Aldo_ket_red 25.00
PF13432TPR_16 3.92
PF13414TPR_11 1.47
PF01797Y1_Tnp 0.98
PF01464SLT 0.49
PF13490zf-HC2 0.49
PF07719TPR_2 0.49
PF14534DUF4440 0.49
PF06537DHOR 0.49
PF01066CDP-OH_P_transf 0.49
PF13276HTH_21 0.49
PF13181TPR_8 0.49
PF16884ADH_N_2 0.49
PF04052TolB_N 0.49
PF14294DUF4372 0.49
PF13291ACT_4 0.49
PF01593Amino_oxidase 0.49

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 204 Family Scaffolds
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 0.98
COG0558Phosphatidylglycerophosphate synthaseLipid transport and metabolism [I] 0.49
COG0823Periplasmic component TolB of the Tol biopolymer transport systemIntracellular trafficking, secretion, and vesicular transport [U] 0.49
COG1183Phosphatidylserine synthaseLipid transport and metabolism [I] 0.49
COG3488Uncharacterized conserved protein with two CxxC motifs, DUF1111 familyGeneral function prediction only [R] 0.49
COG5050sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferasesLipid transport and metabolism [I] 0.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.98 %
UnclassifiedrootN/A24.02 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459017|G14TP7Y01AKHZVNot Available536Open in IMG/M
3300000532|CNAas_1018649All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium502Open in IMG/M
3300000887|AL16A1W_10067316All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1472Open in IMG/M
3300000891|JGI10214J12806_10421495All Organisms → cellular organisms → Bacteria2261Open in IMG/M
3300001431|F14TB_103928609All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium818Open in IMG/M
3300002886|JGI25612J43240_1046863Not Available632Open in IMG/M
3300002907|JGI25613J43889_10000181All Organisms → cellular organisms → Bacteria13328Open in IMG/M
3300004114|Ga0062593_100766068Not Available954Open in IMG/M
3300004156|Ga0062589_101592447All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium647Open in IMG/M
3300004157|Ga0062590_100516807All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1023Open in IMG/M
3300004463|Ga0063356_102337833Not Available816Open in IMG/M
3300004479|Ga0062595_100603813All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium855Open in IMG/M
3300004480|Ga0062592_100384892All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1108Open in IMG/M
3300005178|Ga0066688_10282948All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300005289|Ga0065704_10105657All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2105Open in IMG/M
3300005290|Ga0065712_10158243Not Available1320Open in IMG/M
3300005293|Ga0065715_10154685All Organisms → cellular organisms → Bacteria1655Open in IMG/M
3300005293|Ga0065715_10928483Not Available566Open in IMG/M
3300005295|Ga0065707_11059914Not Available502Open in IMG/M
3300005328|Ga0070676_10769725All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium708Open in IMG/M
3300005330|Ga0070690_100744078All Organisms → cellular organisms → Bacteria → Acidobacteria756Open in IMG/M
3300005331|Ga0070670_100000914All Organisms → cellular organisms → Bacteria23199Open in IMG/M
3300005331|Ga0070670_100073139All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2944Open in IMG/M
3300005334|Ga0068869_100011478All Organisms → cellular organisms → Bacteria5811Open in IMG/M
3300005337|Ga0070682_100000027All Organisms → cellular organisms → Bacteria188799Open in IMG/M
3300005353|Ga0070669_100012440All Organisms → cellular organisms → Bacteria6038Open in IMG/M
3300005364|Ga0070673_100976067All Organisms → cellular organisms → Bacteria → Acidobacteria788Open in IMG/M
3300005406|Ga0070703_10456721Not Available567Open in IMG/M
3300005406|Ga0070703_10611206Not Available504Open in IMG/M
3300005438|Ga0070701_10719668Not Available673Open in IMG/M
3300005438|Ga0070701_11281654Not Available523Open in IMG/M
3300005440|Ga0070705_100281885All Organisms → cellular organisms → Bacteria1182Open in IMG/M
3300005440|Ga0070705_100523992All Organisms → cellular organisms → Bacteria → Acidobacteria904Open in IMG/M
3300005440|Ga0070705_101908564Not Available505Open in IMG/M
3300005444|Ga0070694_100368100All Organisms → cellular organisms → Bacteria1118Open in IMG/M
3300005444|Ga0070694_100819056Not Available764Open in IMG/M
3300005445|Ga0070708_100598194All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Ktedonobacteria → Ktedonobacterales → Ktedonobacteraceae → Ktedonobacter → Ktedonobacter racemifer1040Open in IMG/M
3300005459|Ga0068867_102177763Not Available526Open in IMG/M
3300005467|Ga0070706_100215091All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1794Open in IMG/M
3300005471|Ga0070698_100000405All Organisms → cellular organisms → Bacteria45717Open in IMG/M
3300005471|Ga0070698_100097741All Organisms → cellular organisms → Bacteria2912Open in IMG/M
3300005471|Ga0070698_100206814All Organisms → cellular organisms → Bacteria1898Open in IMG/M
3300005518|Ga0070699_100052666All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium3521Open in IMG/M
3300005536|Ga0070697_100002437All Organisms → cellular organisms → Bacteria14314Open in IMG/M
3300005544|Ga0070686_100008924All Organisms → cellular organisms → Bacteria5619Open in IMG/M
3300005545|Ga0070695_100654262Not Available830Open in IMG/M
3300005549|Ga0070704_100943847All Organisms → cellular organisms → Bacteria → Acidobacteria778Open in IMG/M
3300005615|Ga0070702_100344313All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → Blastocatellales → Pyrinomonadaceae → unclassified Pyrinomonadaceae → Pyrinomonadaceae bacterium1047Open in IMG/M
3300005616|Ga0068852_101914347Not Available615Open in IMG/M
3300005617|Ga0068859_101118390Not Available867Open in IMG/M
3300005618|Ga0068864_101425971All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium695Open in IMG/M
3300005719|Ga0068861_100843789All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium863Open in IMG/M
3300005841|Ga0068863_100067840All Organisms → cellular organisms → Bacteria3374Open in IMG/M
3300005841|Ga0068863_101873690All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium610Open in IMG/M
3300005844|Ga0068862_100271615All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1551Open in IMG/M
3300005983|Ga0081540_1052703All Organisms → cellular organisms → Bacteria → Acidobacteria2000Open in IMG/M
3300006876|Ga0079217_10634504All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium702Open in IMG/M
3300007004|Ga0079218_11323469Not Available761Open in IMG/M
3300009098|Ga0105245_10985749All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium887Open in IMG/M
3300009143|Ga0099792_10969348All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300009148|Ga0105243_10782829All Organisms → cellular organisms → Bacteria → Acidobacteria938Open in IMG/M
3300009148|Ga0105243_10901241All Organisms → cellular organisms → Bacteria → Acidobacteria880Open in IMG/M
3300009174|Ga0105241_10705236All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium922Open in IMG/M
3300009174|Ga0105241_10758621All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium890Open in IMG/M
3300009176|Ga0105242_10861108All Organisms → cellular organisms → Bacteria → Acidobacteria903Open in IMG/M
3300009176|Ga0105242_11959112Not Available627Open in IMG/M
3300010371|Ga0134125_12025359Not Available626Open in IMG/M
3300010373|Ga0134128_10718697All Organisms → cellular organisms → Bacteria1109Open in IMG/M
3300010397|Ga0134124_10350024All Organisms → cellular organisms → Bacteria → Acidobacteria1391Open in IMG/M
3300010397|Ga0134124_13121198Not Available507Open in IMG/M
3300010399|Ga0134127_10081350All Organisms → cellular organisms → Bacteria2784Open in IMG/M
3300010399|Ga0134127_13311799Not Available527Open in IMG/M
3300010400|Ga0134122_10723038All Organisms → cellular organisms → Bacteria → Acidobacteria939Open in IMG/M
3300010400|Ga0134122_12264913All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium588Open in IMG/M
3300010400|Ga0134122_12739557Not Available545Open in IMG/M
3300010400|Ga0134122_12911992All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium532Open in IMG/M
3300010400|Ga0134122_13118323Not Available518Open in IMG/M
3300010401|Ga0134121_12963684All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium522Open in IMG/M
3300010403|Ga0134123_10056382All Organisms → cellular organisms → Bacteria2978Open in IMG/M
3300010403|Ga0134123_10256205Not Available1526Open in IMG/M
3300010403|Ga0134123_10852600All Organisms → cellular organisms → Bacteria → Acidobacteria911Open in IMG/M
3300010403|Ga0134123_11172052Not Available797Open in IMG/M
3300010403|Ga0134123_12013995Not Available636Open in IMG/M
3300010999|Ga0138505_100054248All Organisms → cellular organisms → Bacteria → Acidobacteria581Open in IMG/M
3300011119|Ga0105246_10820779All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium827Open in IMG/M
3300011119|Ga0105246_11762062All Organisms → cellular organisms → Bacteria → Acidobacteria590Open in IMG/M
3300011270|Ga0137391_10359738All Organisms → cellular organisms → Bacteria1249Open in IMG/M
3300011414|Ga0137442_1037102All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium942Open in IMG/M
3300011444|Ga0137463_1015718All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2664Open in IMG/M
3300011998|Ga0120114_1025458All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300012034|Ga0137453_1047388All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium772Open in IMG/M
3300012035|Ga0137445_1103146All Organisms → cellular organisms → Bacteria → Acidobacteria578Open in IMG/M
3300012198|Ga0137364_10358914All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1088Open in IMG/M
3300012198|Ga0137364_10807586All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium709Open in IMG/M
3300012200|Ga0137382_10479772All Organisms → cellular organisms → Bacteria → Acidobacteria882Open in IMG/M
3300012203|Ga0137399_10625981All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium905Open in IMG/M
3300012208|Ga0137376_10010254All Organisms → cellular organisms → Bacteria6660Open in IMG/M
3300012211|Ga0137377_10064973All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3405Open in IMG/M
3300012226|Ga0137447_1024991All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium950Open in IMG/M
3300012353|Ga0137367_10068636All Organisms → cellular organisms → Bacteria2635Open in IMG/M
3300012356|Ga0137371_10215236Not Available1503Open in IMG/M
3300012532|Ga0137373_10058388All Organisms → cellular organisms → Bacteria3546Open in IMG/M
3300012685|Ga0137397_10013026All Organisms → cellular organisms → Bacteria5817Open in IMG/M
3300012685|Ga0137397_10159156All Organisms → cellular organisms → Bacteria → Acidobacteria1675Open in IMG/M
3300012685|Ga0137397_10160718All Organisms → cellular organisms → Bacteria1666Open in IMG/M
3300012685|Ga0137397_10162857Not Available1655Open in IMG/M
3300012917|Ga0137395_10278663All Organisms → cellular organisms → Bacteria → Acidobacteria1180Open in IMG/M
3300012918|Ga0137396_10407529All Organisms → cellular organisms → Bacteria → Acidobacteria1008Open in IMG/M
3300012918|Ga0137396_11178416All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300012922|Ga0137394_10608983All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium923Open in IMG/M
3300012923|Ga0137359_10875795All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium775Open in IMG/M
3300012924|Ga0137413_10946448Not Available672Open in IMG/M
3300012927|Ga0137416_11890897Not Available546Open in IMG/M
3300012929|Ga0137404_10144037All Organisms → cellular organisms → Bacteria → Acidobacteria1974Open in IMG/M
3300012930|Ga0137407_10010626All Organisms → cellular organisms → Bacteria → Acidobacteria6510Open in IMG/M
3300012930|Ga0137407_11914550Not Available565Open in IMG/M
3300012944|Ga0137410_10043953All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium3161Open in IMG/M
3300012951|Ga0164300_10127692All Organisms → cellular organisms → Bacteria1159Open in IMG/M
3300012957|Ga0164303_10447886Not Available812Open in IMG/M
3300013294|Ga0120150_1013444All Organisms → cellular organisms → Bacteria1719Open in IMG/M
3300013297|Ga0157378_10167998All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2056Open in IMG/M
3300013297|Ga0157378_10231166All Organisms → cellular organisms → Bacteria1762Open in IMG/M
3300013297|Ga0157378_13041593Not Available520Open in IMG/M
3300013297|Ga0157378_13041595Not Available520Open in IMG/M
3300013308|Ga0157375_12600658All Organisms → cellular organisms → Bacteria → Acidobacteria605Open in IMG/M
3300013765|Ga0120172_1005066All Organisms → cellular organisms → Bacteria4593Open in IMG/M
3300014056|Ga0120125_1044726All Organisms → cellular organisms → Bacteria967Open in IMG/M
3300014326|Ga0157380_10049827All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium3305Open in IMG/M
3300014326|Ga0157380_11860139All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300014326|Ga0157380_12930841Not Available543Open in IMG/M
3300014873|Ga0180066_1024012All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1133Open in IMG/M
3300014883|Ga0180086_1000801All Organisms → cellular organisms → Bacteria5197Open in IMG/M
3300015254|Ga0180089_1013623All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1437Open in IMG/M
3300015359|Ga0134085_10435342All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium593Open in IMG/M
3300015371|Ga0132258_12802682All Organisms → cellular organisms → Bacteria1214Open in IMG/M
3300015372|Ga0132256_100466738All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300018000|Ga0184604_10059960All Organisms → cellular organisms → Bacteria1079Open in IMG/M
3300018027|Ga0184605_10472271Not Available550Open in IMG/M
3300018027|Ga0184605_10514579All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium520Open in IMG/M
3300018028|Ga0184608_10112657Not Available1146Open in IMG/M
3300018028|Ga0184608_10271635All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium746Open in IMG/M
3300018051|Ga0184620_10051254All Organisms → cellular organisms → Bacteria → Acidobacteria1161Open in IMG/M
3300018052|Ga0184638_1249853All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium611Open in IMG/M
3300018053|Ga0184626_10058329All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1620Open in IMG/M
3300018061|Ga0184619_10023083Not Available2572Open in IMG/M
3300018061|Ga0184619_10436248Not Available587Open in IMG/M
3300018063|Ga0184637_10096256All Organisms → cellular organisms → Bacteria1821Open in IMG/M
3300018071|Ga0184618_10179830All Organisms → cellular organisms → Bacteria → Acidobacteria877Open in IMG/M
3300018071|Ga0184618_10248659All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium752Open in IMG/M
3300018072|Ga0184635_10266231Not Available677Open in IMG/M
3300018076|Ga0184609_10023654All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2464Open in IMG/M
3300018076|Ga0184609_10332348All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium710Open in IMG/M
3300018078|Ga0184612_10412934All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium677Open in IMG/M
3300018079|Ga0184627_10120760All Organisms → cellular organisms → Bacteria1387Open in IMG/M
3300018081|Ga0184625_10498704All Organisms → cellular organisms → Bacteria → Acidobacteria615Open in IMG/M
3300018429|Ga0190272_10017729All Organisms → cellular organisms → Bacteria → Acidobacteria3638Open in IMG/M
3300018429|Ga0190272_10046240All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium2485Open in IMG/M
3300018429|Ga0190272_10786171All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium873Open in IMG/M
3300018429|Ga0190272_11980491Not Available616Open in IMG/M
3300018429|Ga0190272_12004459Not Available613Open in IMG/M
3300018469|Ga0190270_11634619All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium697Open in IMG/M
3300018469|Ga0190270_12176825Not Available615Open in IMG/M
3300018476|Ga0190274_10183692All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300018476|Ga0190274_12757882All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium588Open in IMG/M
3300018920|Ga0190273_10755972All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium764Open in IMG/M
3300019360|Ga0187894_10099383All Organisms → cellular organisms → Bacteria1560Open in IMG/M
3300019377|Ga0190264_10047453All Organisms → cellular organisms → Bacteria → Acidobacteria1703Open in IMG/M
3300019377|Ga0190264_10094712Not Available1380Open in IMG/M
3300019879|Ga0193723_1062665All Organisms → cellular organisms → Bacteria1081Open in IMG/M
3300019883|Ga0193725_1001677All Organisms → cellular organisms → Bacteria6404Open in IMG/M
3300019883|Ga0193725_1013436All Organisms → cellular organisms → Bacteria2296Open in IMG/M
3300019883|Ga0193725_1021119All Organisms → cellular organisms → Bacteria → Acidobacteria1780Open in IMG/M
3300019883|Ga0193725_1028601All Organisms → cellular organisms → Bacteria1496Open in IMG/M
3300019886|Ga0193727_1037619All Organisms → cellular organisms → Bacteria → Acidobacteria1620Open in IMG/M
3300019997|Ga0193711_1046340Not Available524Open in IMG/M
3300019998|Ga0193710_1018829All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300020060|Ga0193717_1125251All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium784Open in IMG/M
3300021078|Ga0210381_10218315All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium670Open in IMG/M
3300021412|Ga0193736_1054386Not Available553Open in IMG/M
3300024347|Ga0179591_1118485All Organisms → cellular organisms → Bacteria → Acidobacteria2498Open in IMG/M
3300025910|Ga0207684_10022673All Organisms → cellular organisms → Bacteria5360Open in IMG/M
3300025910|Ga0207684_11124365All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium653Open in IMG/M
3300025922|Ga0207646_11185952All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium670Open in IMG/M
3300025923|Ga0207681_10024806All Organisms → cellular organisms → Bacteria3850Open in IMG/M
3300025925|Ga0207650_10000872All Organisms → cellular organisms → Bacteria22890Open in IMG/M
3300025925|Ga0207650_10284855All Organisms → cellular organisms → Bacteria → Acidobacteria1346Open in IMG/M
3300025931|Ga0207644_11370672All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium594Open in IMG/M
3300025934|Ga0207686_11121128All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium642Open in IMG/M
3300025936|Ga0207670_10196929Not Available1528Open in IMG/M
3300026075|Ga0207708_10276737All Organisms → cellular organisms → Bacteria1359Open in IMG/M
3300026088|Ga0207641_10022383All Organisms → cellular organisms → Bacteria → Acidobacteria5203Open in IMG/M
3300026089|Ga0207648_10952604All Organisms → cellular organisms → Bacteria → Acidobacteria803Open in IMG/M
3300026095|Ga0207676_10835785All Organisms → cellular organisms → Bacteria → Acidobacteria900Open in IMG/M
3300026118|Ga0207675_101433015All Organisms → cellular organisms → Bacteria → Acidobacteria711Open in IMG/M
3300026285|Ga0209438_1003237All Organisms → cellular organisms → Bacteria5489Open in IMG/M
3300028705|Ga0307276_10138128All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium614Open in IMG/M
3300028814|Ga0307302_10705510All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium502Open in IMG/M
3300031456|Ga0307513_10446896Not Available1018Open in IMG/M
3300031456|Ga0307513_10613844All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium796Open in IMG/M
3300031720|Ga0307469_10257266All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium1410Open in IMG/M
3300031720|Ga0307469_10993742All Organisms → cellular organisms → Bacteria → Acidobacteria → Blastocatellia → unclassified Blastocatellia → Blastocatellia bacterium783Open in IMG/M
3300032174|Ga0307470_10256471All Organisms → cellular organisms → Bacteria → Acidobacteria1159Open in IMG/M
3300032180|Ga0307471_100503852All Organisms → cellular organisms → Bacteria → Acidobacteria1359Open in IMG/M
3300033814|Ga0364930_0142958All Organisms → cellular organisms → Bacteria817Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil13.24%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil12.75%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere11.27%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment9.31%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil8.33%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere4.41%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil3.92%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere3.92%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.92%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil2.45%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost2.45%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.45%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.96%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.47%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Miscanthus Rhizosphere1.47%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.47%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.47%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil0.98%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza0.98%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.98%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.49%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.49%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere0.49%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.49%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.49%
Microbial Mat On RocksEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks0.49%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.49%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil0.49%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.49%
Quercus RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere0.49%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere0.49%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.49%
Tabebuia Heterophylla RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere0.49%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.49%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.49%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere0.49%
Switchgrass, Maize And Mischanthus LitterEngineered → Solid Waste → Grass → Composting → Unclassified → Switchgrass, Maize And Mischanthus Litter0.49%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459017Litter degradation ZMR4EngineeredOpen in IMG/M
3300000532Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_AssembledHost-AssociatedOpen in IMG/M
3300000887Permafrost active layer microbial communities from McGill Arctic Research Station, Canada - (A3-65cm-16A)- 1 week illuminaEnvironmentalOpen in IMG/M
3300000891Soil microbial communities from Great Prairies - Wisconsin, Continuous corn soilEnvironmentalOpen in IMG/M
3300001431Amended soil microbial communities from Kansas Great Prairies, USA - BrdU F1.4TB clc assemlyEnvironmentalOpen in IMG/M
3300002886Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cmEnvironmentalOpen in IMG/M
3300002907Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_40cmEnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004156Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1EnvironmentalOpen in IMG/M
3300004157Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2EnvironmentalOpen in IMG/M
3300004463Combined assembly of Arabidopsis thaliana microbial communitiesHost-AssociatedOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005289Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2Host-AssociatedOpen in IMG/M
3300005290Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1Host-AssociatedOpen in IMG/M
3300005293Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1Host-AssociatedOpen in IMG/M
3300005295Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3EnvironmentalOpen in IMG/M
3300005328Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005334Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2Host-AssociatedOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005353Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005406Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaGEnvironmentalOpen in IMG/M
3300005438Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaGEnvironmentalOpen in IMG/M
3300005440Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaGEnvironmentalOpen in IMG/M
3300005444Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaGEnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005459Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2Host-AssociatedOpen in IMG/M
3300005467Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005544Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005549Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaGEnvironmentalOpen in IMG/M
3300005615Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaGEnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005617Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2Host-AssociatedOpen in IMG/M
3300005618Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2Host-AssociatedOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005841Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2Host-AssociatedOpen in IMG/M
3300005844Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2Host-AssociatedOpen in IMG/M
3300005983Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1Host-AssociatedOpen in IMG/M
3300006876Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009143Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2EnvironmentalOpen in IMG/M
3300009148Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009176Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300010400Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-2EnvironmentalOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300010999Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t3i015EnvironmentalOpen in IMG/M
3300011119Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaGHost-AssociatedOpen in IMG/M
3300011270Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h2.4B metaGEnvironmentalOpen in IMG/M
3300011414Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT266_2EnvironmentalOpen in IMG/M
3300011444Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT800_2EnvironmentalOpen in IMG/M
3300011998Permafrost microbial communities from Nunavut, Canada - A30_35cm_6MEnvironmentalOpen in IMG/M
3300012034Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT526_2EnvironmentalOpen in IMG/M
3300012035Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT338_2EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012203Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz3.16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012353Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_80_16 metaGEnvironmentalOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012922Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk1.16 metaGEnvironmentalOpen in IMG/M
3300012923Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_40_16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012930Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300013294Permafrost microbial communities from Nunavut, Canada - A3_65cm_0MEnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300013765Permafrost microbial communities from Nunavut, Canada - A30_80cm_6MEnvironmentalOpen in IMG/M
3300014056Permafrost microbial communities from Nunavut, Canada - A20_5cm_0MEnvironmentalOpen in IMG/M
3300014326Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaGHost-AssociatedOpen in IMG/M
3300014873Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT200B_16_10DEnvironmentalOpen in IMG/M
3300014883Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT760_16_10DEnvironmentalOpen in IMG/M
3300015254Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaG ERMLT860_16_10DEnvironmentalOpen in IMG/M
3300015359Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_20cm_2_09182015EnvironmentalOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018000Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_coexEnvironmentalOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018051Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_b1EnvironmentalOpen in IMG/M
3300018052Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_50_b2EnvironmentalOpen in IMG/M
3300018053Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_b1EnvironmentalOpen in IMG/M
3300018061Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_60_b1EnvironmentalOpen in IMG/M
3300018063Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b2EnvironmentalOpen in IMG/M
3300018071Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_b1EnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018076Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_60_coexEnvironmentalOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018079Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_127_b1EnvironmentalOpen in IMG/M
3300018081Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b1EnvironmentalOpen in IMG/M
3300018429Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 TEnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300019360White microbial mat communities from a lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - GBC170108-1 metaGEnvironmentalOpen in IMG/M
3300019377Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 112 TEnvironmentalOpen in IMG/M
3300019879Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2m2EnvironmentalOpen in IMG/M
3300019883Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2a2EnvironmentalOpen in IMG/M
3300019886Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c2EnvironmentalOpen in IMG/M
3300019997Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2EnvironmentalOpen in IMG/M
3300019998Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m1EnvironmentalOpen in IMG/M
3300020060Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2c2EnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021412Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2m1EnvironmentalOpen in IMG/M
3300024347Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300025910Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025922Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025923Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025931Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025934Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025936Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026285Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300028705Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_115EnvironmentalOpen in IMG/M
3300028814Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_183EnvironmentalOpen in IMG/M
3300031456Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EMHost-AssociatedOpen in IMG/M
3300031720Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033814Sediment microbial communities from East River floodplain, Colorado, United States - 55_j17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
4ZMR_027309502170459017Switchgrass, Maize And Mischanthus LitterMIAPRQIAGGMEFLLTVGISAVAGLLAFLLVSLVVNVLGLSGA
CNAas_101864923300000532Quercus RhizosphereMIAPKSLTGGMEFLVTVGVSAVAGLLAFLFVSLIVC
AL16A1W_1006731623300000887PermafrostMIAPKHLAEGMEFLITLAVSVVAGLLAFLFVSLVANILGLSGS*
JGI10214J12806_1042149523300000891SoilMIAPKQVAGGMEFLVTVGVSALAGLLAFLLVSLVVNVLGLSGG*
F14TB_10392860923300001431SoilMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVLGLSGEVEGGE
JGI25612J43240_104686313300002886Grasslands SoilMIMEALPMIAPKQVAGGMEFLVTVGVSAIAGLLAFLFVSLVVTLLGLSGG*
JGI25613J43889_10000181113300002907Grasslands SoilMIAPKQVAGGMEFLVTVGVSAIAGLLAFLFVSLVVTLLGLSGG*
Ga0062593_10076606823300004114SoilAPRQIAGGMEFLLTVGISAVAGLLAFLLVSLVVNVLGLSGA*
Ga0062589_10159244723300004156SoilSSLVKQLMIMEALPMIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVANVLGLSGG*
Ga0062590_10051680713300004157SoilKQLMIMEALPMIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVVNVLGLSGG*
Ga0063356_10233783313300004463Arabidopsis Thaliana RhizosphereMIVPKNLAEGMEFLITVALSAFAGLLAFLFVSLVVNVLGLSGN*
Ga0062595_10060381323300004479SoilMITSKNFAGGMEFLVTVGVSAIAGLLAFLLVSLIANVFGL*
Ga0062592_10038489213300004480SoilMIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVANVLGLSGG*
Ga0066688_1028294823300005178SoilMIAPKNLAEGTEFVVTIIVSAVAGLLAFLFVSLIVNILGL*
Ga0065704_1010565733300005289Switchgrass RhizosphereMIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVVNVLGLSGG*
Ga0065712_1015824323300005290Miscanthus RhizosphereMIMEALPVIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLSGG*
Ga0065715_1015468523300005293Miscanthus RhizosphereMIAPKQVAGGMEFLVTVGVSAVAGLLAFLLVSLVVNVLGLSGG*
Ga0065715_1092848313300005293Miscanthus RhizosphereMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLSGG*
Ga0065707_1105991413300005295Switchgrass RhizosphereAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVVNVLGLSGG*
Ga0070676_1076972513300005328Miscanthus RhizosphereMEALPMIAPKQVAGGMEFLLTVGISAVAGLLAFLLVSLVVNVLGLSGA*
Ga0070690_10074407813300005330Switchgrass RhizosphereMIARKNMAGGMEFLVTVGISAAAGLLAFLFVSLVAHVLGLTNG*
Ga0070670_100000914253300005331Switchgrass RhizosphereMIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNALGLFSG*
Ga0070670_10007313913300005331Switchgrass RhizosphereMIAPKDSAGSMEFLVTVGVSAVAGLLAFLLVSLVVNVLGLSGG*
Ga0068869_10001147863300005334Miscanthus RhizosphereMIAPKQVAGGMEFVLTVGLSAVAGLLAFLLVSLVVNVFGLSGG*
Ga0070682_100000027443300005337Corn RhizosphereMIAPKNMAGGMEFLVTVGISAAAGLLAFLFVSVVVHLLGLTNG*
Ga0070669_10001244063300005353Switchgrass RhizosphereMIARKNVAGGMEFLITIGVSAVAGLLAFLLVSVVVNALGLFSG*
Ga0070673_10097606713300005364Switchgrass RhizosphereMIARKNMTGGMEFLMTVGISAAAGLLAFLLVSIVAHMLGLTNG*
Ga0070703_1045672113300005406Corn, Switchgrass And Miscanthus RhizosphereEALPMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG*
Ga0070703_1061120623300005406Corn, Switchgrass And Miscanthus RhizosphereMIAPKNAAAGMEFLVTVGVSAIAGLLAFLFVSLIANILGLSGG*
Ga0070701_1071966823300005438Corn, Switchgrass And Miscanthus RhizosphereMITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSLIANLLGL*
Ga0070701_1128165413300005438Corn, Switchgrass And Miscanthus RhizosphereMIKLKNLDEGTEFAVTIVVSAAAGLLAFLFVALIVYMLGL*
Ga0070705_10028188523300005440Corn, Switchgrass And Miscanthus RhizosphereMIARKNVNGGMEFLVTVGVSAVAGLLAFLLVSVVVHVLGLFSG*
Ga0070705_10052399223300005440Corn, Switchgrass And Miscanthus RhizosphereMIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVQVLGLFGP*
Ga0070705_10190856423300005440Corn, Switchgrass And Miscanthus RhizosphereMIARKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG*
Ga0070694_10036810023300005444Corn, Switchgrass And Miscanthus RhizosphereMIAPKQVAGGMEFLVTVGLSAVAGLLAFLLVSLVVNVFGLSGQ*
Ga0070694_10081905623300005444Corn, Switchgrass And Miscanthus RhizosphereMEALPMIAPKNLAEGTEFLVTIAVSAVAGLAAFLLVALIVNMLGL*
Ga0070708_10059819413300005445Corn, Switchgrass And Miscanthus RhizosphereMIKQKNLDGGTEFLVTMVVSVVAGLLAFLFVALMVKMLGL*
Ga0068867_10217776313300005459Miscanthus RhizosphereMIARKNMTGGMEFLMTVGISAAAGLLAFLLVSIVAHMLGLTAG*
Ga0070706_10021509133300005467Corn, Switchgrass And Miscanthus RhizosphereMIAPKNVAGGMEFLVTVGVSALAGLLAFLFVSLLVSVLGLSGG*
Ga0070698_100000405333300005471Corn, Switchgrass And Miscanthus RhizosphereMIAPKQVAGGMEFLVTVGVSALAGLLAFLFVSLVVSVLGLS*
Ga0070698_10009774123300005471Corn, Switchgrass And Miscanthus RhizosphereMIAPKNLAEGTEFLVTIILSAVAGLLAFLFVSLIVKILGL*
Ga0070698_10020681423300005471Corn, Switchgrass And Miscanthus RhizosphereMIAPKNLAEGTEFVVTILVSAIAGLVAFLFVSLIVRILGL*
Ga0070699_10005266633300005518Corn, Switchgrass And Miscanthus RhizosphereMEALPMIAPKNLAEGTEFLVTIILSAVAGLLAFLFVSLIVKILGL*
Ga0070697_100002437103300005536Corn, Switchgrass And Miscanthus RhizosphereMIAPKNLAEGTEFLATIIVSAVAGLLAFLLVSLIVNILGL*
Ga0070686_10000892453300005544Switchgrass RhizosphereLPMITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSLIANILGL*
Ga0070695_10065426223300005545Corn, Switchgrass And Miscanthus RhizosphereMEALPMIAPKNLAEGTEFLVTIVVSAVAGLAAFLLVALIVYLLGL*
Ga0070704_10094384723300005549Corn, Switchgrass And Miscanthus RhizosphereMIAPKTLAEGTEFLVTIVVSAVAGLAAFLLVALIVYLLGL*
Ga0070702_10034431313300005615Corn, Switchgrass And Miscanthus RhizosphereMIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNVLGLFSGY*
Ga0068852_10191434713300005616Corn RhizosphereMIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVN
Ga0068859_10111839023300005617Switchgrass RhizosphereMEALPMIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNALGLFSG*
Ga0068864_10142597123300005618Switchgrass RhizosphereMIMEALPMIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVVNVLGLSGG*
Ga0068861_10084378913300005719Switchgrass RhizosphereMEALPMIAPKNFAEGTEFVVTILVSAVAGLLAFLLVALIVQVLGL*
Ga0068863_10006784023300005841Switchgrass RhizosphereMIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNVLGLFSG*
Ga0068863_10187369013300005841Switchgrass RhizosphereMIMETLPMIAPRQIAGGMEFLLTVGISAVAGLLAFLLVSLVVNVLGLSGA*
Ga0068862_10027161533300005844Switchgrass RhizosphereMIAPKDSAGSMEFLVTIGVSAVAGLLAFLLVSLVVNVLGLSGG*
Ga0081540_105270313300005983Tabebuia Heterophylla RhizosphereMIARKNVAGGMEFLLTVGLSAVAGLLAFLLVALVVNVLGLSG*
Ga0079217_1063450423300006876Agricultural SoilMIVPKNLAEGMEFLLTVGLSAFAGLLAFLFVSLIVNVLGLSGT*
Ga0079218_1132346923300007004Agricultural SoilMIAPKNLAEGTEFLATIILSAVAGLLAFLFVSLIVKILGL*
Ga0105245_1098574923300009098Miscanthus RhizosphereMIAPKQVAGGMEFLLTVGISAVAGLLAFLLVSLVVNVLGLSGA*
Ga0099792_1096934823300009143Vadose Zone SoilMEALPMIAPKNLAEGTEFVVTILVSAIAGLVAFLCVSLIVRILGL*
Ga0105243_1078282923300009148Miscanthus RhizosphereMIAPKDSTESMEFLVTVGVSAVAGMLAFLLVSLVVNVLGLSGG*
Ga0105243_1090124113300009148Miscanthus RhizosphereMIARKNVNGGMEFLITVGVSAVAGLLAFLLVSVVVHVLGLVGG*
Ga0105241_1070523623300009174Corn RhizosphereMIAPKNIAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG*
Ga0105241_1075862133300009174Corn RhizosphereMIAPKNVAGGMEFLVTVGVSAIAGLLAFLFVSLVVSVLGLSGG*
Ga0105242_1086110813300009176Miscanthus RhizosphereMIMEALPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLFVTLVVNVLGLSGG*
Ga0105242_1195911213300009176Miscanthus RhizosphereMIARKNVNGGMEFLVTVGVSAVAGLLAFLLVSVVVHVLGLVGG*
Ga0134125_1202535923300010371Terrestrial SoilMIARKNVAGGMEFLLTVGVSALAGLLAFLFVSVVVQVLGLFSG*
Ga0134128_1071869723300010373Terrestrial SoilMIARKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLSGG*
Ga0134124_1035002413300010397Terrestrial SoilMIAPRQIAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLSGG*
Ga0134124_1312119813300010397Terrestrial SoilMIARKNVNGGMEFLITVGVSAVAGLLAFLFVSVVVQVLGLFSG*
Ga0134127_1008135023300010399Terrestrial SoilMEALPMIAPKQVAGGMEFLVTVGLSAVAGLLAFLLVSLVVNVFGLSGQ*
Ga0134127_1331179923300010399Terrestrial SoilMIARKNVAGGMEFLVTVGVSAVAGLLAFLLVSVVVQVLGLFSG*
Ga0134122_1072303813300010400Terrestrial SoilMIAPKTLTGGMEFLVTVGVSAVAGLLAFLFVSLIVCLFGLGN*
Ga0134122_1226491313300010400Terrestrial SoilMRLEGLPMIVPKNYAEGMEFLLTVIVSAFAGLMAFLLVLLIVYVLGLNSC*
Ga0134122_1273955713300010400Terrestrial SoilMIAPKQVAGGMEFLLTVGLSAVAGLLAFLFVSLVVNVLGLSGV*
Ga0134122_1291199213300010400Terrestrial SoilMEALPMITPKISVNCSAKRRNFAEGTEFLLTIVVSAVAGLAAFLLVALIVYLLGL*
Ga0134122_1311832313300010400Terrestrial SoilPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVILVVNVLGLSNG*
Ga0134121_1296368423300010401Terrestrial SoilMIMEALPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLSGG*
Ga0134123_1005638233300010403Terrestrial SoilMIARKNAAAGMEFLVTVGVSAIAGLLAFLFVSLIANILGLSGG*
Ga0134123_1025620523300010403Terrestrial SoilMIAPKTLTGGMEFLVTVGVSAVAGLLAFLFVSLIVCLFGLGS*
Ga0134123_1085260023300010403Terrestrial SoilMIARKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGL
Ga0134123_1117205223300010403Terrestrial SoilIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNALGLFSG*
Ga0134123_1201399513300010403Terrestrial SoilMEALPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVQLVVKIFGLTG*
Ga0138505_10005424823300010999SoilMIARKNVTGGMEFLITVGVSAVAGLLAFLLVSVVVNVLGLFSG*
Ga0105246_1082077913300011119Miscanthus RhizosphereIMEALPMIAPKDSAGSMEFLVTVGVSAVAGLLAFLLVSLVVNVLGLSGG*
Ga0105246_1176206223300011119Miscanthus RhizosphereMIARKNVAGGMEFLITVGVSAMAGLLAFLFVSMVVHVLGL
Ga0137391_1035973823300011270Vadose Zone SoilMEALPMIAPKNLAEGTEFVVTIVVSAVAGLLAFLFVSLIVKILGL*
Ga0137442_103710223300011414SoilMIMEALPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVLGLSGG*
Ga0137463_101571823300011444SoilMEVSPMVVPKNVAEGMEFLATVGLSAVAGLLAFLLVTLVVKALGLSSG*
Ga0120114_102545823300011998PermafrostMIAPKNLAEGTEFVVTIVVSAVAGLLAFLFVLLMVNILGL*
Ga0137453_104738823300012034SoilMIAPKNLAEGTEFLVTMILSAAAGLLAFLFVSLIVNMLGL*
Ga0137445_110314613300012035SoilMIAPKNLAEGTEFLVTMILSAAAGLLAFLFVSLIVNMLG
Ga0137364_1035891413300012198Vadose Zone SoilMVFMEALPMIMPKNLAEGMEFLVTVVLSALAGLLAFLLVSIVATILGLAGS*
Ga0137364_1080758613300012198Vadose Zone SoilMEALPMIAPKNLAGGMEFIVTVGLSAVAGLLAFLFVSLVVRVLGLSGS*
Ga0137382_1047977213300012200Vadose Zone SoilMEALPMIAPKNLAEGTEFVVTILVSAVAGLLAFLFVLLMVNILGL*
Ga0137399_1062598123300012203Vadose Zone SoilMIARKNVAGGMEFLATVGISAVAGLLAFLLVSLVVNILGLTSG*
Ga0137376_1001025433300012208Vadose Zone SoilMEALPMIAPKNLAEGTEFVVTILVSAIAGLVAFLFVSLIVRILGL*
Ga0137377_1006497333300012211Vadose Zone SoilMIMPKNLAEGMEFLVTVVLSALAGLLAFLFVSIVATILGLAGS*
Ga0137447_102499123300012226SoilMIMEALPMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG*
Ga0137367_1006863643300012353Vadose Zone SoilMEALPMIVPKNLAEGMEFLITVALSAFAGLLAFLFVSLVVNVLGLSGN*
Ga0137371_1021523623300012356Vadose Zone SoilMIMPKNLAEGMEFLVTVVLSALAGLLAFLLVSIVATILGLAGS*
Ga0137373_1005838823300012532Vadose Zone SoilMEVLPMIVPKNLAEGMEFLITVALSAFAGLLAFLFVSLVVNVLGLSGN*
Ga0137397_1001302663300012685Vadose Zone SoilMEALPMIAPEKVAEGTEFVVTIVVSAVAGLLAFLFVWLIVNILGL*
Ga0137397_1015915613300012685Vadose Zone SoilMKEIFCNALETLPMIKQKNLDEGTEFAVTIVVSAVAGLLAFLFVALIVNMLGL*
Ga0137397_1016071823300012685Vadose Zone SoilMEDLPMIAPKHQAEGMEFLITVVLSAFAGLAAFLLVSLVVNILGLSGS*
Ga0137397_1016285713300012685Vadose Zone SoilMEALPMIAPKNLAEGTEFVVTILVSAVAGLVAFLFVSLIVRILGL*
Ga0137395_1027866313300012917Vadose Zone SoilMEALPMIAPKNLAEGTEFVVTIIVSAVAGLLAFLFVSLIVNILGL*
Ga0137396_1040752923300012918Vadose Zone SoilMEALPMITTKNLAEGMEFLITLVLSAVAGLLAFLFVSL
Ga0137396_1117841613300012918Vadose Zone SoilMIAPKNLAAGMEFFMTVFVSAVAGLLAFLLVCLVVNVIGLSGG*
Ga0137394_1060898323300012922Vadose Zone SoilMEALPMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG*
Ga0137359_1087579513300012923Vadose Zone SoilMVFVEALPMIMPKNLAEGMEFLVTVVLSALAGLLAFLLVSIVATILGLAGS*
Ga0137413_1094644813300012924Vadose Zone SoilMITPKHLAGGMEFLVTVGLSAVAGLLAFLLVSLVVNILGLAAG*
Ga0137416_1189089713300012927Vadose Zone SoilMIKQKNLDEGTEFAVTIVVSAVAGLLAFLFVALIVNMLGL*
Ga0137404_1014403723300012929Vadose Zone SoilMITPKDFAEGMELLITLALSLVAGLLAFLFVSLVVNVLGLSGG*
Ga0137407_1001062663300012930Vadose Zone SoilMITPKDVAEGMELLITLVLSLVAGLLAFLFVSLVVNILGLSGS*
Ga0137407_1191455013300012930Vadose Zone SoilMEALPMITPKDLAEGMELLITLVLSLVAGLLAFLFVSLVVNILGLSGS*
Ga0137410_1004395323300012944Vadose Zone SoilMEALPMIAPKNLAGGMEFLITVGLSAIAGLLAFLFVTLVVSVLGLSGG*
Ga0164300_1012769223300012951SoilMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVLGLSG*
Ga0164303_1044788613300012957SoilLIMEALPMIAPKNFAEGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG*
Ga0120150_101344433300013294PermafrostSAQRLVRRLSPMIAPKHLAEGMEFLITLAVSVVAGLLAFLFVSLVANILGLSGS*
Ga0157378_1016799813300013297Miscanthus RhizosphereMITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSL
Ga0157378_1023116623300013297Miscanthus RhizosphereMIAPKNLAEGTEFLVTIVVSAVAGLAAFLLVALIVYLLGL*
Ga0157378_1304159313300013297Miscanthus RhizosphereALPMITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSLIANLLGL*
Ga0157378_1304159513300013297Miscanthus RhizosphereALPMITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSLIANILGL*
Ga0157375_1260065813300013308Miscanthus RhizosphereMEALPMIAPKTLAEGTEFLVTIIVSLVAGLAAFLLVALIVYLLGL*
Ga0120172_100506653300013765PermafrostRLVRRLSPMIAPKHLAEGMEFLITLAVSVVAGLLAFLFVSLVANILGLSGS*
Ga0120125_104472633300014056PermafrostNLAEGTEFVVTIVVSAVAGLLAFLFVLLMVNILGL*
Ga0157380_1004982733300014326Switchgrass RhizosphereMITPKVSSKTYSGGMEFLVTVGVSALAGLLAFLFVSLIANILGL*
Ga0157380_1186013913300014326Switchgrass RhizosphereMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSAVVRLFGLAG*
Ga0157380_1293084113300014326Switchgrass RhizosphereMIARKNMTGGMEFLMTVGISAAAGLLAFLLVSIVAHMLGLTTG*
Ga0180066_102401223300014873SoilMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG*
Ga0180086_100080123300014883SoilMEALPMIVPKNLAEGMEFLITVALSAFAGVLAFLFVSLVVNLLGLSGS*
Ga0180089_101362333300015254SoilMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLVLSGG*
Ga0134085_1043534223300015359Grasslands SoilMIAPKNLAEGTEFVVTIVVSAVAGLLAFLFVLLMV
Ga0132258_1280268223300015371Arabidopsis RhizosphereMIAPKQVAGGMEFLVTVGVSALAGLLAFLFVSLVVNVLGLSGG*
Ga0132256_10046673823300015372Arabidopsis RhizosphereMIMEALPMIAPKQVAGGMEFLVTVGVSALAGLLAFLFVSLVVNVLGLSGG*
Ga0184604_1005996023300018000Groundwater SedimentMIARKNVDGGMEFLLTVGVSAVAGLLAFLFVTVVVHVLGLFSG
Ga0184605_1047227113300018027Groundwater SedimentMEALPMIARKNVDGGMEFLLTVGVSAVAGLLAFLLVTVVVHVLGLFSG
Ga0184605_1051457913300018027Groundwater SedimentMITSKNLAEGMEFLITLVLSAVAGLLAFLFVSLIVNVLGLAGN
Ga0184608_1011265713300018028Groundwater SedimentMIARKNVDGGIEFLLTVGVSAVAGLLAFLFVTVVVHVLGLFSG
Ga0184608_1027163513300018028Groundwater SedimentMEGLPMIAPKNQAEGMEFLITVVLSAFAGLVAFLLVSLVVNILGLSGS
Ga0184620_1005125413300018051Groundwater SedimentMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVANVFGLSGG
Ga0184638_124985323300018052Groundwater SedimentMIALKNFAGGMEFLITVGVSAVAGLLAFLFVSLIVSVLGLGS
Ga0184626_1005832923300018053Groundwater SedimentMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG
Ga0184619_1002308333300018061Groundwater SedimentKIMEALPMIARKNVDGGMEFLLTVGVSAVAGLLAFLLVTLVVQVLGLFSG
Ga0184619_1043624813300018061Groundwater SedimentMLRMEALPMIAPEKVAEGTEFVVTIVVSAVAGLLAFLFVWLVVNILGL
Ga0184637_1009625623300018063Groundwater SedimentMTVPKNLAEGMEFLITVVLSAFAGLLAFLFVSLVVNILGLSGS
Ga0184618_1017983013300018071Groundwater SedimentMEALPMIARKNVDGGMEFLLTVGVSAVAGLLAFLLVTLVVQVLGLFSG
Ga0184618_1024865913300018071Groundwater SedimentMIAPKNLAEGTEFVVTIAVSAVAGLLAFIFVELIVSILGL
Ga0184635_1026623123300018072Groundwater SedimentMIAPKNVAGSMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG
Ga0184609_1002365433300018076Groundwater SedimentMIAPKQVAGGMEFVLTVGLSAVAGLLAFLLVSLVVNVFGLSGG
Ga0184609_1033234813300018076Groundwater SedimentKNVAGGMEFLVTVGVSAIAGLLAFLFVSLVVSVLGLSGG
Ga0184612_1041293413300018078Groundwater SedimentMIAPKNVAVGMEFLVTVGVSAVAGLLAFLFVSLVVSVL
Ga0184627_1012076013300018079Groundwater SedimentMTVPKNLAEGMEFLITVALSAFAGLLAFLFVSLVVNILGLSGS
Ga0184625_1049870423300018081Groundwater SedimentMIMEALPMIAPKNVAGSMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG
Ga0190272_1001772923300018429SoilMIALKNFAGGMEFLITVGVSAGVGVLTFLFALLIFCVLGPGC
Ga0190272_1004624013300018429SoilMIAPKNLAAGTEFLITIGVCAIAGLLMFLLVALIVSVLGLA
Ga0190272_1078617123300018429SoilMIAPKTMAEGTEFLVTILVSAVAGLLAFLLVALIVNLLGL
Ga0190272_1198049113300018429SoilMIAPKNLAGGTEFFITIGVCAFAGLLMFMLVALIFCFVGLA
Ga0190272_1200445923300018429SoilMETLPMIAPKDLAGGTEFFITIGVCAFAGLLMFVLVALIFCLVGLA
Ga0190270_1163461923300018469SoilMIAPKNIAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG
Ga0190270_1217682523300018469SoilMIARKNVDGGMEFLVTVGISAAAGLLAFLLVSVVVHVLGLFSG
Ga0190274_1018369223300018476SoilMIAPKNLAEGTEFLVTIVVSAVAGLAAFLLVALIVYLLGL
Ga0190274_1275788213300018476SoilPMIARKNVDGGMEFLVTVGVSAVAGLLAFLLVSVVVHVLGLSG
Ga0190273_1075597223300018920SoilMIARKNVEGGMEFLLTVGVSAVAGLLAFLFVTVVVHVLGLFSG
Ga0187894_1009938323300019360Microbial Mat On RocksMIARKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVAKLFGLA
Ga0190264_1004745313300019377SoilMIARKNVDGGMEFLVTVGVSAAAGLLAFLLVSVVVHVLGLF
Ga0190264_1009471223300019377SoilMIARKNVEGGMEFLLTVGVSAVAGLLAFLFVTVVVHVLGLFSC
Ga0193723_106266523300019879SoilMIARKNVAGGMEFLATVGISAVAGLLAFLLVSLVVNILGLTSG
Ga0193725_100167733300019883SoilMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVFGLTGG
Ga0193725_101343613300019883SoilMITPKDAAEGMELLITLALSLVAGLLAFLFVSLVVNVLGLSGG
Ga0193725_102111923300019883SoilMIARKQVAGGVEFLLIVGASAVAGLLAFLFVSLVVNILGLSGG
Ga0193725_102860133300019883SoilMIAPKNLAGGMEFLLTVGLSAIAGLLAFLFVSLIVRVLGLGS
Ga0193727_103761923300019886SoilMIAPKNVAGGMEFLVTVGVSALAGLLAFLFVSLVVSLLGLSGG
Ga0193711_104634023300019997SoilMIAPKQVAGGMEFVLTVGLSAVAGLLAFLLVSLVVNVFGLSG
Ga0193710_101882913300019998SoilMNQSMIMEALPMIAPKQVAGGMEFVLTVGLSAVAGLLAFLLVSLVVNVFGLSG
Ga0193717_112525123300020060SoilMIAPKALAGGMEFLVTVGVSAIAGLLAFFLVVLVVSVLGLGC
Ga0210381_1021831523300021078Groundwater SedimentMEALPMIVSKNLAEGLEFLLTVALSAFAGLLAFLLVSLVVNLLGLSGS
Ga0193736_105438633300021412SoilMIARKNVDGGMEFLVTVGVSAAAGLLAFLLVSVVVHVL
Ga0179591_111848583300024347Vadose Zone SoilMEALPMIARKNVAGGMEFLLTVGLSAIAGLLAFLFVSLLVTLLGLG
Ga0207684_1002267353300025910Corn, Switchgrass And Miscanthus RhizosphereMIAPKNVAGGMEFLVTVGVSALAGLLAFLFVSLLVSVLGLSGG
Ga0207684_1112436523300025910Corn, Switchgrass And Miscanthus RhizosphereMIAPKNAAAGMEFLVTVGVSAIAGLLAFLFVSLIANILGLSGG
Ga0207646_1118595223300025922Corn, Switchgrass And Miscanthus RhizosphereMIAPKNAAAGMEFLVTVGVSAIAGLLAFLFVSLIA
Ga0207681_1002480613300025923Switchgrass RhizosphereMIARKNVAGGMEFLITIGVSAVAGLLAFLLVSVVVNALGLFSG
Ga0207650_10000872213300025925Switchgrass RhizosphereMIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNALGLFSG
Ga0207650_1028485523300025925Switchgrass RhizosphereMIARKNMTGGMEFLMTVGISAAAGLLAFLLVSIVAHLLGLTTG
Ga0207644_1137067223300025931Switchgrass RhizosphereSLIMEALPMIAPKQVAGGMEFLLTVGLSAVAGLLAFLLVSLVVNVLGLSG
Ga0207686_1112112813300025934Miscanthus RhizosphereMIARKNVNGGMEFLVTVGVSAVAGLLAFLLVSVVVHVLGLVGG
Ga0207670_1019692923300025936Switchgrass RhizosphereMIARKNMAGGMEFLVTVGISAAAGLLAFLFVSLVAHVLGLTNG
Ga0207708_1027673723300026075Corn, Switchgrass And Miscanthus RhizosphereMIAPKQVAGGMEFLVTVGVSAVAGLLAFLLVSLVVNVLGLSGG
Ga0207641_1002238323300026088Switchgrass RhizosphereMIARKNVAGGMEFLITVGVSAVAGLLAFLLVSVVVNVLGLFSG
Ga0207648_1095260423300026089Miscanthus RhizosphereMIARKNMTGGMEFLMTVGISAAAGLLAFLLVSIVAHMLGLTAG
Ga0207676_1083578523300026095Switchgrass RhizosphereMIAPKQVAGGMEFLVTVGVSAVAGLLAFLFVSLVVNVLGLSGG
Ga0207675_10143301523300026118Switchgrass RhizosphereMIAPKNFAEGTEFVVTILVSAVAGLLAFLLVALIVQVL
Ga0209438_100323733300026285Grasslands SoilMIAPKQVAGGMEFLVTVGVSAIAGLLAFLFVSLVVTLLGLSGG
Ga0307276_1013812813300028705SoilMIVPKNFTEGMEFLITVALSAFAGLLAFLFVSLVVNVLGLSGR
Ga0307302_1070551013300028814SoilMEALPMIAPKNLAGGMEFLVTVGVSAVAGLLAFLLVSLIVTVLGLGS
Ga0307513_1044689613300031456EctomycorrhizaLMIMEALPMIAPKQVAGGIEFLLTVGLSAVAGLLAFLLVILVVNVLGLSTG
Ga0307513_1061384423300031456EctomycorrhizaMIAPKQVAGGMEFLLTVGLSAVAGLLAFLFVSLVVKIFGLSG
Ga0307469_1025726623300031720Hardwood Forest SoilMIARKQVAGGMEFLLTVGASAVAGLLAFLFVSLVVNILGLS
Ga0307469_1099374213300031720Hardwood Forest SoilKDFAERMEFLITVSLSAFAGLLAFLLVSLVVNILGLS
Ga0307470_1025647113300032174Hardwood Forest SoilMRLEGLPMIVPKNYAEGVEFLLTVIVSAFAGLLAFLLVLLIVYILGLNSC
Ga0307471_10050385213300032180Hardwood Forest SoilMEALPMIAPKNVAGGMEFLVTVGVSAVAGLLAFLFVSLVVSVLGLSGG
Ga0364930_0142958_634_7803300033814SedimentMEALPMIVPKNLAEGMEFLITVALSAFAGLLAFLFVSLVVNILGLSGN


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.