| Basic Information | |
|---|---|
| Family ID | F024855 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 204 |
| Average Sequence Length | 44 residues |
| Representative Sequence | VPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS |
| Number of Associated Samples | 172 |
| Number of Associated Scaffolds | 204 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 1.96 % |
| % of genes near scaffold ends (potentially truncated) | 97.06 % |
| % of genes from short scaffolds (< 2000 bps) | 92.65 % |
| Associated GOLD sequencing projects | 161 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.43 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (93.137 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (32.353 % of family members) |
| Environment Ontology (ENVO) | Unclassified (30.392 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (47.549 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 19.72% β-sheet: 14.08% Coil/Unstructured: 66.20% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.43 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 204 Family Scaffolds |
|---|---|---|
| PF01694 | Rhomboid | 9.80 |
| PF00293 | NUDIX | 9.80 |
| PF12697 | Abhydrolase_6 | 7.84 |
| PF12695 | Abhydrolase_5 | 6.37 |
| PF02780 | Transketolase_C | 2.94 |
| PF00135 | COesterase | 1.96 |
| PF07690 | MFS_1 | 1.96 |
| PF06441 | EHN | 1.47 |
| PF14833 | NAD_binding_11 | 1.47 |
| PF00583 | Acetyltransf_1 | 1.47 |
| PF03061 | 4HBT | 0.98 |
| PF00561 | Abhydrolase_1 | 0.98 |
| PF01266 | DAO | 0.98 |
| PF00248 | Aldo_ket_red | 0.98 |
| PF08240 | ADH_N | 0.98 |
| PF00378 | ECH_1 | 0.98 |
| PF16124 | RecQ_Zn_bind | 0.98 |
| PF04226 | Transgly_assoc | 0.49 |
| PF13701 | DDE_Tnp_1_4 | 0.49 |
| PF04972 | BON | 0.49 |
| PF00271 | Helicase_C | 0.49 |
| PF01782 | RimM | 0.49 |
| PF00005 | ABC_tran | 0.49 |
| PF01381 | HTH_3 | 0.49 |
| PF08882 | Acetone_carb_G | 0.49 |
| PF04672 | Methyltransf_19 | 0.49 |
| PF01053 | Cys_Met_Meta_PP | 0.49 |
| PF06197 | DUF998 | 0.49 |
| PF08044 | DUF1707 | 0.49 |
| PF03900 | Porphobil_deamC | 0.49 |
| PF00274 | Glycolytic | 0.49 |
| PF03729 | DUF308 | 0.49 |
| PF03601 | Cons_hypoth698 | 0.49 |
| PF02771 | Acyl-CoA_dh_N | 0.49 |
| PF04024 | PspC | 0.49 |
| PF00892 | EamA | 0.49 |
| PF00365 | PFK | 0.49 |
| PF05378 | Hydant_A_N | 0.49 |
| PF06325 | PrmA | 0.49 |
| PF00196 | GerE | 0.49 |
| PF13561 | adh_short_C2 | 0.49 |
| PF00120 | Gln-synt_C | 0.49 |
| PF16912 | Glu_dehyd_C | 0.49 |
| PF00072 | Response_reg | 0.49 |
| PF12847 | Methyltransf_18 | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
|---|---|---|---|
| COG0705 | Membrane-associated serine protease, rhomboid family | Posttranslational modification, protein turnover, chaperones [O] | 9.80 |
| COG2272 | Carboxylesterase type B | Lipid transport and metabolism [I] | 1.96 |
| COG0596 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase MenH and related esterases, alpha/beta hydrolase fold | Coenzyme transport and metabolism [H] | 1.47 |
| COG0145 | N-methylhydantoinase A/oxoprolinase/acetone carboxylase, beta subunit | Amino acid transport and metabolism [E] | 0.98 |
| COG4647 | Acetone carboxylase, gamma subunit | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
| COG0075 | Archaeal aspartate aminotransferase or a related aminotransferase, includes purine catabolism protein PucG | Amino acid transport and metabolism [E] | 0.49 |
| COG4100 | Cystathionine beta-lyase family protein involved in aluminum resistance | Inorganic ion transport and metabolism [P] | 0.49 |
| COG3897 | Protein N-terminal and lysine N-methylase, NNT1/EFM7 family | Posttranslational modification, protein turnover, chaperones [O] | 0.49 |
| COG3588 | Fructose-bisphosphate aldolase class 1 | Carbohydrate transport and metabolism [G] | 0.49 |
| COG3371 | Uncharacterized membrane protein | Function unknown [S] | 0.49 |
| COG3247 | Acid resistance membrane protein HdeD, DUF308 family | General function prediction only [R] | 0.49 |
| COG2890 | Methylase of polypeptide chain release factors | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| COG2873 | O-acetylhomoserine/O-acetylserine sulfhydrylase, pyridoxal phosphate-dependent | Amino acid transport and metabolism [E] | 0.49 |
| COG2855 | Uncharacterized membrane protein YadS, UPF0324 family | Function unknown [S] | 0.49 |
| COG2264 | Ribosomal protein L11 methylase PrmA | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 0.49 |
| COG2008 | Threonine aldolase | Amino acid transport and metabolism [E] | 0.49 |
| COG1982 | Arginine/lysine/ornithine decarboxylase | Amino acid transport and metabolism [E] | 0.49 |
| COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.49 |
| COG1921 | Seryl-tRNA(Sec) selenium transferase | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| COG0806 | Ribosomal 30S subunit maturation factor RimM, required for 16S rRNA processing | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| COG0626 | Cystathionine beta-lyase/cystathionine gamma-synthase | Amino acid transport and metabolism [E] | 0.49 |
| COG0520 | Selenocysteine lyase/Cysteine desulfurase | Amino acid transport and metabolism [E] | 0.49 |
| COG0436 | Aspartate/methionine/tyrosine aminotransferase | Amino acid transport and metabolism [E] | 0.49 |
| COG0399 | dTDP-4-amino-4,6-dideoxygalactose transaminase | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
| COG0205 | 6-phosphofructokinase | Carbohydrate transport and metabolism [G] | 0.49 |
| COG0181 | Porphobilinogen deaminase | Coenzyme transport and metabolism [H] | 0.49 |
| COG0156 | 7-keto-8-aminopelargonate synthetase or related enzyme | Coenzyme transport and metabolism [H] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 93.14 % |
| Unclassified | root | N/A | 6.86 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2166559006|FI_contig18467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 752 | Open in IMG/M |
| 3300001593|JGI12635J15846_10559955 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300005167|Ga0066672_10252464 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium sucinum | 1136 | Open in IMG/M |
| 3300005334|Ga0068869_101848883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 540 | Open in IMG/M |
| 3300005356|Ga0070674_101299369 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 649 | Open in IMG/M |
| 3300005434|Ga0070709_10009890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 5270 | Open in IMG/M |
| 3300005434|Ga0070709_11794649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 502 | Open in IMG/M |
| 3300005436|Ga0070713_101957982 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 568 | Open in IMG/M |
| 3300005444|Ga0070694_101816531 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 520 | Open in IMG/M |
| 3300005529|Ga0070741_10235378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1755 | Open in IMG/M |
| 3300005541|Ga0070733_10096702 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1881 | Open in IMG/M |
| 3300005541|Ga0070733_10304315 | Not Available | 1054 | Open in IMG/M |
| 3300005541|Ga0070733_10345744 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 986 | Open in IMG/M |
| 3300005548|Ga0070665_101734336 | Not Available | 631 | Open in IMG/M |
| 3300005554|Ga0066661_10150010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Dactylosporangium → Dactylosporangium sucinum | 1426 | Open in IMG/M |
| 3300005712|Ga0070764_10369758 | Not Available | 841 | Open in IMG/M |
| 3300005719|Ga0068861_101786770 | All Organisms → cellular organisms → Bacteria | 610 | Open in IMG/M |
| 3300005764|Ga0066903_106569101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora olivasterospora | 606 | Open in IMG/M |
| 3300005921|Ga0070766_10031071 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2907 | Open in IMG/M |
| 3300006052|Ga0075029_100498463 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 803 | Open in IMG/M |
| 3300006059|Ga0075017_100558236 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 872 | Open in IMG/M |
| 3300006173|Ga0070716_101678952 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 523 | Open in IMG/M |
| 3300006175|Ga0070712_101585645 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 572 | Open in IMG/M |
| 3300006176|Ga0070765_100979220 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 799 | Open in IMG/M |
| 3300006176|Ga0070765_101007193 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 787 | Open in IMG/M |
| 3300006176|Ga0070765_102212630 | All Organisms → cellular organisms → Bacteria | 513 | Open in IMG/M |
| 3300006804|Ga0079221_10895292 | All Organisms → cellular organisms → Bacteria | 651 | Open in IMG/M |
| 3300006806|Ga0079220_10745402 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptacidiphilus | 729 | Open in IMG/M |
| 3300006806|Ga0079220_11034473 | All Organisms → cellular organisms → Bacteria | 656 | Open in IMG/M |
| 3300006854|Ga0075425_102411191 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 584 | Open in IMG/M |
| 3300006854|Ga0075425_102516617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 570 | Open in IMG/M |
| 3300006871|Ga0075434_100719555 | All Organisms → cellular organisms → Bacteria | 1015 | Open in IMG/M |
| 3300006871|Ga0075434_102141069 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 564 | Open in IMG/M |
| 3300006903|Ga0075426_10479691 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi | 923 | Open in IMG/M |
| 3300006904|Ga0075424_100404678 | All Organisms → cellular organisms → Bacteria | 1455 | Open in IMG/M |
| 3300006904|Ga0075424_102452432 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 547 | Open in IMG/M |
| 3300009012|Ga0066710_103515853 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 592 | Open in IMG/M |
| 3300009093|Ga0105240_12249961 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 565 | Open in IMG/M |
| 3300009137|Ga0066709_103637944 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 559 | Open in IMG/M |
| 3300009522|Ga0116218_1200314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 901 | Open in IMG/M |
| 3300009683|Ga0116224_10644008 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
| 3300010048|Ga0126373_11101282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 860 | Open in IMG/M |
| 3300010048|Ga0126373_11904081 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 658 | Open in IMG/M |
| 3300010159|Ga0099796_10262447 | All Organisms → cellular organisms → Bacteria | 721 | Open in IMG/M |
| 3300010366|Ga0126379_10731602 | All Organisms → cellular organisms → Bacteria | 1085 | Open in IMG/M |
| 3300010366|Ga0126379_13300939 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 540 | Open in IMG/M |
| 3300010373|Ga0134128_12642185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 553 | Open in IMG/M |
| 3300010376|Ga0126381_102933798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 679 | Open in IMG/M |
| 3300010396|Ga0134126_11476838 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 750 | Open in IMG/M |
| 3300010396|Ga0134126_12610688 | Not Available | 549 | Open in IMG/M |
| 3300010398|Ga0126383_13684377 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 500 | Open in IMG/M |
| 3300010401|Ga0134121_10374631 | All Organisms → cellular organisms → Bacteria | 1279 | Open in IMG/M |
| 3300010867|Ga0126347_1394751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 589 | Open in IMG/M |
| 3300010880|Ga0126350_11058717 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 816 | Open in IMG/M |
| 3300011120|Ga0150983_11927296 | All Organisms → cellular organisms → Bacteria | 583 | Open in IMG/M |
| 3300012357|Ga0137384_10766203 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 782 | Open in IMG/M |
| 3300012359|Ga0137385_10626302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 903 | Open in IMG/M |
| 3300012924|Ga0137413_11036961 | Not Available | 645 | Open in IMG/M |
| 3300012951|Ga0164300_10185695 | All Organisms → cellular organisms → Bacteria | 1006 | Open in IMG/M |
| 3300012958|Ga0164299_11194582 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 575 | Open in IMG/M |
| 3300012971|Ga0126369_10058591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3326 | Open in IMG/M |
| 3300012986|Ga0164304_11412366 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 572 | Open in IMG/M |
| 3300012987|Ga0164307_11648252 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 543 | Open in IMG/M |
| 3300013296|Ga0157374_10352914 | All Organisms → cellular organisms → Bacteria | 1461 | Open in IMG/M |
| 3300013296|Ga0157374_12787095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 516 | Open in IMG/M |
| 3300013306|Ga0163162_10948265 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 972 | Open in IMG/M |
| 3300016294|Ga0182041_11421771 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 637 | Open in IMG/M |
| 3300016294|Ga0182041_11615708 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 599 | Open in IMG/M |
| 3300016357|Ga0182032_10605551 | Not Available | 912 | Open in IMG/M |
| 3300016387|Ga0182040_11280424 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
| 3300016422|Ga0182039_10401572 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1163 | Open in IMG/M |
| 3300016422|Ga0182039_10505491 | All Organisms → cellular organisms → Bacteria | 1044 | Open in IMG/M |
| 3300017821|Ga0187812_1010295 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3241 | Open in IMG/M |
| 3300017822|Ga0187802_10286646 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 641 | Open in IMG/M |
| 3300017942|Ga0187808_10473496 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 578 | Open in IMG/M |
| 3300017948|Ga0187847_10061621 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 2112 | Open in IMG/M |
| 3300017959|Ga0187779_11195725 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 534 | Open in IMG/M |
| 3300017974|Ga0187777_10763640 | Not Available | 689 | Open in IMG/M |
| 3300018001|Ga0187815_10108415 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1172 | Open in IMG/M |
| 3300018046|Ga0187851_10529091 | All Organisms → cellular organisms → Bacteria | 668 | Open in IMG/M |
| 3300018046|Ga0187851_10777579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 539 | Open in IMG/M |
| 3300019887|Ga0193729_1219986 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 631 | Open in IMG/M |
| 3300020082|Ga0206353_11857535 | Not Available | 629 | Open in IMG/M |
| 3300020582|Ga0210395_10767169 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 720 | Open in IMG/M |
| 3300020583|Ga0210401_10591116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 971 | Open in IMG/M |
| 3300021180|Ga0210396_10651092 | Not Available | 913 | Open in IMG/M |
| 3300021180|Ga0210396_11226665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 627 | Open in IMG/M |
| 3300021401|Ga0210393_10492234 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1001 | Open in IMG/M |
| 3300021401|Ga0210393_10524588 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 967 | Open in IMG/M |
| 3300021402|Ga0210385_10410545 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1018 | Open in IMG/M |
| 3300021404|Ga0210389_10668917 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 814 | Open in IMG/M |
| 3300021432|Ga0210384_10137282 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2194 | Open in IMG/M |
| 3300021433|Ga0210391_10512913 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 941 | Open in IMG/M |
| 3300021433|Ga0210391_10800141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 737 | Open in IMG/M |
| 3300021474|Ga0210390_10042844 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3705 | Open in IMG/M |
| 3300021474|Ga0210390_11304471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 582 | Open in IMG/M |
| 3300021477|Ga0210398_11374846 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 553 | Open in IMG/M |
| 3300021560|Ga0126371_11629103 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 771 | Open in IMG/M |
| 3300022557|Ga0212123_10802848 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 566 | Open in IMG/M |
| 3300022724|Ga0242665_10350870 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
| 3300022726|Ga0242654_10332613 | All Organisms → cellular organisms → Bacteria | 567 | Open in IMG/M |
| 3300024249|Ga0247676_1077792 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 549 | Open in IMG/M |
| 3300025321|Ga0207656_10142752 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1129 | Open in IMG/M |
| 3300025412|Ga0208194_1056695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 602 | Open in IMG/M |
| 3300025504|Ga0208356_1083912 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 611 | Open in IMG/M |
| 3300025898|Ga0207692_10084785 | All Organisms → cellular organisms → Bacteria | 1703 | Open in IMG/M |
| 3300025909|Ga0207705_10232282 | All Organisms → cellular organisms → Bacteria | 1403 | Open in IMG/M |
| 3300025913|Ga0207695_10764010 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 847 | Open in IMG/M |
| 3300025915|Ga0207693_10419743 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1046 | Open in IMG/M |
| 3300025928|Ga0207700_10031876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 3751 | Open in IMG/M |
| 3300025929|Ga0207664_10108342 | All Organisms → cellular organisms → Bacteria | 2306 | Open in IMG/M |
| 3300025942|Ga0207689_10757876 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 819 | Open in IMG/M |
| 3300025949|Ga0207667_11734396 | All Organisms → cellular organisms → Bacteria | 590 | Open in IMG/M |
| 3300025981|Ga0207640_12082036 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae | 514 | Open in IMG/M |
| 3300026214|Ga0209838_1026614 | All Organisms → cellular organisms → Bacteria | 816 | Open in IMG/M |
| 3300026551|Ga0209648_10811890 | Not Available | 511 | Open in IMG/M |
| 3300026911|Ga0209620_1000842 | All Organisms → cellular organisms → Bacteria | 1982 | Open in IMG/M |
| 3300027037|Ga0209005_1008221 | All Organisms → cellular organisms → Bacteria | 1202 | Open in IMG/M |
| 3300027096|Ga0208099_1049649 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 599 | Open in IMG/M |
| 3300027096|Ga0208099_1049650 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 599 | Open in IMG/M |
| 3300027497|Ga0208199_1118195 | All Organisms → cellular organisms → Bacteria | 543 | Open in IMG/M |
| 3300027696|Ga0208696_1244798 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 558 | Open in IMG/M |
| 3300027817|Ga0209112_10114930 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 880 | Open in IMG/M |
| 3300027853|Ga0209274_10241965 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 922 | Open in IMG/M |
| 3300027889|Ga0209380_10749674 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 557 | Open in IMG/M |
| 3300027908|Ga0209006_11229378 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 584 | Open in IMG/M |
| 3300028718|Ga0307307_10240159 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 577 | Open in IMG/M |
| 3300028787|Ga0307323_10019103 | All Organisms → cellular organisms → Bacteria | 2333 | Open in IMG/M |
| 3300028789|Ga0302232_10016053 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4335 | Open in IMG/M |
| 3300028808|Ga0302228_10162918 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1025 | Open in IMG/M |
| 3300028877|Ga0302235_10455997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 545 | Open in IMG/M |
| 3300028906|Ga0308309_11499114 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 576 | Open in IMG/M |
| 3300029944|Ga0311352_11292030 | All Organisms → cellular organisms → Bacteria | 551 | Open in IMG/M |
| 3300029951|Ga0311371_12448661 | Not Available | 533 | Open in IMG/M |
| 3300029999|Ga0311339_10852043 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
| 3300030013|Ga0302178_10409339 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 604 | Open in IMG/M |
| 3300030399|Ga0311353_10604241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 958 | Open in IMG/M |
| 3300030503|Ga0311370_10530141 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1433 | Open in IMG/M |
| 3300030509|Ga0302183_10412838 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
| 3300030617|Ga0311356_10014224 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 8716 | Open in IMG/M |
| 3300030741|Ga0265459_13825842 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 528 | Open in IMG/M |
| 3300031236|Ga0302324_101368148 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 929 | Open in IMG/M |
| 3300031543|Ga0318516_10632284 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
| 3300031544|Ga0318534_10351115 | Not Available | 849 | Open in IMG/M |
| 3300031544|Ga0318534_10602766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 624 | Open in IMG/M |
| 3300031544|Ga0318534_10641608 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 602 | Open in IMG/M |
| 3300031549|Ga0318571_10310623 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 595 | Open in IMG/M |
| 3300031561|Ga0318528_10157426 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1211 | Open in IMG/M |
| 3300031681|Ga0318572_10809975 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 557 | Open in IMG/M |
| 3300031682|Ga0318560_10493289 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 664 | Open in IMG/M |
| 3300031708|Ga0310686_100596476 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1068 | Open in IMG/M |
| 3300031713|Ga0318496_10065795 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales | 1902 | Open in IMG/M |
| 3300031713|Ga0318496_10190690 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1125 | Open in IMG/M |
| 3300031719|Ga0306917_11381035 | Not Available | 544 | Open in IMG/M |
| 3300031723|Ga0318493_10155918 | Not Available | 1184 | Open in IMG/M |
| 3300031723|Ga0318493_10657738 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 586 | Open in IMG/M |
| 3300031724|Ga0318500_10260117 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 843 | Open in IMG/M |
| 3300031736|Ga0318501_10082241 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Micromonospora → Micromonospora olivasterospora | 1576 | Open in IMG/M |
| 3300031748|Ga0318492_10198489 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1026 | Open in IMG/M |
| 3300031751|Ga0318494_10336651 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 872 | Open in IMG/M |
| 3300031754|Ga0307475_10457585 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1025 | Open in IMG/M |
| 3300031764|Ga0318535_10505542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 537 | Open in IMG/M |
| 3300031768|Ga0318509_10562596 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
| 3300031768|Ga0318509_10808464 | All Organisms → cellular organisms → Bacteria | 518 | Open in IMG/M |
| 3300031769|Ga0318526_10218388 | All Organisms → cellular organisms → Bacteria | 780 | Open in IMG/M |
| 3300031771|Ga0318546_11071219 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 567 | Open in IMG/M |
| 3300031777|Ga0318543_10523586 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 531 | Open in IMG/M |
| 3300031781|Ga0318547_10095599 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1688 | Open in IMG/M |
| 3300031782|Ga0318552_10187931 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1044 | Open in IMG/M |
| 3300031795|Ga0318557_10095073 | All Organisms → cellular organisms → Bacteria | 1313 | Open in IMG/M |
| 3300031798|Ga0318523_10386528 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 696 | Open in IMG/M |
| 3300031821|Ga0318567_10349911 | All Organisms → cellular organisms → Bacteria | 835 | Open in IMG/M |
| 3300031821|Ga0318567_10579044 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 637 | Open in IMG/M |
| 3300031832|Ga0318499_10118727 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1028 | Open in IMG/M |
| 3300031832|Ga0318499_10395066 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 529 | Open in IMG/M |
| 3300031845|Ga0318511_10561324 | All Organisms → cellular organisms → Bacteria | 531 | Open in IMG/M |
| 3300031846|Ga0318512_10008285 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 3896 | Open in IMG/M |
| 3300031860|Ga0318495_10094728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1342 | Open in IMG/M |
| 3300031893|Ga0318536_10674683 | All Organisms → cellular organisms → Bacteria | 515 | Open in IMG/M |
| 3300031896|Ga0318551_10355904 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 829 | Open in IMG/M |
| 3300031897|Ga0318520_10199743 | All Organisms → cellular organisms → Bacteria | 1179 | Open in IMG/M |
| 3300031912|Ga0306921_10592579 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1283 | Open in IMG/M |
| 3300031912|Ga0306921_11731695 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 675 | Open in IMG/M |
| 3300031941|Ga0310912_11424941 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 523 | Open in IMG/M |
| 3300031942|Ga0310916_11291581 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 601 | Open in IMG/M |
| 3300031945|Ga0310913_10061605 | All Organisms → cellular organisms → Bacteria | 2472 | Open in IMG/M |
| 3300031954|Ga0306926_11214178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 885 | Open in IMG/M |
| 3300031959|Ga0318530_10112788 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 1087 | Open in IMG/M |
| 3300032001|Ga0306922_10230877 | All Organisms → cellular organisms → Bacteria | 1988 | Open in IMG/M |
| 3300032001|Ga0306922_10828382 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 966 | Open in IMG/M |
| 3300032001|Ga0306922_11466298 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 683 | Open in IMG/M |
| 3300032008|Ga0318562_10131766 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 1434 | Open in IMG/M |
| 3300032009|Ga0318563_10713687 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 538 | Open in IMG/M |
| 3300032010|Ga0318569_10234612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium | 852 | Open in IMG/M |
| 3300032035|Ga0310911_10539650 | All Organisms → cellular organisms → Bacteria | 676 | Open in IMG/M |
| 3300032044|Ga0318558_10456380 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 637 | Open in IMG/M |
| 3300032066|Ga0318514_10348201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 785 | Open in IMG/M |
| 3300032067|Ga0318524_10214907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micrococcales → Micrococcaceae → Arthrobacter | 985 | Open in IMG/M |
| 3300032067|Ga0318524_10737355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 520 | Open in IMG/M |
| 3300032075|Ga0310890_10854732 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 724 | Open in IMG/M |
| 3300032076|Ga0306924_11751324 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
| 3300032160|Ga0311301_11214712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 964 | Open in IMG/M |
| 3300032898|Ga0335072_10284665 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1867 | Open in IMG/M |
| 3300033547|Ga0316212_1001756 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 3003 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 32.35% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.86% |
| Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 5.88% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 4.41% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.92% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.92% |
| Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 3.92% |
| Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 3.92% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 3.43% |
| Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 2.45% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
| Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.96% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.96% |
| Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 1.47% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 1.47% |
| Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 1.47% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.47% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.98% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.98% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.98% |
| Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.98% |
| Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 0.49% |
| Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.49% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 0.49% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.49% |
| Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil | 0.49% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.49% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 0.49% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.49% |
| Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Roots | Host-Associated → Plants → Roots → Unclassified → Unclassified → Roots | 0.49% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.49% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.49% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2166559006 | Grass soil microbial communities from Rothamsted Park, UK - FI (heavy metals 2g/kg) assembled | Environmental | Open in IMG/M |
| 3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
| 3300005167 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_121 | Environmental | Open in IMG/M |
| 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Host-Associated | Open in IMG/M |
| 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
| 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Environmental | Open in IMG/M |
| 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Environmental | Open in IMG/M |
| 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Environmental | Open in IMG/M |
| 3300005529 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1 | Environmental | Open in IMG/M |
| 3300005541 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen05_05102014_R1 | Environmental | Open in IMG/M |
| 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
| 3300005554 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_110 | Environmental | Open in IMG/M |
| 3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
| 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
| 3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
| 3300006059 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2012 | Environmental | Open in IMG/M |
| 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
| 3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
| 3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006904 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD3 | Host-Associated | Open in IMG/M |
| 3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
| 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Host-Associated | Open in IMG/M |
| 3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
| 3300009522 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG | Environmental | Open in IMG/M |
| 3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
| 3300010048 | Tropical forest soil microbial communities from Panama - MetaG Plot_11 | Environmental | Open in IMG/M |
| 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
| 3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
| 3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
| 3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300010880 | Boreal forest soil eukaryotic communities from Alaska, USA - C5-1 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
| 3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
| 3300012357 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_60_16 metaG | Environmental | Open in IMG/M |
| 3300012359 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_80_16 metaG | Environmental | Open in IMG/M |
| 3300012924 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
| 3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
| 3300012986 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
| 3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
| 3300016357 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 | Environmental | Open in IMG/M |
| 3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
| 3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
| 3300017821 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_2 | Environmental | Open in IMG/M |
| 3300017822 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_2 | Environmental | Open in IMG/M |
| 3300017942 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_3 | Environmental | Open in IMG/M |
| 3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017974 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_10_MG | Environmental | Open in IMG/M |
| 3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
| 3300018046 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_10 | Environmental | Open in IMG/M |
| 3300019887 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1c2 | Environmental | Open in IMG/M |
| 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300020582 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-O | Environmental | Open in IMG/M |
| 3300020583 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-M | Environmental | Open in IMG/M |
| 3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
| 3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
| 3300021402 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-O | Environmental | Open in IMG/M |
| 3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
| 3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
| 3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
| 3300021474 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-O | Environmental | Open in IMG/M |
| 3300021477 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-O | Environmental | Open in IMG/M |
| 3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
| 3300022557 | Paint Pots_combined assembly | Environmental | Open in IMG/M |
| 3300022724 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-17-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300022726 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
| 3300024249 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK17 | Environmental | Open in IMG/M |
| 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
| 3300025504 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026214 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 2 DNA2013-047 (SPAdes) | Environmental | Open in IMG/M |
| 3300026551 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_115cm (SPAdes) | Environmental | Open in IMG/M |
| 3300026911 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM1H0_O1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027037 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300027096 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF043 (SPAdes) | Environmental | Open in IMG/M |
| 3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027696 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027817 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027853 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes) | Environmental | Open in IMG/M |
| 3300027889 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 (SPAdes) | Environmental | Open in IMG/M |
| 3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
| 3300028718 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_194 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
| 3300028808 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N1_2 | Environmental | Open in IMG/M |
| 3300028877 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N3_3 | Environmental | Open in IMG/M |
| 3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
| 3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
| 3300029951 | III_Palsa_N1 coassembly | Environmental | Open in IMG/M |
| 3300029999 | I_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030013 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_3 | Environmental | Open in IMG/M |
| 3300030399 | II_Palsa_E2 coassembly | Environmental | Open in IMG/M |
| 3300030503 | III_Palsa_E3 coassembly | Environmental | Open in IMG/M |
| 3300030509 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_2 | Environmental | Open in IMG/M |
| 3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
| 3300030741 | Forest Soil Metatranscriptomes Boreal Montmorency Forest, Quebec, Canada ANR Co-assembly | Environmental | Open in IMG/M |
| 3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
| 3300031543 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f20 | Environmental | Open in IMG/M |
| 3300031544 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26 | Environmental | Open in IMG/M |
| 3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
| 3300031561 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26 | Environmental | Open in IMG/M |
| 3300031681 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f20 | Environmental | Open in IMG/M |
| 3300031682 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22 | Environmental | Open in IMG/M |
| 3300031708 | FICUS49499 Metagenome Czech Republic combined assembly | Environmental | Open in IMG/M |
| 3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
| 3300031719 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2) | Environmental | Open in IMG/M |
| 3300031723 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
| 3300031751 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24 | Environmental | Open in IMG/M |
| 3300031754 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_515 | Environmental | Open in IMG/M |
| 3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
| 3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
| 3300031769 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f24 | Environmental | Open in IMG/M |
| 3300031771 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f19 | Environmental | Open in IMG/M |
| 3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
| 3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
| 3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
| 3300031795 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f19 | Environmental | Open in IMG/M |
| 3300031798 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f19 | Environmental | Open in IMG/M |
| 3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
| 3300031832 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25 | Environmental | Open in IMG/M |
| 3300031845 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18 | Environmental | Open in IMG/M |
| 3300031846 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19 | Environmental | Open in IMG/M |
| 3300031860 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f25 | Environmental | Open in IMG/M |
| 3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
| 3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
| 3300031897 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16 | Environmental | Open in IMG/M |
| 3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
| 3300031941 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080 | Environmental | Open in IMG/M |
| 3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
| 3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
| 3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032001 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2) | Environmental | Open in IMG/M |
| 3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
| 3300032009 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19 | Environmental | Open in IMG/M |
| 3300032010 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22 | Environmental | Open in IMG/M |
| 3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
| 3300032044 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f20 | Environmental | Open in IMG/M |
| 3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
| 3300032067 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f22 | Environmental | Open in IMG/M |
| 3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
| 3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
| 3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
| 3300032898 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1 | Environmental | Open in IMG/M |
| 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| FI_00100930 | 2166559006 | Grass Soil | VPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAPAALLRRGAAS |
| JGI12635J15846_105599551 | 3300001593 | Forest Soil | GESDTGTEVPLADGLVWAALHQDAIIVQLPERTGPLADEPAAALLRRGSAS* |
| Ga0066672_102524641 | 3300005167 | Soil | TEVPLEDGLVWAALHQDAIVVRLPDRSGPLAGQPVAALLRRG* |
| Ga0068869_1018488831 | 3300005334 | Miscanthus Rhizosphere | EIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0070674_1012993692 | 3300005356 | Miscanthus Rhizosphere | PLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS* |
| Ga0070709_100098901 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | IPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQAVAALLRRGAAT* |
| Ga0070709_117946492 | 3300005434 | Corn, Switchgrass And Miscanthus Rhizosphere | LCDGLVWAAVHQDAIVVQVPDRSGPLGGEPCAALLRRGAAR* |
| Ga0070713_1019579821 | 3300005436 | Corn, Switchgrass And Miscanthus Rhizosphere | GAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0070694_1018165312 | 3300005444 | Corn, Switchgrass And Miscanthus Rhizosphere | DGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0070741_102353781 | 3300005529 | Surface Soil | VWAALNQDAIVVQLPDRSGPLADQAVAALLRRGSAA* |
| Ga0070733_100967024 | 3300005541 | Surface Soil | GVEVPLEDGLVWAALHQDAFVVQLPDRTGPLAGEPVAALLRRGSAG* |
| Ga0070733_103043152 | 3300005541 | Surface Soil | GTEVPLDDGLVWAALHQDAIVVQLPDRTSVLGDQPVAALLRRGPA* |
| Ga0070733_103457441 | 3300005541 | Surface Soil | DSDAGTEVPLDDGLVWAALHQDSIIVQLRDRSGPLADQPAAALLHRGRGYGEAYPR* |
| Ga0070665_1017343362 | 3300005548 | Switchgrass Rhizosphere | AEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS* |
| Ga0066661_101500101 | 3300005554 | Soil | VPLEDGLVWAALHQDAIVVRLPDRSGPLAGQPVAALLRRG* |
| Ga0070764_103697582 | 3300005712 | Soil | GLVWAALNQDAIVLRRPDRTGPLAGQPVAALLRRGAAS* |
| Ga0068861_1017867702 | 3300005719 | Switchgrass Rhizosphere | VPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0066903_1065691012 | 3300005764 | Tropical Forest Soil | PLEDGLAWAALHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG* |
| Ga0070766_100310715 | 3300005921 | Soil | EVPLEDGLVWAALHQDAIVVQLPDRTGLLAGEPAAALLRRGSAR* |
| Ga0075029_1004984631 | 3300006052 | Watersheds | AIHQDAIIVQLPERTGPLAGEPAAALLRRGSIPG* |
| Ga0075017_1005582361 | 3300006059 | Watersheds | WAAVHQDAIVVQLPDRTGPLAGEPVAALLRRGSAP* |
| Ga0070716_1016789522 | 3300006173 | Corn, Switchgrass And Miscanthus Rhizosphere | TGDAGAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0070712_1015856452 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | VPLEDGLVWAALHQDAIVVELPDRSGSLAGQPAAALLRRGAAS* |
| Ga0070765_1009792202 | 3300006176 | Soil | GLVWAALHQDAIVVQLPDRTGLLAGEPAAALLRRGSAR* |
| Ga0070765_1010071933 | 3300006176 | Soil | VWAALHQDSIVVQLPGRTGPLDGQPAAALLRRGSS* |
| Ga0070765_1022126301 | 3300006176 | Soil | EVPLEDGLVWAALHQDAIIVQLPERTGPLADEPAAALLRRGSAS* |
| Ga0079221_108952922 | 3300006804 | Agricultural Soil | EDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0079220_107454023 | 3300006806 | Agricultural Soil | EVPLADGLAWAALHQDAIVVQLPDRAGPLAGQPVAALLRRGPAA* |
| Ga0079220_110344731 | 3300006806 | Agricultural Soil | ARAEVPLADGLAWAALHQDAIVVQLPDRDGPLAGQPAAALLRRGSAA* |
| Ga0075425_1024111911 | 3300006854 | Populus Rhizosphere | VPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAA* |
| Ga0075425_1025166172 | 3300006854 | Populus Rhizosphere | GTEVPLEDGLVWAALHQDAIVVRLPDRSGPLAGQPVAALLRRG* |
| Ga0075434_1007195553 | 3300006871 | Populus Rhizosphere | AALHQDAIVVQLPDRAGPLAGQPVAALLRRGPAA* |
| Ga0075434_1021410692 | 3300006871 | Populus Rhizosphere | LVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGTAS* |
| Ga0075426_104796912 | 3300006903 | Populus Rhizosphere | EDGLVWAALHQDAIVVQLPDRSGPLAGQPTAALLRRGAAS* |
| Ga0075424_1004046783 | 3300006904 | Populus Rhizosphere | GDEGTGDAGAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS* |
| Ga0075424_1024524322 | 3300006904 | Populus Rhizosphere | EVPLADGLAWAALHQDAIVVQLPDRDGPLAGQPAAALLRRGSAA* |
| Ga0066710_1035158531 | 3300009012 | Grasslands Soil | SDVGTEVPLEDGLVWAALHQDAIVVRLPDRSGPLAGQPVAALLRRG |
| Ga0105240_122499611 | 3300009093 | Corn Rhizosphere | GDAGTGDASTEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0066709_1036379442 | 3300009137 | Grasslands Soil | SDAGTEVPLEDGLVWAALHQDAIVVRLPDRSGPLAGQPVAALLRRG* |
| Ga0116218_12003143 | 3300009522 | Peatlands Soil | IGVEVPPEDGLVWAAVHQDAIVVQLPDRTGPLAGEPVAALLRRGSAS* |
| Ga0116224_106440081 | 3300009683 | Peatlands Soil | TGTEVPLDDGLVWAALHQDAIVVQLPDRAGPLAGEPAAALLRRGSAG* |
| Ga0126373_111012821 | 3300010048 | Tropical Forest Soil | VPLADGLAWAALHQDAIVVQLPDRAGPLAGQPAAALLRRGPAA* |
| Ga0126373_119040811 | 3300010048 | Tropical Forest Soil | LTDGLAWAALHQDAIVVQLPDRDGPLAGEPAAALLRRGPAA* |
| Ga0099796_102624471 | 3300010159 | Vadose Zone Soil | DGLVWAALHQDAIVVRLPDRSGPLAGQPVAALLRRA* |
| Ga0126379_107316021 | 3300010366 | Tropical Forest Soil | EVPLEDGLAWAALHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG* |
| Ga0126379_133009392 | 3300010366 | Tropical Forest Soil | DGLAWAALHQDAIVVQLPDRAGPLAGQPAAALLRRGRAA* |
| Ga0134128_126421852 | 3300010373 | Terrestrial Soil | AGDAGTGDASTEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0126381_1029337981 | 3300010376 | Tropical Forest Soil | VPLADGLAWAALHQDAVVVQLSDRAGPLAGWPAAALLRRGPAA* |
| Ga0134126_114768381 | 3300010396 | Terrestrial Soil | LVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0134126_126106882 | 3300010396 | Terrestrial Soil | IPVPLEDGLVWAALHQDAIVVQLPDRSEPLAGQPAAALLRRGAAS* |
| Ga0126383_136843771 | 3300010398 | Tropical Forest Soil | PAARTEVPLADALAWAALHQDAIIVQLPDRAGPLAGQPVAALLRRGPVA* |
| Ga0134121_103746313 | 3300010401 | Terrestrial Soil | IPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS* |
| Ga0126347_13947512 | 3300010867 | Boreal Forest Soil | VDDSDIGVDVPLEDGLVWAALHQDAVVIQLPDRTGPLAGEPAAALLRRGSAG* |
| Ga0126350_110587172 | 3300010880 | Boreal Forest Soil | LEDGLVWAALHQDAIVLRRPDRTGPLAGQPVAALLRRGAAS* |
| Ga0150983_119272962 | 3300011120 | Forest Soil | WAALHQDAIIVQLPERTGPLAGEPVAALLRRGPAADR* |
| Ga0137384_107662032 | 3300012357 | Vadose Zone Soil | VPLADGLAWAALHQDAIVVQLPDPAGPLAGRPAAALLRRGPAA* |
| Ga0137385_106263021 | 3300012359 | Vadose Zone Soil | DGLVWAALHQDAIVVRLPDRSGPLAGQPVAALLRRG* |
| Ga0137413_110369611 | 3300012924 | Vadose Zone Soil | ASTEIPVSLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0164300_101856953 | 3300012951 | Soil | DGLVGAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS* |
| Ga0164299_111945822 | 3300012958 | Soil | GDQVSGIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0126369_100585911 | 3300012971 | Tropical Forest Soil | AARAQVPLADGLAWAALHQDAIVVQLPDRAGPRAGWPAAALLRRGPAA* |
| Ga0164304_114123661 | 3300012986 | Soil | PVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS* |
| Ga0164307_116482521 | 3300012987 | Soil | GDEGTGDAGAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLTGQPTAALLRRGAAS* |
| Ga0157374_103529141 | 3300013296 | Miscanthus Rhizosphere | DEGTGDAGAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS* |
| Ga0157374_127870952 | 3300013296 | Miscanthus Rhizosphere | VWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0163162_109482651 | 3300013306 | Switchgrass Rhizosphere | AALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS* |
| Ga0182041_114217712 | 3300016294 | Soil | GLVWAAVHQDAIVVQLPDRTGPLAGEPVAALLRRGFAG |
| Ga0182041_116157082 | 3300016294 | Soil | LLAAGDSAAGAEVPLADGLAWAALYQDSIIVQLPDRDGPLAGQPAAALLRRGSAA |
| Ga0182032_106055512 | 3300016357 | Soil | EDGLIWAALHQDAIVVQLPDRTGALAGQPAAALLRRGRS |
| Ga0182040_112804242 | 3300016387 | Soil | DGLTCAALHQDAIVVQLPDRTGALAGQPAAALLRRGRL |
| Ga0182039_104015721 | 3300016422 | Soil | ELLAADDPAARAQVSLADGLAWAALHQDAIVVQLPDRAGPLAGWPAAALLRRGPAA |
| Ga0182039_105054912 | 3300016422 | Soil | DGLVWAALNQDAIVVELPDRSGPLAGEPVAALLRRGPAG |
| Ga0187812_10102956 | 3300017821 | Freshwater Sediment | VDEADTGVEVPLDDGLVWAAVNQDATVVQLPDRTGPLAGEPAAALLRRGSAG |
| Ga0187802_102866461 | 3300017822 | Freshwater Sediment | DSDTGVEVPLGDGLVWAAVHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG |
| Ga0187808_104734961 | 3300017942 | Freshwater Sediment | TGVEVPLDDGLVWAAVHQDAIVVQLPDRTGPLAGEPAAALLRRGAAG |
| Ga0187847_100616212 | 3300017948 | Peatland | VPLEDGLVWAALHQDAIVVQLPDRTGPLAGERAAALLRRGSAR |
| Ga0187779_111957252 | 3300017959 | Tropical Peatland | DPDIGVEVPLEDGLAWAALHQDAIVVQLPDRTGPLAGQPAAALLRRGPAS |
| Ga0187777_107636402 | 3300017974 | Tropical Peatland | DDSSIGTQVPLEDGLVWAALHQDAFVLQLPDRTGPLAGQPAAALLRRGAGS |
| Ga0187815_101084153 | 3300018001 | Freshwater Sediment | GTEVPLDDGLVWAALHQDAIVVQLPDRAGPLAGEPAAALLRRGSAG |
| Ga0187851_105290912 | 3300018046 | Peatland | PLEDGLVWAAIHQDAIIVQLPERTGPLAGEPAAALLRRGSAS |
| Ga0187851_107775792 | 3300018046 | Peatland | VVPLEDGLVWAALHQDAIVVQLPDRTGPLAGEQAAALLRRGSAR |
| Ga0193729_12199862 | 3300019887 | Soil | DSDVGTEVPLEDGLVWAALHQDAIVVRLPDRSGPLAGQPVAALLRRG |
| Ga0206353_118575351 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | GAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS |
| Ga0210395_107671691 | 3300020582 | Soil | AGTDVPLADGLAWAALHQDAIVVQLPDRTGPLAGQPAAALLRRGPAA |
| Ga0210401_105911163 | 3300020583 | Soil | SDIRVEVPLEDGLVWAALHQDAIVVQLPDRTGLLAGEPAAALLRRSSAR |
| Ga0210396_106510921 | 3300021180 | Soil | EVPLEDGLVWAALHQDAIIVRLPDRSGPLDGQPVAALLRRG |
| Ga0210396_112266652 | 3300021180 | Soil | EDGLVWAALHQDAIIVRLPDRSGPLAGQPVAALLRRG |
| Ga0210393_104922341 | 3300021401 | Soil | LEDGLVWAALHQDAIIVRLPDRSGPLDGQPVAALLRRG |
| Ga0210393_105245881 | 3300021401 | Soil | DSDVGTEVPLEDGLVWAALHQDAIIVRLPDRSGPLAGQPVAALLRRG |
| Ga0210385_104105451 | 3300021402 | Soil | EFLVGEPDAGTEVPPADGLVWAALLQDAIVVQLPDRAGPLAGEPAAALLRRGPAA |
| Ga0210389_106689171 | 3300021404 | Soil | EVPLEDGLVWAAIHQDAIIVQLPDRTGLLAGEPAAALLRRGSLS |
| Ga0210384_101372821 | 3300021432 | Soil | PLEDGLVWAALHQDAIIVRLPDRSGPLAGQPVAALLRRG |
| Ga0210391_105129132 | 3300021433 | Soil | DSDIRVEVPLEDGLVWAALHQDAIVVQLPDRTGLLAGEPAAALLRRGSAR |
| Ga0210391_108001411 | 3300021433 | Soil | LVWAALHQDAIVVQLPDRTGPLAGEPAAALLRRGAAR |
| Ga0210390_100428445 | 3300021474 | Soil | DSDVGTEVPLEDGLVWAALHQDAIIVRLPDRSGPLAGQPVAGLLRRG |
| Ga0210390_113044712 | 3300021474 | Soil | LVDDSDAGTEVPLDDGLVWAALHQDSIVVQLSARSDSLAGQPVAALLRRGSS |
| Ga0210398_113748461 | 3300021477 | Soil | LEDGLVWAALHQEAIVVQLPDRTGPLAGEPAAALLRRGSAR |
| Ga0126371_116291033 | 3300021560 | Tropical Forest Soil | GTEVPLEDGLVWAAVHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG |
| Ga0212123_108028481 | 3300022557 | Iron-Sulfur Acid Spring | VPLGDGLVWAALHQDAIIVQLPDRTGPLAGEPAAALLRRGSAS |
| Ga0242665_103508701 | 3300022724 | Soil | SDIDVEVPLEDGLVWAALHQDAIVVQLPDRTGPLAGEPAAALLRRGSAR |
| Ga0242654_103326131 | 3300022726 | Soil | PLDDGLVWAAVHQDAIIVQLPDRNGALAGEAAAALLRRGSAR |
| Ga0247676_10777921 | 3300024249 | Soil | EIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS |
| Ga0207656_101427522 | 3300025321 | Corn Rhizosphere | DADAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS |
| Ga0208194_10566952 | 3300025412 | Peatland | GVGESATGTEVPLEDGLVWAAIHQDAIIVQLPERTGPLAGERAAALLRRGSAR |
| Ga0208356_10839122 | 3300025504 | Arctic Peat Soil | TDDGVEVPAEDGMVWAALHQDAIVVQLPDRAGALAGEPAAALLRRGQAS |
| Ga0207692_100847853 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | EIPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS |
| Ga0207705_102322823 | 3300025909 | Corn Rhizosphere | PLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS |
| Ga0207695_107640101 | 3300025913 | Corn Rhizosphere | VPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS |
| Ga0207693_104197432 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | DAGAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS |
| Ga0207700_100318761 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | VGDSDIGTEVPLEDGLVWAALHQDAIVVRLPDRSGPLAGQPVAALLRRG |
| Ga0207664_101083421 | 3300025929 | Agricultural Soil | GDAGAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS |
| Ga0207689_107578761 | 3300025942 | Miscanthus Rhizosphere | GDAGTGDASTEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS |
| Ga0207667_117343961 | 3300025949 | Corn Rhizosphere | SEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS |
| Ga0207640_120820362 | 3300025981 | Corn Rhizosphere | VGDEGTGDAGAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS |
| Ga0209838_10266142 | 3300026214 | Soil | EVPLEDGLIWAAIHQDAIIVQLPERTGPLAGEPAAALLRRGSAS |
| Ga0209648_108118902 | 3300026551 | Grasslands Soil | TGIEVPLEDGLVWAALHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG |
| Ga0209620_10008421 | 3300026911 | Forest Soil | VGDEGTGDAGAEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS |
| Ga0209005_10082212 | 3300027037 | Forest Soil | LTLIAVMVWAALHQDAIVVQLPERTGPLAGESVAALLRRGPVA |
| Ga0208099_10496491 | 3300027096 | Forest Soil | SDIRVEVPLEDGLVWAALHQDAIVVQLPDRTGPLAGEPAAALLRRGAAR |
| Ga0208099_10496501 | 3300027096 | Forest Soil | SDIRVEVPLEDGLVWAALHQDAIVVQLPDRTGLLAGEPAAALLRRGSAR |
| Ga0208199_11181952 | 3300027497 | Peatlands Soil | VGESDIGVEVPPEDGLVWAAVHQDAIVVQLPDRTGPLAGEPVAALLRRGSAS |
| Ga0208696_12447982 | 3300027696 | Peatlands Soil | TGTEVPLDDGLVWAALHQDAIVVQLPDRAGPLAGEPAAALLRRGSAG |
| Ga0209112_101149301 | 3300027817 | Forest Soil | LVGQSDAGTEVPLADGMVWAALHQDAIVVQLPERTGPLAGESVAALLRRGPVA |
| Ga0209274_102419651 | 3300027853 | Soil | DSDTGVEVPLEDGLVWAALHQDAIVVQLPDRTGSLAGEPAAALLRRGSAG |
| Ga0209380_107496742 | 3300027889 | Soil | DDSDIGVEVPLEDGLVWAALHQDAIVIQLPDRTGPLAGEPAAALLRRGSAR |
| Ga0209006_112293781 | 3300027908 | Forest Soil | TEVPLADGMVWAALHQDAIVVQLAERTGPLAGESVAALLRRGPVA |
| Ga0307307_102401591 | 3300028718 | Soil | ASTEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS |
| Ga0307323_100191031 | 3300028787 | Soil | AGTGDASTEIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS |
| Ga0302232_100160531 | 3300028789 | Palsa | EDGLIWAALQQDAIIVQLPERTGPLAGEPAAALLRRGSAS |
| Ga0302228_101629183 | 3300028808 | Palsa | AVEDGLVWAAIHQDAIIAQLAERTGPLAGEPVAALLRRGSVS |
| Ga0302235_104559972 | 3300028877 | Palsa | DDGLVWAAVHQDAIVVQVPDRSGPLAGEPAAALLRRGVAR |
| Ga0308309_114991141 | 3300028906 | Soil | VWAALHQDSIVVQLPGRTGPLDGQPAAALLRRGSS |
| Ga0311352_112920301 | 3300029944 | Palsa | VLLVAADAALEDGLVWAAIHQDAIIVQLAERTGPLAGEGAAALLRRGSAS |
| Ga0311371_124486612 | 3300029951 | Palsa | GLIWAALHQDAIIVQLPDRTGPLAGEPAAALLHRGSLPAGRSHGVG |
| Ga0311339_108520431 | 3300029999 | Palsa | PLEDGLVWAALHQDAIIVQLPERTGPLADEPAAALLRRGSAS |
| Ga0302178_104093392 | 3300030013 | Palsa | GDVDAGVPVPLEDGLVWAALHQDAIVVQLPDRAGPLAGEPVAALLRRGGA |
| Ga0311353_106042411 | 3300030399 | Palsa | IWAALHQDAIIVQLPERTGPLADEPAAALLRRGSAS |
| Ga0311370_105301411 | 3300030503 | Palsa | VGEPDAGTEVPLEDGLVWAAIHQDAIIVQLPERTGPLAGEPAAALLRGGSG |
| Ga0302183_104128381 | 3300030509 | Palsa | ADAALEDGLVWAAIHQDAIIVQLPRRTGPLAGEPAAALLRRGSVS |
| Ga0311356_100142241 | 3300030617 | Palsa | PLEDGLIWAALQQDAIIVQLPERTGPLAGEPAAALLRRGSAS |
| Ga0265459_138258421 | 3300030741 | Soil | LVAADAALEDDLVWAALRQDAIVAPLPERTGPLAGEPAAALLRRGSAS |
| Ga0302324_1013681483 | 3300031236 | Palsa | DGLVWAAVHQDAIVVQVPDRTGPLAGEPAAALLRRGVAR |
| Ga0318516_106322841 | 3300031543 | Soil | LEDGLVWAAVHQDAIVVQMPDRTGPLAGEPTAALLRRGSAG |
| Ga0318534_103511152 | 3300031544 | Soil | TEVPLEDGLIWAALHQDAIVVQLPDRTGALAGQPAAALLRRGRS |
| Ga0318534_106027662 | 3300031544 | Soil | GLVWAAVHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG |
| Ga0318534_106416082 | 3300031544 | Soil | GAEVPLVDGLAWAALYQDAIVVQLPDRDGPLAGQPVAALLRRGSAA |
| Ga0318571_103106231 | 3300031549 | Soil | DGLVWAALHQDAIVVQLPDRGGPLNGQPAAALLRRGPAA |
| Ga0318528_101574263 | 3300031561 | Soil | ASTDVPLADGLAWAALHQDAIVVQLPDRARPLAGRPPAALLRRGPAA |
| Ga0318572_108099751 | 3300031681 | Soil | LEDGLVWAALHQDAIVVQLPDRTGPLAGQVAAALLRRARA |
| Ga0318560_104932892 | 3300031682 | Soil | EDGLVWAAVHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG |
| Ga0310686_1005964762 | 3300031708 | Soil | EDGLVWAALHQDAIVVQLPDRTGPLAGEPTAALLRRGSAR |
| Ga0318496_100657951 | 3300031713 | Soil | DPAASTDVPLADGLAWAALHQDAIVVQLPDRARPLAGRPPAALLRRGPAA |
| Ga0318496_101906901 | 3300031713 | Soil | DQELGRTDPDTGVEVPLEDGLAWAALNQDAIVVQLPDRAGPLAGEPVAALLRRGPAS |
| Ga0306917_113810351 | 3300031719 | Soil | LVWAALHQDAIVAQLPVRPGPLAGETAAALLRRGAAS |
| Ga0318493_101559184 | 3300031723 | Soil | PLEDGLVWAALHQDAIVVQLPDRTGPLAGQVAAALLRRARA |
| Ga0318493_106577381 | 3300031723 | Soil | VWAALHQDAIVVQLPDRTGPLAGEPTAALLRRGSAG |
| Ga0318500_102601171 | 3300031724 | Soil | PDTGVEVPLEDGLAWAALNQDAIVVQLPDRAGPLAGEPVAALLRRGPAS |
| Ga0318501_100822411 | 3300031736 | Soil | LEDGLAWAALNQDAIVVQLPDRAGPLAGEPVAALLRRGPAS |
| Ga0318492_101984891 | 3300031748 | Soil | EVPLDDGLVWAAVHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG |
| Ga0318494_103366512 | 3300031751 | Soil | DGLVWAALHQDAIVVRLPDRTGPLAGEPAAALLRRGPGR |
| Ga0307475_104575851 | 3300031754 | Hardwood Forest Soil | LEDGLVWAALHQDAIVVQLPDRTGLLAGEPAAALLRRSSAR |
| Ga0318535_105055421 | 3300031764 | Soil | VEVPLDDGLVWAAVHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG |
| Ga0318509_105625962 | 3300031768 | Soil | VWAAVHQDAIVVQLSDRTGPLGGEPAAALLRRGFAG |
| Ga0318509_108084642 | 3300031768 | Soil | PLEDGLVWAAVHQDAIVVQLPDRTGPLAGEPVAALLRRGSAG |
| Ga0318526_102183882 | 3300031769 | Soil | VWAALHQDAIVVQLPDRTGPLAGQVAAALLRRARA |
| Ga0318546_110712191 | 3300031771 | Soil | LEDGLVWAAVHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG |
| Ga0318543_105235861 | 3300031777 | Soil | SVLADGLAWAALHQDAIVVQLPDRARPLAGRPPAALLRRGPAA |
| Ga0318547_100955994 | 3300031781 | Soil | GDPAASTDVPLADGLAWAALHQDAIVVQLPDRARPLAGRPPAALLRRGPAA |
| Ga0318552_101879314 | 3300031782 | Soil | ELVWAALHQDAIVAPLPARSGPLAGEAAAALLRRG |
| Ga0318557_100950731 | 3300031795 | Soil | VDDPDTGVEVPLEDGLVWAAVHQDAIVVQLPDRTGPLAGEPVAALLRRGSAG |
| Ga0318523_103865281 | 3300031798 | Soil | VWAALHQDAIVVRLPDRTGPLAGQPAAALLRRGPGR |
| Ga0318567_103499112 | 3300031821 | Soil | ADIGTEVPLEDGLVWAALHQDAIVVQLPDRTGPLAGQVAAALLRRARA |
| Ga0318567_105790441 | 3300031821 | Soil | TAVPLADGLAWAALHQDAIIVQLPDRAGPLAGEPAAALLRRGHAT |
| Ga0318499_101187271 | 3300031832 | Soil | SYTGVEVPLEDGLVWAAVHQDAIVVQLSDRTGPLGGEPAAALLRRGFAG |
| Ga0318499_103950662 | 3300031832 | Soil | LVWAALHQDAIVVRLPDRTGPLAGQPAAALLRRGPGG |
| Ga0318511_105613242 | 3300031845 | Soil | TWAALHQDAIVVQLPDRTGALAGQPAAALLRRGRL |
| Ga0318512_100082854 | 3300031846 | Soil | TWVPLEDGLTWAALHQDAIVVQLPDRTGALAGQPAAALLRRGRL |
| Ga0318495_100947281 | 3300031860 | Soil | EVPLEDGLVWAAVHQDAIVVQLSDRTGPLGGEPAAALLRRGFAG |
| Ga0318536_106746832 | 3300031893 | Soil | SGSGTQVPLEDGLTWAALHQDAIVVQLPDRTGALAGQPAAALLRRGRL |
| Ga0318551_103559043 | 3300031896 | Soil | ASPAASTDVPLADGLAWAALHQDAIVVQLPDRARPLAGRPPAALLRRGPAA |
| Ga0318520_101997433 | 3300031897 | Soil | VEVPLEDGLVWAAVHQDAIVVQLPDRTGPLAGEPVAALLRRGSAG |
| Ga0306921_105925791 | 3300031912 | Soil | EDGLVWAALHQDAIVVQLPDRGGPLNGQPAAALLRRGPAA |
| Ga0306921_117316951 | 3300031912 | Soil | VTGIPVPLEDGLVWAALHQDAIVVQLPDRSGPLAGQPAAALLRRGAAS |
| Ga0310912_114249412 | 3300031941 | Soil | DGLVWAAVHQDAIVVQMPDRAGPLAGEPTAALLRRGSAG |
| Ga0310916_112915811 | 3300031942 | Soil | VEVPLEDGLVWAAVHQDAIVVQMPDRAGPLAGEPTAALLRRGSAG |
| Ga0310913_100616051 | 3300031945 | Soil | FGVGDSGSGTQVPLEDGLTWAALHQDAIVVQLPDRTGALAGQPAAALLRRGRL |
| Ga0306926_112141781 | 3300031954 | Soil | WAALHQDAIVVQLPDRTGPLAGEPTAALLRRGSAG |
| Ga0318530_101127881 | 3300031959 | Soil | DDPDTGVEVPLEDGLAWAALNQDAIVVQLPDRAGPLAGEPVAALLRRGPAS |
| Ga0306922_102308771 | 3300032001 | Soil | AWAALNQDAIVVQLPDRAGPLAGEPVAALLRRGPAS |
| Ga0306922_108283822 | 3300032001 | Soil | TGVEVPLEDGLVWAAVHQDAIVVQLPDRTGPLAGEPAAALLRRGSAG |
| Ga0306922_114662983 | 3300032001 | Soil | ARTEVPLADGLAWAALHQDAIIVQLPDRAGPLAGEPAAALLRRGHAT |
| Ga0318562_101317661 | 3300032008 | Soil | LEDGLTWAALHQDAIVVQLPDRTGALAGQPAAALLRRGRL |
| Ga0318563_107136871 | 3300032009 | Soil | AEVPLADGLAWAALHQDAIVVQLPDRAGPLAGEPAAALLRRGHAT |
| Ga0318569_102346122 | 3300032010 | Soil | LVWAALHQDAIVVRLPDRTGPLAGEPAAALLRRGPGR |
| Ga0310911_105396501 | 3300032035 | Soil | DGLAWAALHQDAIVVQLRDRAGPLAGWPAAALLRRGPAA |
| Ga0318558_104563802 | 3300032044 | Soil | FEDGLIWAALHQDAIVVQLPDRTGPLDGQPAAALLRRGPVS |
| Ga0318514_103482012 | 3300032066 | Soil | TSVLADGLAWAALHQDAIVVQLPDRARPLAGRPPAALLRRGPAA |
| Ga0318524_102149071 | 3300032067 | Soil | STDVPLADGLAWAALHQDAIVVQLPDRARPLAGRPPAALLRRGPAA |
| Ga0318524_107373552 | 3300032067 | Soil | LDDRLVWAAVHQDAIVVQLPDRTGPLAGEPVAALLRRGFAG |
| Ga0310890_108547321 | 3300032075 | Soil | IPVPLEDGLVWAALHQDAIVVQLPDRSGPLDGHPAAALLRRGAAS |
| Ga0306924_117513241 | 3300032076 | Soil | LVDDPDTGVEVPLEDGLAWAALHQDAIVVLLPDRTGPLAGEPVAALLRRGPAG |
| Ga0311301_112147122 | 3300032160 | Peatlands Soil | ESDTGTEVPLEDGLVWAAIHQDAIIVQLPERTGPLAGEPAAALLRRGSVS |
| Ga0335072_102846653 | 3300032898 | Soil | AGLVWAALHQDAIVAQLPARTGPLAGDPAAALLRRGPAS |
| Ga0316212_10017567 | 3300033547 | Roots | VWAALHQDAIIVQLPERTGPLAGEPVAALLRRGPAADR |
| ⦗Top⦘ |