| Basic Information | |
|---|---|
| Family ID | F024789 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 204 |
| Average Sequence Length | 43 residues |
| Representative Sequence | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDESFNKDTEN |
| Number of Associated Samples | 139 |
| Number of Associated Scaffolds | 204 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 49.75 % |
| % of genes near scaffold ends (potentially truncated) | 12.25 % |
| % of genes from short scaffolds (< 2000 bps) | 57.84 % |
| Associated GOLD sequencing projects | 123 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.34 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (62.745 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine (17.157 % of family members) |
| Environment Ontology (ENVO) | Unclassified (56.373 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) (62.745 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 11.76% β-sheet: 17.65% Coil/Unstructured: 70.59% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 204 Family Scaffolds |
|---|---|---|
| PF13640 | 2OG-FeII_Oxy_3 | 6.37 |
| PF00255 | GSHPx | 3.92 |
| PF01844 | HNH | 2.45 |
| PF00296 | Bac_luciferase | 1.96 |
| PF00685 | Sulfotransfer_1 | 1.96 |
| PF04973 | NMN_transporter | 1.96 |
| PF16861 | Carbam_trans_C | 1.47 |
| PF11397 | GlcNAc | 1.47 |
| PF05050 | Methyltransf_21 | 0.98 |
| PF03031 | NIF | 0.98 |
| PF12849 | PBP_like_2 | 0.98 |
| PF04488 | Gly_transf_sug | 0.98 |
| PF00011 | HSP20 | 0.98 |
| PF04577 | Glyco_transf_61 | 0.98 |
| PF07235 | DUF1427 | 0.98 |
| PF05118 | Asp_Arg_Hydrox | 0.49 |
| PF13524 | Glyco_trans_1_2 | 0.49 |
| PF01370 | Epimerase | 0.49 |
| PF09360 | zf-CDGSH | 0.49 |
| PF02335 | Cytochrom_C552 | 0.49 |
| PF03171 | 2OG-FeII_Oxy | 0.49 |
| PF13370 | Fer4_13 | 0.49 |
| PF02543 | Carbam_trans_N | 0.49 |
| PF00082 | Peptidase_S8 | 0.49 |
| PF00154 | RecA | 0.49 |
| PF02668 | TauD | 0.49 |
| PF02945 | Endonuclease_7 | 0.49 |
| PF13578 | Methyltransf_24 | 0.49 |
| PF09834 | DUF2061 | 0.49 |
| PF00534 | Glycos_transf_1 | 0.49 |
| PF08007 | JmjC_2 | 0.49 |
| COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
|---|---|---|---|
| COG0386 | Thioredoxin/glutathione peroxidase BtuE, reduces lipid peroxides | Defense mechanisms [V] | 3.92 |
| COG2141 | Flavin-dependent oxidoreductase, luciferase family (includes alkanesulfonate monooxygenase SsuD and methylene tetrahydromethanopterin reductase) | Coenzyme transport and metabolism [H] | 1.96 |
| COG3201 | Nicotinamide riboside transporter PnuC | Coenzyme transport and metabolism [H] | 1.96 |
| COG0071 | Small heat shock protein IbpA, HSP20 family | Posttranslational modification, protein turnover, chaperones [O] | 0.98 |
| COG3774 | Mannosyltransferase OCH1 or related enzyme | Cell wall/membrane/envelope biogenesis [M] | 0.98 |
| COG4317 | Xanthosine utilization system component, XapX domain | Nucleotide transport and metabolism [F] | 0.98 |
| COG5190 | TFIIF-interacting CTD phosphatase, includes NLI-interacting factor | Transcription [K] | 0.98 |
| COG0468 | RecA/RadA recombinase | Replication, recombination and repair [L] | 0.49 |
| COG2175 | Taurine dioxygenase, alpha-ketoglutarate-dependent | Secondary metabolites biosynthesis, transport and catabolism [Q] | 0.49 |
| COG2192 | Predicted carbamoyl transferase, NodU family | General function prediction only [R] | 0.49 |
| COG2850 | Ribosomal protein L16 Arg81 hydroxylase, contains JmjC domain | Translation, ribosomal structure and biogenesis [J] | 0.49 |
| COG3303 | Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit | Inorganic ion transport and metabolism [P] | 0.49 |
| COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.49 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 62.75 % |
| All Organisms | root | All Organisms | 37.25 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 2035265000|ErSWdraf_F5BXKTZ02GQMNG | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 518 | Open in IMG/M |
| 3300000756|JGI12421J11937_10018561 | All Organisms → cellular organisms → Bacteria | 2586 | Open in IMG/M |
| 3300000756|JGI12421J11937_10161067 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 547 | Open in IMG/M |
| 3300001282|B570J14230_10026734 | Not Available | 2070 | Open in IMG/M |
| 3300001282|B570J14230_10172275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 608 | Open in IMG/M |
| 3300002296|B570J29587_1001541 | All Organisms → Viruses → Predicted Viral | 2158 | Open in IMG/M |
| 3300002383|B570J29604_1000028 | Not Available | 11044 | Open in IMG/M |
| 3300002387|B570J29608_1000148 | Not Available | 6214 | Open in IMG/M |
| 3300002408|B570J29032_109849556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1642 | Open in IMG/M |
| 3300002447|JGI24768J34885_10003088 | Not Available | 5388 | Open in IMG/M |
| 3300002835|B570J40625_100078016 | All Organisms → Viruses → Predicted Viral | 4315 | Open in IMG/M |
| 3300002835|B570J40625_100213215 | Not Available | 2070 | Open in IMG/M |
| 3300002835|B570J40625_100252163 | All Organisms → cellular organisms → Bacteria | 1838 | Open in IMG/M |
| 3300002835|B570J40625_100363583 | All Organisms → Viruses → Predicted Viral | 1427 | Open in IMG/M |
| 3300002835|B570J40625_100824488 | Not Available | 812 | Open in IMG/M |
| 3300002835|B570J40625_101534920 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 546 | Open in IMG/M |
| 3300003395|JGI25917J50250_1001399 | Not Available | 6836 | Open in IMG/M |
| 3300003395|JGI25917J50250_1016047 | Not Available | 1780 | Open in IMG/M |
| 3300003413|JGI25922J50271_10000898 | Not Available | 8721 | Open in IMG/M |
| 3300003429|JGI25914J50564_10003313 | Not Available | 5440 | Open in IMG/M |
| 3300003493|JGI25923J51411_1000331 | Not Available | 8198 | Open in IMG/M |
| 3300003616|JGI25928J51866_1093589 | Not Available | 649 | Open in IMG/M |
| 3300003986|Ga0063233_10041651 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1251 | Open in IMG/M |
| 3300004054|Ga0063232_10185029 | Not Available | 617 | Open in IMG/M |
| 3300004054|Ga0063232_10242193 | Not Available | 543 | Open in IMG/M |
| 3300004096|Ga0066177_10107098 | All Organisms → Viruses → Predicted Viral | 1075 | Open in IMG/M |
| 3300004112|Ga0065166_10486507 | Not Available | 522 | Open in IMG/M |
| 3300004369|Ga0065726_18133 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 10735 | Open in IMG/M |
| 3300005580|Ga0049083_10001350 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 9242 | Open in IMG/M |
| 3300005581|Ga0049081_10030956 | All Organisms → Viruses → Predicted Viral | 2034 | Open in IMG/M |
| 3300005583|Ga0049085_10000851 | Not Available | 12068 | Open in IMG/M |
| 3300005583|Ga0049085_10310136 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 512 | Open in IMG/M |
| 3300005584|Ga0049082_10000658 | Not Available | 10249 | Open in IMG/M |
| 3300005584|Ga0049082_10029080 | Not Available | 1928 | Open in IMG/M |
| 3300005584|Ga0049082_10293663 | Not Available | 543 | Open in IMG/M |
| 3300005662|Ga0078894_10248972 | All Organisms → Viruses → Predicted Viral | 1611 | Open in IMG/M |
| 3300005662|Ga0078894_10251203 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1604 | Open in IMG/M |
| 3300005662|Ga0078894_10258313 | All Organisms → cellular organisms → Bacteria | 1580 | Open in IMG/M |
| 3300005662|Ga0078894_10486823 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
| 3300005941|Ga0070743_10004540 | Not Available | 5050 | Open in IMG/M |
| 3300006484|Ga0070744_10013918 | All Organisms → Viruses → Predicted Viral | 2385 | Open in IMG/M |
| 3300006484|Ga0070744_10042028 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1345 | Open in IMG/M |
| 3300006484|Ga0070744_10230058 | Not Available | 525 | Open in IMG/M |
| 3300006641|Ga0075471_10010071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 5817 | Open in IMG/M |
| 3300007546|Ga0102874_1020141 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2184 | Open in IMG/M |
| 3300007547|Ga0102875_1183778 | Not Available | 650 | Open in IMG/M |
| 3300007548|Ga0102877_1059628 | All Organisms → Viruses → Predicted Viral | 1099 | Open in IMG/M |
| 3300007549|Ga0102879_1008533 | Not Available | 3631 | Open in IMG/M |
| 3300007549|Ga0102879_1139220 | Not Available | 744 | Open in IMG/M |
| 3300007555|Ga0102817_1097009 | Not Available | 648 | Open in IMG/M |
| 3300007557|Ga0102821_1051961 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1066 | Open in IMG/M |
| 3300007558|Ga0102822_1150509 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 551 | Open in IMG/M |
| 3300007559|Ga0102828_1003506 | All Organisms → cellular organisms → Bacteria | 2950 | Open in IMG/M |
| 3300007559|Ga0102828_1126628 | Not Available | 632 | Open in IMG/M |
| 3300007561|Ga0102914_1160422 | Not Available | 694 | Open in IMG/M |
| 3300007562|Ga0102915_1148326 | Not Available | 765 | Open in IMG/M |
| 3300007606|Ga0102923_1264338 | Not Available | 531 | Open in IMG/M |
| 3300007618|Ga0102896_1145330 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 759 | Open in IMG/M |
| 3300007618|Ga0102896_1250430 | Not Available | 549 | Open in IMG/M |
| 3300007620|Ga0102871_1023534 | Not Available | 1857 | Open in IMG/M |
| 3300007621|Ga0102872_1065270 | Not Available | 988 | Open in IMG/M |
| 3300007621|Ga0102872_1156951 | Not Available | 602 | Open in IMG/M |
| 3300007625|Ga0102870_1075605 | Not Available | 990 | Open in IMG/M |
| 3300007642|Ga0102876_1218773 | Not Available | 503 | Open in IMG/M |
| 3300007708|Ga0102859_1145110 | Not Available | 695 | Open in IMG/M |
| 3300008052|Ga0102893_1036090 | Not Available | 1510 | Open in IMG/M |
| 3300008107|Ga0114340_1007157 | Not Available | 7314 | Open in IMG/M |
| 3300008108|Ga0114341_10014012 | Not Available | 12990 | Open in IMG/M |
| 3300008113|Ga0114346_1089856 | Not Available | 1430 | Open in IMG/M |
| 3300008261|Ga0114336_1010427 | Not Available | 5886 | Open in IMG/M |
| 3300008261|Ga0114336_1011762 | Not Available | 5476 | Open in IMG/M |
| 3300008950|Ga0102891_1013923 | Not Available | 2585 | Open in IMG/M |
| 3300008996|Ga0102831_1028550 | Not Available | 1894 | Open in IMG/M |
| 3300009059|Ga0102830_1056664 | All Organisms → Viruses → Predicted Viral | 1182 | Open in IMG/M |
| 3300009068|Ga0114973_10000393 | Not Available | 32776 | Open in IMG/M |
| 3300009152|Ga0114980_10001092 | Not Available | 19473 | Open in IMG/M |
| 3300009152|Ga0114980_10025736 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 3651 | Open in IMG/M |
| 3300009159|Ga0114978_10030169 | Not Available | 3885 | Open in IMG/M |
| 3300009180|Ga0114979_10195677 | Not Available | 1226 | Open in IMG/M |
| 3300009419|Ga0114982_1000472 | Not Available | 21651 | Open in IMG/M |
| 3300010312|Ga0102883_1158658 | Not Available | 646 | Open in IMG/M |
| 3300012012|Ga0153799_1057172 | Not Available | 712 | Open in IMG/M |
| 3300012663|Ga0157203_1000371 | Not Available | 14242 | Open in IMG/M |
| 3300012665|Ga0157210_1010471 | Not Available | 1641 | Open in IMG/M |
| 3300012665|Ga0157210_1072361 | Not Available | 519 | Open in IMG/M |
| 3300012706|Ga0157627_1187287 | Not Available | 532 | Open in IMG/M |
| 3300012722|Ga0157630_1204484 | Not Available | 616 | Open in IMG/M |
| 3300013004|Ga0164293_10107711 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2129 | Open in IMG/M |
| 3300013004|Ga0164293_10297764 | Not Available | 1119 | Open in IMG/M |
| 3300013004|Ga0164293_10331081 | All Organisms → Viruses → Predicted Viral | 1045 | Open in IMG/M |
| 3300013004|Ga0164293_10430480 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 883 | Open in IMG/M |
| 3300013005|Ga0164292_10635592 | Not Available | 686 | Open in IMG/M |
| 3300013372|Ga0177922_10952130 | Not Available | 2355 | Open in IMG/M |
| 3300017788|Ga0169931_10058340 | Not Available | 4055 | Open in IMG/M |
| 3300019784|Ga0181359_1000870 | Not Available | 7403 | Open in IMG/M |
| 3300019784|Ga0181359_1003502 | All Organisms → Viruses → Predicted Viral | 4820 | Open in IMG/M |
| 3300020048|Ga0207193_1013067 | Not Available | 11287 | Open in IMG/M |
| 3300020141|Ga0211732_1050319 | Not Available | 6143 | Open in IMG/M |
| 3300020141|Ga0211732_1136853 | Not Available | 15029 | Open in IMG/M |
| 3300020141|Ga0211732_1385394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1430 | Open in IMG/M |
| 3300020151|Ga0211736_10550810 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 943 | Open in IMG/M |
| 3300020151|Ga0211736_10761066 | Not Available | 1058 | Open in IMG/M |
| 3300020151|Ga0211736_10923201 | Not Available | 858 | Open in IMG/M |
| 3300020159|Ga0211734_10534557 | Not Available | 9432 | Open in IMG/M |
| 3300020160|Ga0211733_10130419 | Not Available | 1567 | Open in IMG/M |
| 3300020160|Ga0211733_10491546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300020161|Ga0211726_10251974 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 960 | Open in IMG/M |
| 3300020161|Ga0211726_10476931 | Not Available | 9567 | Open in IMG/M |
| 3300020161|Ga0211726_10618348 | All Organisms → Viruses → Predicted Viral | 3042 | Open in IMG/M |
| 3300020161|Ga0211726_10986498 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 992 | Open in IMG/M |
| 3300020162|Ga0211735_10536264 | Not Available | 874 | Open in IMG/M |
| 3300020172|Ga0211729_10075753 | All Organisms → Viruses → Predicted Viral | 2310 | Open in IMG/M |
| 3300020205|Ga0211731_11455213 | Not Available | 1096 | Open in IMG/M |
| 3300020205|Ga0211731_11622570 | Not Available | 9638 | Open in IMG/M |
| 3300020519|Ga0208223_1001036 | Not Available | 6285 | Open in IMG/M |
| 3300020527|Ga0208232_1013397 | All Organisms → Viruses → Predicted Viral | 1237 | Open in IMG/M |
| 3300020529|Ga0208233_1000105 | Not Available | 14843 | Open in IMG/M |
| 3300020529|Ga0208233_1000118 | Not Available | 14085 | Open in IMG/M |
| 3300020532|Ga0208601_1027481 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 843 | Open in IMG/M |
| 3300020550|Ga0208600_1010686 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1478 | Open in IMG/M |
| 3300020569|Ga0208229_1063949 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300020572|Ga0207909_1052322 | Not Available | 633 | Open in IMG/M |
| 3300020575|Ga0208053_1057746 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 722 | Open in IMG/M |
| 3300021140|Ga0214168_1042189 | Not Available | 1116 | Open in IMG/M |
| 3300021141|Ga0214163_1059596 | Not Available | 963 | Open in IMG/M |
| 3300021141|Ga0214163_1078339 | Not Available | 797 | Open in IMG/M |
| 3300021519|Ga0194048_10000992 | Not Available | 14070 | Open in IMG/M |
| 3300021519|Ga0194048_10004394 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 6839 | Open in IMG/M |
| 3300021963|Ga0222712_10096184 | Not Available | 2082 | Open in IMG/M |
| 3300023174|Ga0214921_10003731 | Not Available | 23031 | Open in IMG/M |
| 3300024343|Ga0244777_10001324 | Not Available | 17881 | Open in IMG/M |
| 3300024343|Ga0244777_10115586 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1733 | Open in IMG/M |
| 3300024346|Ga0244775_10024099 | Not Available | 5481 | Open in IMG/M |
| 3300024346|Ga0244775_10024338 | Not Available | 5451 | Open in IMG/M |
| 3300024346|Ga0244775_10038218 | Not Available | 4238 | Open in IMG/M |
| 3300024346|Ga0244775_10052148 | All Organisms → Viruses → Predicted Viral | 3558 | Open in IMG/M |
| 3300024346|Ga0244775_10072596 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2948 | Open in IMG/M |
| 3300024346|Ga0244775_10188227 | Not Available | 1734 | Open in IMG/M |
| 3300024346|Ga0244775_10650111 | Not Available | 853 | Open in IMG/M |
| 3300024346|Ga0244775_11194837 | Not Available | 593 | Open in IMG/M |
| 3300024346|Ga0244775_11420553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 533 | Open in IMG/M |
| 3300024348|Ga0244776_10001230 | Not Available | 27569 | Open in IMG/M |
| 3300024348|Ga0244776_10455468 | Not Available | 836 | Open in IMG/M |
| 3300025732|Ga0208784_1255219 | Not Available | 504 | Open in IMG/M |
| 3300027084|Ga0208443_1090704 | Not Available | 590 | Open in IMG/M |
| 3300027129|Ga0255067_1048331 | Not Available | 607 | Open in IMG/M |
| 3300027138|Ga0255064_1032905 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 854 | Open in IMG/M |
| 3300027192|Ga0208673_1035071 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 828 | Open in IMG/M |
| 3300027210|Ga0208802_1059981 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 513 | Open in IMG/M |
| 3300027229|Ga0208442_1075535 | Not Available | 551 | Open in IMG/M |
| 3300027320|Ga0208923_1057332 | Not Available | 691 | Open in IMG/M |
| 3300027508|Ga0255072_1095900 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 588 | Open in IMG/M |
| 3300027529|Ga0255077_1006586 | All Organisms → Viruses → Predicted Viral | 2063 | Open in IMG/M |
| 3300027563|Ga0209552_1002519 | Not Available | 5951 | Open in IMG/M |
| 3300027581|Ga0209651_1055790 | Not Available | 1168 | Open in IMG/M |
| 3300027586|Ga0208966_1000742 | Not Available | 10267 | Open in IMG/M |
| 3300027621|Ga0208951_1021513 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2042 | Open in IMG/M |
| 3300027627|Ga0208942_1000326 | Not Available | 20472 | Open in IMG/M |
| 3300027627|Ga0208942_1072658 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1017 | Open in IMG/M |
| 3300027631|Ga0208133_1118892 | Not Available | 614 | Open in IMG/M |
| 3300027689|Ga0209551_1000747 | Not Available | 12234 | Open in IMG/M |
| 3300027689|Ga0209551_1003683 | Not Available | 5621 | Open in IMG/M |
| 3300027720|Ga0209617_10023842 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 2668 | Open in IMG/M |
| 3300027720|Ga0209617_10055102 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
| 3300027754|Ga0209596_1000050 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 100398 | Open in IMG/M |
| 3300027756|Ga0209444_10140322 | Not Available | 937 | Open in IMG/M |
| 3300027759|Ga0209296_1410247 | Not Available | 505 | Open in IMG/M |
| 3300027760|Ga0209598_10020695 | Not Available | 3871 | Open in IMG/M |
| 3300027763|Ga0209088_10088995 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1432 | Open in IMG/M |
| 3300027763|Ga0209088_10149866 | Not Available | 1031 | Open in IMG/M |
| 3300027782|Ga0209500_10001100 | Not Available | 21247 | Open in IMG/M |
| 3300027782|Ga0209500_10357387 | Not Available | 601 | Open in IMG/M |
| 3300027797|Ga0209107_10004060 | Not Available | 8128 | Open in IMG/M |
| 3300027797|Ga0209107_10155831 | Not Available | 1163 | Open in IMG/M |
| 3300027797|Ga0209107_10171091 | All Organisms → Viruses → Predicted Viral | 1094 | Open in IMG/M |
| 3300027797|Ga0209107_10479307 | Not Available | 555 | Open in IMG/M |
| 3300027836|Ga0209230_10006894 | All Organisms → Viruses → Predicted Viral | 4958 | Open in IMG/M |
| 3300027836|Ga0209230_10565141 | Not Available | 640 | Open in IMG/M |
| 3300027892|Ga0209550_10343771 | All Organisms → cellular organisms → Bacteria | 943 | Open in IMG/M |
| 3300027973|Ga0209298_10000721 | Not Available | 21990 | Open in IMG/M |
| 3300027973|Ga0209298_10012556 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 4444 | Open in IMG/M |
| 3300028025|Ga0247723_1000015 | Not Available | 109057 | Open in IMG/M |
| 3300028027|Ga0247722_10264837 | Not Available | 594 | Open in IMG/M |
| 3300029349|Ga0238435_113808 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales → Aphanizomenonaceae → Aphanizomenon → Aphanizomenon flos-aquae → Aphanizomenon flos-aquae WA102 | 697 | Open in IMG/M |
| 3300031784|Ga0315899_11493401 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 566 | Open in IMG/M |
| 3300031787|Ga0315900_10613724 | Not Available | 792 | Open in IMG/M |
| 3300033993|Ga0334994_0002011 | Not Available | 14879 | Open in IMG/M |
| 3300033993|Ga0334994_0186027 | Not Available | 1136 | Open in IMG/M |
| 3300033996|Ga0334979_0002881 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 12376 | Open in IMG/M |
| 3300034022|Ga0335005_0521197 | Not Available | 658 | Open in IMG/M |
| 3300034022|Ga0335005_0757188 | Not Available | 507 | Open in IMG/M |
| 3300034062|Ga0334995_0210654 | All Organisms → Viruses → Predicted Viral | 1342 | Open in IMG/M |
| 3300034062|Ga0334995_0454949 | Not Available | 784 | Open in IMG/M |
| 3300034066|Ga0335019_0000016 | Not Available | 97603 | Open in IMG/M |
| 3300034068|Ga0334990_0011610 | Not Available | 4709 | Open in IMG/M |
| 3300034082|Ga0335020_0013143 | Not Available | 4902 | Open in IMG/M |
| 3300034093|Ga0335012_0082759 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 1811 | Open in IMG/M |
| 3300034093|Ga0335012_0340393 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 749 | Open in IMG/M |
| 3300034102|Ga0335029_0014945 | Not Available | 5938 | Open in IMG/M |
| 3300034102|Ga0335029_0028869 | All Organisms → Viruses → Predicted Viral | 4182 | Open in IMG/M |
| 3300034108|Ga0335050_0364677 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 662 | Open in IMG/M |
| 3300034119|Ga0335054_0788320 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage | 502 | Open in IMG/M |
| 3300034272|Ga0335049_0021012 | Not Available | 4899 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 17.16% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 12.75% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 11.76% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 10.29% |
| Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 9.80% |
| Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 6.86% |
| Estuarine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine | 6.86% |
| Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 5.39% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater And Sediment | 2.94% |
| Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 2.45% |
| Freshwater | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater | 1.96% |
| Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 1.96% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater And Sediment | 1.47% |
| Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 1.47% |
| Freshwater And Sediment | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater And Sediment | 0.98% |
| Anoxic Zone Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater | 0.98% |
| Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 0.98% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.98% |
| Deep Subsurface Sediment | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment | 0.98% |
| Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Lake Sediment | 0.49% |
| Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.49% |
| Saline | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline | 0.49% |
| Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.49% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 2035265000 | Freshwater microbial communities from Swedish Lakes - surface of Lake Erken | Environmental | Open in IMG/M |
| 3300000756 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 | Environmental | Open in IMG/M |
| 3300001282 | Freshwater microbial communities from Lake Mendota, WI - Practice 20APR2010 epilimnion | Environmental | Open in IMG/M |
| 3300002296 | Freshwater microbial communities from Lake Mendota, WI - 02JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002383 | Freshwater microbial communities from Lake Mendota, WI - 15JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002387 | Freshwater microbial communities from Lake Mendota, WI - 22JUN2012 deep hole epilimnion | Environmental | Open in IMG/M |
| 3300002408 | Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123) | Environmental | Open in IMG/M |
| 3300002447 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome | Environmental | Open in IMG/M |
| 3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
| 3300003395 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN | Environmental | Open in IMG/M |
| 3300003413 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.DD | Environmental | Open in IMG/M |
| 3300003429 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003493 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SN | Environmental | Open in IMG/M |
| 3300003616 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.DN | Environmental | Open in IMG/M |
| 3300003986 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM110.SN (v2) | Environmental | Open in IMG/M |
| 3300004054 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2) | Environmental | Open in IMG/M |
| 3300004096 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 2) | Environmental | Open in IMG/M |
| 3300004112 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 2) | Environmental | Open in IMG/M |
| 3300004369 | Saline microbial communities from the South Caspian sea - cas-15 | Environmental | Open in IMG/M |
| 3300005580 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF | Environmental | Open in IMG/M |
| 3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
| 3300005583 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF | Environmental | Open in IMG/M |
| 3300005584 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF | Environmental | Open in IMG/M |
| 3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
| 3300005941 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.697 | Environmental | Open in IMG/M |
| 3300006484 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 | Environmental | Open in IMG/M |
| 3300006641 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_>0.8_DNA | Environmental | Open in IMG/M |
| 3300007546 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-02 | Environmental | Open in IMG/M |
| 3300007547 | Estuarine microbial communities from the Columbia River estuary - metaG 1547B-02 | Environmental | Open in IMG/M |
| 3300007548 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-3 | Environmental | Open in IMG/M |
| 3300007549 | Estuarine microbial communities from the Columbia River estuary - metaG 1548B-02 | Environmental | Open in IMG/M |
| 3300007555 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.555 | Environmental | Open in IMG/M |
| 3300007557 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 | Environmental | Open in IMG/M |
| 3300007558 | Estuarine microbial communities from the Columbia River estuary - Flood tide non-ETM metaG S.733 | Environmental | Open in IMG/M |
| 3300007559 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.541 | Environmental | Open in IMG/M |
| 3300007561 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-3 | Environmental | Open in IMG/M |
| 3300007562 | Estuarine microbial communities from the Columbia River estuary - metaG 1561A-02 | Environmental | Open in IMG/M |
| 3300007606 | Estuarine microbial communities from the Columbia River estuary - metaG 1569-02 | Environmental | Open in IMG/M |
| 3300007618 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 | Environmental | Open in IMG/M |
| 3300007620 | Estuarine microbial communities from the Columbia River estuary - metaG 1546C-02 | Environmental | Open in IMG/M |
| 3300007621 | Estuarine microbial communities from the Columbia River estuary - metaG 1547A-3 | Environmental | Open in IMG/M |
| 3300007625 | Estuarine microbial communities from the Columbia River estuary - metaG 1546B-02 | Environmental | Open in IMG/M |
| 3300007642 | Estuarine microbial communities from the Columbia River estuary - metaG 1548A-3 | Environmental | Open in IMG/M |
| 3300007708 | Estuarine microbial communities from the Columbia River estuary - metaG 1371B-02 | Environmental | Open in IMG/M |
| 3300008052 | Estuarine microbial communities from the Columbia River estuary - metaG 1553A-02 | Environmental | Open in IMG/M |
| 3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
| 3300008108 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-C-NA | Environmental | Open in IMG/M |
| 3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
| 3300008261 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0024-C-NA | Environmental | Open in IMG/M |
| 3300008950 | Estuarine microbial communities from the Columbia River estuary - metaG 1552A-02 | Environmental | Open in IMG/M |
| 3300008996 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.747 | Environmental | Open in IMG/M |
| 3300009059 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703 | Environmental | Open in IMG/M |
| 3300009068 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG | Environmental | Open in IMG/M |
| 3300009152 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG | Environmental | Open in IMG/M |
| 3300009159 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG | Environmental | Open in IMG/M |
| 3300009180 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG | Environmental | Open in IMG/M |
| 3300009419 | Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT | Environmental | Open in IMG/M |
| 3300010312 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-02 | Environmental | Open in IMG/M |
| 3300012012 | Freshwater microbial communities from Eastern Basin Lake Erie, Ontario, Canada - Station 879 - Top - Depth 1m | Environmental | Open in IMG/M |
| 3300012663 | Freshwater microbial communities from Indian River, Ontario, Canada - S50 | Environmental | Open in IMG/M |
| 3300012665 | Freshwater microbial communities from Talbot River, Ontario, Canada - S11 | Environmental | Open in IMG/M |
| 3300012706 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES159 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300012722 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES163 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300013004 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES118 metaG | Environmental | Open in IMG/M |
| 3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
| 3300013372 | Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs | Environmental | Open in IMG/M |
| 3300017788 | Freshwater microbial communities from Lake Kivu, Western Province, Rwanda to study Microbial Dark Matter (Phase II) - Kivu_15m_20L | Environmental | Open in IMG/M |
| 3300019784 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D | Environmental | Open in IMG/M |
| 3300020048 | Microbial communities from Manganika and McQuade lakes, Minnesota, USA Combined Assembly of Gp0225457, Gp0225456, Gp0225455, Gp0225454, Gp0225453, Gp0224915 | Environmental | Open in IMG/M |
| 3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
| 3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
| 3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
| 3300020160 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_105 megahit1 | Environmental | Open in IMG/M |
| 3300020161 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1 | Environmental | Open in IMG/M |
| 3300020162 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_201 megahit1 | Environmental | Open in IMG/M |
| 3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
| 3300020205 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_103 megahit1 | Environmental | Open in IMG/M |
| 3300020519 | Freshwater microbial communities from Lake Mendota, WI - 07OCT2009 deep hole epilimnion ns (SPAdes) | Environmental | Open in IMG/M |
| 3300020527 | Freshwater microbial communities from Lake Mendota, WI - 24AUG2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020529 | Freshwater microbial communities from Lake Mendota, WI - 07SEP2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020532 | Freshwater microbial communities from Lake Mendota, WI - 09NOV2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020550 | Freshwater microbial communities from Lake Mendota, WI - 08OCT2012 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020569 | Freshwater microbial communities from Lake Mendota, WI - 22AUG2011 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020572 | Freshwater microbial communities from Lake Mendota, WI - 05MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300020575 | Freshwater microbial communities from Lake Mendota, WI - 20MAY2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
| 3300021140 | Freshwater microbial communities from Lake Mendota, WI - Practice 29OCT2010 epilimnion | Environmental | Open in IMG/M |
| 3300021141 | Freshwater microbial communities from Lake Mendota, WI - Practice 15JUN2010 epilimnion | Environmental | Open in IMG/M |
| 3300021519 | Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L222-5m | Environmental | Open in IMG/M |
| 3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
| 3300023174 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1505 | Environmental | Open in IMG/M |
| 3300024343 | Combined assembly of estuarine microbial communities from Columbia River, Washington, USA >3um size fraction | Environmental | Open in IMG/M |
| 3300024346 | Whole water sample coassembly | Environmental | Open in IMG/M |
| 3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
| 3300025732 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300027084 | Estuarine microbial communities from the Columbia River estuary - metaG 1554A-02 (SPAdes) | Environmental | Open in IMG/M |
| 3300027129 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_8h | Environmental | Open in IMG/M |
| 3300027138 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepB_0h | Environmental | Open in IMG/M |
| 3300027192 | Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.715 (SPAdes) | Environmental | Open in IMG/M |
| 3300027210 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027229 | Estuarine microbial communities from the Columbia River estuary - metaG 1549B-3 (SPAdes) | Environmental | Open in IMG/M |
| 3300027320 | Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes) | Environmental | Open in IMG/M |
| 3300027508 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Yuk_RepA_8h | Environmental | Open in IMG/M |
| 3300027529 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepC_8h | Environmental | Open in IMG/M |
| 3300027563 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027581 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM110.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027586 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027621 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027627 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes) | Environmental | Open in IMG/M |
| 3300027631 | Estuarine microbial communities from the Columbia River estuary, USA - metaG S.535 (SPAdes) | Environmental | Open in IMG/M |
| 3300027689 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SD (SPAdes) | Environmental | Open in IMG/M |
| 3300027697 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027720 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB epilimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027754 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027756 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.DN (SPAdes) | Environmental | Open in IMG/M |
| 3300027759 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027760 | Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027763 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027782 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140212_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300027797 | Freshwater microbial communities from dead zone in Lake Erie, Canada - CCB hypolimnion July 2011 (SPAdes) | Environmental | Open in IMG/M |
| 3300027836 | Freshwater and sediment microbial communities from Lake Ontario - Sta 18 epilimnion Metagenome (SPAdes) | Environmental | Open in IMG/M |
| 3300027892 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (SPAdes) | Environmental | Open in IMG/M |
| 3300027973 | Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140806_EF_MetaG (SPAdes) | Environmental | Open in IMG/M |
| 3300028025 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC | Environmental | Open in IMG/M |
| 3300028027 | Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 3H_FC | Environmental | Open in IMG/M |
| 3300029349 | Freshwater microbial communities from Iron Gate Dam, Klamath Basin, California, USA - IR103 | Environmental | Open in IMG/M |
| 3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
| 3300031787 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114 | Environmental | Open in IMG/M |
| 3300033993 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037 | Environmental | Open in IMG/M |
| 3300033996 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2016-rr0004 | Environmental | Open in IMG/M |
| 3300034022 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Apr2018-rr0058 | Environmental | Open in IMG/M |
| 3300034062 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045 | Environmental | Open in IMG/M |
| 3300034066 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME11Jul2017-rr0087 | Environmental | Open in IMG/M |
| 3300034068 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME13Apr2016-rr0031 | Environmental | Open in IMG/M |
| 3300034082 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME05Jun2015-rr0088 | Environmental | Open in IMG/M |
| 3300034093 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME08Jun2014-rr0072 | Environmental | Open in IMG/M |
| 3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
| 3300034108 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME24Jun2014-rr0157 | Environmental | Open in IMG/M |
| 3300034119 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME21Jul2015-rr0166 | Environmental | Open in IMG/M |
| 3300034272 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Jul2017-rr0156 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| ErSWdraft_3481150 | 2035265000 | Freshwater | VYNEYMKEPKITQMDWRSLGYWPVYKNGKKVWVPKDDTNDKDRED |
| JGI12421J11937_100185612 | 3300000756 | Freshwater And Sediment | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDAESFNKDTEN* |
| JGI12421J11937_101610671 | 3300000756 | Freshwater And Sediment | MKEPKIAQMDWRSLGYWPIWKDGKKVWVPKDEPFNKDSKD* |
| B570J14230_100267343 | 3300001282 | Freshwater | VITRCGVPREPKITKMDWRALGYWPVYKNGKKVWEKDDKSFIQNREN* |
| B570J14230_101722751 | 3300001282 | Freshwater | VTDISGAQMPKEPKITKMDWRSLGYWPVYKDGKKVWVPKDAELFNRTSQD* |
| B570J29587_10015414 | 3300002296 | Freshwater | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDDKSFNQDRKN* |
| B570J29604_100002820 | 3300002383 | Freshwater | MERFGVSMPKDPKIMTMDWRSLGYWPVWKDGKKVWVPKDDKSFNEDTKN* |
| B570J29608_10001485 | 3300002387 | Freshwater | MPKDPKIMTMDWRSLGYWPVWKDGKKVWVPKDDKSFNEDTKN* |
| B570J29032_1098495562 | 3300002408 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKIESKEDSK* |
| JGI24768J34885_1000308811 | 3300002447 | Freshwater And Sediment | MKEPKIMSMDWRSLGYWPTWKDGKKVWVPKDDQSFNQDAEN* |
| B570J40625_10007801611 | 3300002835 | Freshwater | MKEPKIAQMDWRSLGYWPVYKDGKKVWVPKDDKSFDKDTEN* |
| B570J40625_1002132151 | 3300002835 | Freshwater | MERHGVLMPREPKITKMDWRSLGYWPVYKDGKKVWEKDDKSFNQDRKN* |
| B570J40625_1002521633 | 3300002835 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDAESFNKDSKN* |
| B570J40625_1003635833 | 3300002835 | Freshwater | MEEFGVHMAKEPKITQMDWRSLGYWPVWKDGKKVWVPKDVEVSKD* |
| B570J40625_1008244881 | 3300002835 | Freshwater | MDIYGAPMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDTNNKDRED* |
| B570J40625_1015349203 | 3300002835 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDDKSFNKDTKN* |
| JGI25917J50250_10013995 | 3300003395 | Freshwater Lake | MKEPKIAXMDWRILGYWPVWKDGKKVWVPKDELFNKDSKD* |
| JGI25917J50250_10160474 | 3300003395 | Freshwater Lake | MKEPKIMTMDWRSLGYWPVWKDGKKVWVPKDEQLNNNSEN* |
| JGI25922J50271_1000089811 | 3300003413 | Freshwater Lake | MWCGVPKEPKITKMDWRALGYWPVYKDGKRVWEKDDKSFDKNTEN* |
| JGI25914J50564_1000331317 | 3300003429 | Freshwater Lake | MDMYGAPMPKEPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFNKNTEN* |
| JGI25923J51411_10003314 | 3300003493 | Freshwater Lake | MKEPKIMTMDWRSLGYWPVWKDGKKVWVPKDEQLNNNSEX* |
| JGI25928J51866_10935892 | 3300003616 | Freshwater Lake | MKEPKITQMDWRSLGYWPVWKDGKKVWVPRDAEAFNKDTEN* |
| Ga0063233_100416514 | 3300003986 | Freshwater Lake | MKEPKIAQMDWRILGYWPVWKDGKKVWVPKDELFNKDSKD* |
| Ga0063232_101850293 | 3300004054 | Freshwater Lake | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDESFNKDSKD* |
| Ga0063232_102421932 | 3300004054 | Freshwater Lake | MDIYGAPMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDKNDEDRED* |
| Ga0066177_101070984 | 3300004096 | Freshwater Lake | MYGAPMPKEPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFNKNTEN* |
| Ga0065166_104865071 | 3300004112 | Freshwater Lake | MDISGALMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDKNDKDRED* |
| Ga0065726_1813310 | 3300004369 | Saline | MTEPKIMKMDWRSAGYWPVWKDGKKVWVPKDDGSFNRNTQN* |
| Ga0049083_1000135019 | 3300005580 | Freshwater Lentic | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDAESFKKDTKN* |
| Ga0049081_100309566 | 3300005581 | Freshwater Lentic | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDAESFKKDTEN* |
| Ga0049085_1000085119 | 3300005583 | Freshwater Lentic | MKEPKIIQMDWRSLGYWPVWKNGKKVWVPKDDESFNKDTEN* |
| Ga0049085_103101361 | 3300005583 | Freshwater Lentic | MKEPKIIQMDWRSLGYWPVWKDGKKVWVPKDVEAFNETPKN* |
| Ga0049082_1000065812 | 3300005584 | Freshwater Lentic | MKEPKIVQMDWRALGYWPVWKDGKKVWVPKDVEQSRDS* |
| Ga0049082_100290803 | 3300005584 | Freshwater Lentic | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDEPFNKDSKD* |
| Ga0049082_102936632 | 3300005584 | Freshwater Lentic | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDEPFNKDRKD* |
| Ga0078894_102489722 | 3300005662 | Freshwater Lake | MKEPKIAQMDWRSLGYWPVYKNGKKIWVPKDDKNDEDRED* |
| Ga0078894_102512031 | 3300005662 | Freshwater Lake | MKEPKIMSMDWRSLGYWPIWKDGKKVWVPKDEEYNKDRED* |
| Ga0078894_102583133 | 3300005662 | Freshwater Lake | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDAEAFNKDTEN* |
| Ga0078894_104868231 | 3300005662 | Freshwater Lake | MDISGVPMPKEPKITQMDWRSLGYWPVWKDGKKVWVPKDDKSFNEDTKN* |
| Ga0070743_100045403 | 3300005941 | Estuarine | MSKEPKIMSMDWRSLGYWPVWKDGKKVWVPKDDKSFEQTSKN* |
| Ga0070744_1001391810 | 3300006484 | Estuarine | MVEFGVLMPKEPKITQMDWRSLGYWPVWKDGKKVWVPKDETHNKD* |
| Ga0070744_100420285 | 3300006484 | Estuarine | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDAEAFNETPKD* |
| Ga0070744_102300581 | 3300006484 | Estuarine | PKITQMDWRSLGYWPVYKNGKKVWVPKDAEAFNETPKD* |
| Ga0075471_100100716 | 3300006641 | Aqueous | MKEPKIMSMDWRSLGYWPVWKDGKKVWVPKDDKSFDETSQD* |
| Ga0102874_10201412 | 3300007546 | Estuarine | MKEPKITQMDWRSLGYWPVYKNGKKVWVAKDEPFNKDSKD* |
| Ga0102875_11837782 | 3300007547 | Estuarine | MDIYGVQMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDKNDEDRED* |
| Ga0102877_10596282 | 3300007548 | Estuarine | MVEFGVLMPKEPKITQMDWRSLGYWPVWKDGKKVWVPKDEPFNKDSKD* |
| Ga0102879_10085333 | 3300007549 | Estuarine | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDEPFNKDSKD* |
| Ga0102879_11392203 | 3300007549 | Estuarine | MERFGALMPKDPKIMTMDWRSLGYWPIWKDGKKVWVPKDDKSFNQDTEN* |
| Ga0102817_10970092 | 3300007555 | Estuarine | MIGFGVLMPKEPKITQMDWRSLGYWPVYKNGKKVWVPKDAEAFNETPKD* |
| Ga0102821_10519611 | 3300007557 | Estuarine | MVEFGVLMPKEPKITQMDWRSLGYWPVYKDGKKVWVPKDDQSFDQTSENK* |
| Ga0102822_11505091 | 3300007558 | Estuarine | MVEFGVLMPKEPKITQMDWRSLGYWPVWKDGKKVWVPKDETHN |
| Ga0102828_10035067 | 3300007559 | Estuarine | MIGFGVLMPKEPKITQMDWRSLGYWPVYKNGKKVWVPKDAEAFNETPKN* |
| Ga0102828_11266282 | 3300007559 | Estuarine | MKEPKITQMDWRSLGYWPVWKNGKKVWVPQDEKDSKD* |
| Ga0102914_11604222 | 3300007561 | Estuarine | MERFGALMPKDPKGMSMDWRSLGYWPVWKDGKKVWVPKDETHNKD* |
| Ga0102915_11483261 | 3300007562 | Estuarine | MSEPRIMRMDWRSLGYWPVWKDGKKVWVPKDDQSFNEASEN* |
| Ga0102923_12643382 | 3300007606 | Estuarine | MEKFGVLMPKEPKITQMDWRSLGYWPVYKNGKKVWVPKDEPFNKDSKD* |
| Ga0102896_11453301 | 3300007618 | Estuarine | MKEPKIMSMDWRSLGYWPVWKDGKKVWVPKDDQSFNEASEN* |
| Ga0102896_12504302 | 3300007618 | Estuarine | MKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDKNDEDRED* |
| Ga0102871_10235346 | 3300007620 | Estuarine | MKEPKITQMDWRSLGYWPVYKNGKKVWVPKDEPFNKDSKD* |
| Ga0102872_10652706 | 3300007621 | Estuarine | MERFGALMPKDPKVMSMDWRSLGYWPVWKDGKKVWVPKDETHNKD* |
| Ga0102872_11569511 | 3300007621 | Estuarine | MVEFGVLMPKEPNITQMDWRSLCYWPVLKDVKKVWVPKDETHNKD* |
| Ga0102870_10756054 | 3300007625 | Estuarine | MKEPKIMYMDWRSLGYWPVWKDGKKVWVPKDEPFNKDSKD* |
| Ga0102876_12187732 | 3300007642 | Estuarine | MKEPKIMSMDWRSLGYWPVWKDGKKVWVPKDDKSFDKDTEN* |
| Ga0102859_11451102 | 3300007708 | Estuarine | MDIFGVPMPKEPKITQMDWRSLGYWPVWKDGKKVWVPKDAESFKKDTKN* |
| Ga0102893_10360901 | 3300008052 | Estuarine | KITQVDWRSLGYWPVYKNGKKVWVPKDEPFNKDSKD* |
| Ga0114340_100715711 | 3300008107 | Freshwater, Plankton | MDISGALMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDKNDEDRED* |
| Ga0114341_1001401225 | 3300008108 | Freshwater, Plankton | MKEPKIAQMDWRSLGYWPIWKDGKKVWVPKDDKSFDKDTKN* |
| Ga0114346_10898563 | 3300008113 | Freshwater, Plankton | MVEFGVHMAKEPKITKMDWRSLGYWPVYKDGKKVWEKDDKSFNQDTEN* |
| Ga0114336_10104276 | 3300008261 | Freshwater, Plankton | MDISGVPMPKEPKITQMDWRSLGYWPVYKNGKKVWVPKDEIYNKDRED* |
| Ga0114336_10117628 | 3300008261 | Freshwater, Plankton | MGKFGVSMPKEPRITQMDWRSLGYWPVCKDGKKVWVPQNEQHNKD* |
| Ga0102891_10139233 | 3300008950 | Estuarine | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDESFNKDTEN* |
| Ga0102831_10285502 | 3300008996 | Estuarine | MGIYGVLMPKEPKITQMDWRSLGYWPVYQDGKKVWVPKDEQHNKDRKD* |
| Ga0102830_10566643 | 3300009059 | Estuarine | MGIYGVLMPKEPKITQMDWRSLGYWPVYQDGKKVWVPKDEQ |
| Ga0114973_1000039354 | 3300009068 | Freshwater Lake | MKEPKITQMDWRSLGYWPVYKNEKKIWVPKDDKSFDKD* |
| Ga0114980_100010924 | 3300009152 | Freshwater Lake | MDMSGVQMPKDPKIMTMDWRSLGYWPVYKNGKKVWVPQDEQHNKD* |
| Ga0114980_100257363 | 3300009152 | Freshwater Lake | MDISGVLMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDKNDEDRED* |
| Ga0114978_100301691 | 3300009159 | Freshwater Lake | MGIYGVPMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKNDKNDEDRED* |
| Ga0114979_101956774 | 3300009180 | Freshwater Lake | MKEPKITQMDWRSLGYWPVWKNGKKVWVPKDEPFNKDSKD* |
| Ga0114982_10004729 | 3300009419 | Deep Subsurface | MGMYGVLMPREPKITKMDWRALGYWPVYKNGKKVWVPQDGKDSKD* |
| Ga0102883_11586582 | 3300010312 | Estuarine | MKEPKIAQMDWRSLGYWPVYKNGKKVWVPKDEPFNKDSKD* |
| Ga0153799_10571722 | 3300012012 | Freshwater | MKEPKITQMDWRSLGYWPVWENGKKVWVPKDAESFKKDTEN* |
| Ga0157203_10003718 | 3300012663 | Freshwater | MERFGALMPKDPKIMTMDWRSLGYWPIWKDGKKIWVPKDDKSFDKD* |
| Ga0157210_10104714 | 3300012665 | Freshwater | MDIYGVQMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDTNNKDRKD* |
| Ga0157210_10723611 | 3300012665 | Freshwater | PKIMNMDWRSLGYWPVWKDGKKVWVPKDDKSFNEDTEN* |
| Ga0157627_11872871 | 3300012706 | Freshwater | MVEFGVHMPKEPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFNKNTEN* |
| Ga0157630_12044843 | 3300012722 | Freshwater | MPREPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFN |
| Ga0164293_101077112 | 3300013004 | Freshwater | MATFGVPMPKEPSIAKMDWRSLGYWPVWKDGKKVWVPKDGQTPKD* |
| Ga0164293_102977643 | 3300013004 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDVEASKD* |
| Ga0164293_103310815 | 3300013004 | Freshwater | QTVESGVHMPREPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFNKNTEN* |
| Ga0164293_104304802 | 3300013004 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKMWVPKDKTDYWDKIDD* |
| Ga0164292_106355923 | 3300013005 | Freshwater | MKEPKITQMDWRSLGYWPVWKNGKKVWVPKDDKSFNKDTKN* |
| Ga0177922_109521309 | 3300013372 | Freshwater | CGALMPKDPKIMTMDWRSLGYWPVWKNGKKVWVPKDEQLNNNSEN* |
| Ga0169931_100583408 | 3300017788 | Freshwater | MQMDWRSAGYWPVWKDGKKVWVPKDDRSFNKNTQN |
| Ga0181359_10008703 | 3300019784 | Freshwater Lake | MKEPKIMTMDWRSLGYWPVWKDGKKVWVPKDEQLNNNSEN |
| Ga0181359_100350212 | 3300019784 | Freshwater Lake | MKEPKIAQMDWRILGYWPVWKDGKKVWVPKDELFNKDSKD |
| Ga0207193_101306714 | 3300020048 | Freshwater Lake Sediment | MERFGVSMPKDPKIMSMDWRSLGYWPVWKDGKKVWVPKDDKSFNEDTKD |
| Ga0211732_105031916 | 3300020141 | Freshwater | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDDKSFDKDTEN |
| Ga0211732_113685316 | 3300020141 | Freshwater | MKEPKITKMDWRALGYWPVWKDGKKVWVPKDEQLNNNSED |
| Ga0211732_13853943 | 3300020141 | Freshwater | MDISGVLMPKEPKITQMDWRSLGYWPVYKNGKKVWVPKDDTNNKD |
| Ga0211736_105508104 | 3300020151 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDEPFNKDS |
| Ga0211736_107610663 | 3300020151 | Freshwater | MKEPKITQMDWRSLGYWPVYKNGKKVWVPKDDTNEKDRED |
| Ga0211736_109232013 | 3300020151 | Freshwater | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDVEASKD |
| Ga0211734_105345578 | 3300020159 | Freshwater | MDISGVLMPKEPKITQMDWRSLGYWPVYKDGKKVWVPKDESYDKDRED |
| Ga0211733_101304192 | 3300020160 | Freshwater | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDAEAFNKDTEN |
| Ga0211733_104915461 | 3300020160 | Freshwater | MDISGVLMPKEPKITQMDWRSLGYWPVYKNGKKVWVPKDDTNDKD |
| Ga0211726_102519741 | 3300020161 | Freshwater | MVEFGVLMAKEPKITQMDWRSLGYWPVWKDGKKVWVPKDDKSFNQNSKN |
| Ga0211726_1047693115 | 3300020161 | Freshwater | MEEFGVLMAKEPKITQMDWRSLGYWPVWKDGKKVWVPKDVEASKD |
| Ga0211726_106183481 | 3300020161 | Freshwater | MDISGVLMPKEPKITQMDWRSLGYWPVYKNGKKVWVPKNDTNDKDRED |
| Ga0211726_109864981 | 3300020161 | Freshwater | MKEPKIIQMDWRSLGYWPVYKNGKKVWVPKDDTNDKDRED |
| Ga0211735_105362641 | 3300020162 | Freshwater | NVLSAYFYGRMMKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDEPFNKDSKD |
| Ga0211729_100757537 | 3300020172 | Freshwater | MKDPKIAQMDWRSLGYWPVWKDGKKVWVPKDDKSFNKDTEN |
| Ga0211731_114552132 | 3300020205 | Freshwater | MTKEPKITQMDWRSLGYWPVYKNGKKVWVPKDDTNDKDRED |
| Ga0211731_116225706 | 3300020205 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDDKSFDKD |
| Ga0208223_10010362 | 3300020519 | Freshwater | MKEPKIAQMDWRSLGYWPVYKDGKKVWVPKDDKSFDKDTEN |
| Ga0208232_10133973 | 3300020527 | Freshwater | MEEFGVHMAKEPKITQMDWRSLGYWPVWKDGKKVWVPKDVEVSKD |
| Ga0208233_100010533 | 3300020529 | Freshwater | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDDKSFNQDRKN |
| Ga0208233_100011811 | 3300020529 | Freshwater | MPKDPKIMTMDWRSLGYWPVWKDGKKVWVPKDDKSFNEDTKN |
| Ga0208601_10274812 | 3300020532 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKIESKEDSK |
| Ga0208600_10106863 | 3300020550 | Freshwater | MERFGVSMPKDPKIMTMDWRSLGYWPVWKDGKKVWVPKDD |
| Ga0208229_10639491 | 3300020569 | Freshwater | MVEFGVHMPKEPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFNKDSKN |
| Ga0207909_10523222 | 3300020572 | Freshwater | MKEPRIAQMDWRSLGYWPVWKDGKKVWVPKDDKSFNKNTEN |
| Ga0208053_10577462 | 3300020575 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDDKSFNKNTEN |
| Ga0214168_10421892 | 3300021140 | Freshwater | MDIYGAPMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDTNNKDRED |
| Ga0214163_10595962 | 3300021141 | Freshwater | MERFGVSMPKDPKIMTMDWRSLGYWPVWKDGKKVWVPKDDKSFNKDTKN |
| Ga0214163_10783393 | 3300021141 | Freshwater | MKEPRIAQMDWRSLGYWPVWKDGKKVWVPKDAESFKKDTEN |
| Ga0194048_100009928 | 3300021519 | Anoxic Zone Freshwater | MGIYGVPMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDAEAFNKDRED |
| Ga0194048_100043945 | 3300021519 | Anoxic Zone Freshwater | MVEFGVLMPKEPKIMSMDWRSLGYWPIWKDGKKVWVPKDAEAFSEAPEN |
| Ga0222712_100961842 | 3300021963 | Estuarine Water | MERFGALMPKDPKIMTMDWRSLGYWPIWKDGKKVWVPKDDKSFNQDTEN |
| Ga0214921_1000373110 | 3300023174 | Freshwater | MDISGVLMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKHDKNDEDRED |
| Ga0244777_1000132442 | 3300024343 | Estuarine | MVEFGVLMPKEPKITQMDWRSLGYWPVWKDGKKVWVPKDETHNKD |
| Ga0244777_101155865 | 3300024343 | Estuarine | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDEPFNKDSKD |
| Ga0244775_100240991 | 3300024346 | Estuarine | MFGAPMPKEPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFNKNTEN |
| Ga0244775_100243387 | 3300024346 | Estuarine | MSKEPKIMSMDWRSLGYWPVWKDGKKVWVPKDDKSFEQTSKN |
| Ga0244775_100382182 | 3300024346 | Estuarine | MGIYGVLMPKEPKITQMDWRSLGYWPVYQDGKKVWVPKDEQHNKDRKD |
| Ga0244775_100521485 | 3300024346 | Estuarine | MIGFGVLMPKEPKITQMDWRSLGYWPVYKNGKKVWVPKDAEAFNETPKN |
| Ga0244775_100725962 | 3300024346 | Estuarine | MDIYGVQMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDKNDEDRED |
| Ga0244775_101882271 | 3300024346 | Estuarine | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDAEAFNKNTEN |
| Ga0244775_106501112 | 3300024346 | Estuarine | MKEPKIVQMDWRALGYWPVWKNGKKVWVPKDDKSFNKNTEN |
| Ga0244775_111948372 | 3300024346 | Estuarine | MKEPKITQMDWRSLGYWPVYKNGKKVWVPKDEPFNKDSKD |
| Ga0244775_114205531 | 3300024346 | Estuarine | MNKEPKIIQMDWRSLGYWPVWKDGKKVWVPKDAEAFNKDSKN |
| Ga0244776_1000123043 | 3300024348 | Estuarine | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDEPFNKDSKD |
| Ga0244776_104554683 | 3300024348 | Estuarine | MKEPKIMSMDWRSLGYWPVWKDGKKVWVPKDDQSFNKASQN |
| Ga0208784_12552192 | 3300025732 | Aqueous | MKEPKIMSMDWRSLGYWPVWKDGKKVWVPKDDKSFDETSQD |
| Ga0208443_10907042 | 3300027084 | Estuarine | MVEFGVLMPKEPKITQMDWRSLGYWPVWKDGKKVWVPKDEPFNKDSKD |
| Ga0255067_10483312 | 3300027129 | Freshwater | MKEPKITQMDWRSLGYWPVWKNGKKVWVPKDEPFNKDSKD |
| Ga0255064_10329051 | 3300027138 | Freshwater | MKEPKITQMDWRSLGYWPVWENGKKVWVPKDAESFKKDTKN |
| Ga0208673_10350713 | 3300027192 | Estuarine | MVEFGVLMPKEPKITQMDWRSLGYWPVYKDGKKVWVPKDDQSFDQTSENK |
| Ga0208802_10599812 | 3300027210 | Estuarine | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDAESFKKDTEN |
| Ga0208442_10755353 | 3300027229 | Estuarine | MERFGALMPKDPKVMSMDWRSLGYWPVWKDGKKVWVPKDETHNKD |
| Ga0208923_10573321 | 3300027320 | Estuarine | EPKITQMDWRSLGYWPEYKNGKKVWVPKDDKNDEDRED |
| Ga0255072_10959001 | 3300027508 | Freshwater | FGRAMKEPKITQMDWRSLGYWPVWKDGKKVWVPKDAESFKKDSKN |
| Ga0255077_10065862 | 3300027529 | Freshwater | MKEPKITQMDWRSLGYWPVWENGKKVWVPKDAESFKKDSKN |
| Ga0209552_100251911 | 3300027563 | Freshwater Lake | MPKDPKIMTMDWRSLGYWPVWKNGKKVWVPKDEQLNNNSED |
| Ga0209651_10557904 | 3300027581 | Freshwater Lake | MKEPKIVQMDWRALGYWPVWKDGKKVWVPKDDESFNKDSKD |
| Ga0208966_100074217 | 3300027586 | Freshwater Lentic | MKEPKIVQMDWRALGYWPVWKDGKKVWVPKDVEQSRDS |
| Ga0208951_10215133 | 3300027621 | Freshwater Lentic | MKEPKITQMDWRSLGYWPVWKDGKKVWVPRDAEAFNKDTEN |
| Ga0208942_100032640 | 3300027627 | Freshwater Lentic | MKEPKIIQMDWRSLGYWPVWKNGKKVWVPKDDESFNKDTEN |
| Ga0208942_10726582 | 3300027627 | Freshwater Lentic | MKEPKIIQMDWRSLGYWPVWKDGKKVWVPKDAEAFNETPKN |
| Ga0208133_11188923 | 3300027631 | Estuarine | MERFGALMPKEPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFNKNTEN |
| Ga0209551_100074718 | 3300027689 | Freshwater Lake | MYGAPMPKEPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFNKNTEN |
| Ga0209551_100368311 | 3300027689 | Freshwater Lake | MWCGVPKEPKITKMDWRALGYWPVYKDGKRVWEKDDKSFDKNTEN |
| Ga0209033_11034373 | 3300027697 | Freshwater Lake | MKEPKIIQMDWRALGYWPVWKDGKKVWVPKDEKNSKD |
| Ga0209617_100238423 | 3300027720 | Freshwater And Sediment | MKEPKIAQMDWRSLGYWPVWKNGKKVWVPKDAESFNKDTEN |
| Ga0209617_100551026 | 3300027720 | Freshwater And Sediment | MDTSGALMPKEPKITQMDWRSLGYWPVWKNGKKVWVPKDEPFNKDSKD |
| Ga0209596_100005086 | 3300027754 | Freshwater Lake | MKEPKIIQMDWRSLGYWPVWKNGKKVWVPKNDESFNKDSKN |
| Ga0209444_101403223 | 3300027756 | Freshwater Lake | MKEPKIAQMDWRSLGYWPVWKNGKKVWVPKDDESFNKDSKD |
| Ga0209296_14102472 | 3300027759 | Freshwater Lake | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDESFNKDSKN |
| Ga0209598_100206956 | 3300027760 | Freshwater Lake | MKEPKITQMDWRSLGYWPVYKNEKKIWVPKDDKSFDKD |
| Ga0209088_100889953 | 3300027763 | Freshwater Lake | MDISGVLMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDKNDEDRED |
| Ga0209088_101498663 | 3300027763 | Freshwater Lake | MKEPKIAQMDWRSLGYWPVWKNGKKVWVPKDEQLDNNSED |
| Ga0209500_100011008 | 3300027782 | Freshwater Lake | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDEPFNKDSKN |
| Ga0209500_103573872 | 3300027782 | Freshwater Lake | MGIYGVPMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKNDKNDEDRED |
| Ga0209107_100040605 | 3300027797 | Freshwater And Sediment | MDTFGALMPKEPKITQMDWRSLGYWPVWKNGKKVWVPKDAESFNKDTEN |
| Ga0209107_101558315 | 3300027797 | Freshwater And Sediment | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDVEASKD |
| Ga0209107_101710913 | 3300027797 | Freshwater And Sediment | MKEPKITQMDWRSLGYWPVWENGKKVWVPKDAESFK |
| Ga0209107_104793071 | 3300027797 | Freshwater And Sediment | MPKEPKITQMDWRSLGYWPVWKNGKKVWVPKDEPFNKDSKD |
| Ga0209230_100068948 | 3300027836 | Freshwater And Sediment | MKEPKIMSMDWRSLGYWPTWKDGKKVWVPKDDQSFNQDAEN |
| Ga0209230_105651411 | 3300027836 | Freshwater And Sediment | MPKDPKIMSMDWRSLGYWPVWKDGKKVWVPKEDKLFNKVLEDTE |
| Ga0209550_103437711 | 3300027892 | Freshwater Lake | MKEPKIAQMDWRSLGYWPVWKDGKKVWVPKDDKSFDKDTE |
| Ga0209298_1000072156 | 3300027973 | Freshwater Lake | MSGVQMPKDPKIMTMDWRSLGYWPVYKNGKKVWVPQDEQHNKD |
| Ga0209298_100125569 | 3300027973 | Freshwater Lake | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDKVDYEAHDKDSKD |
| Ga0247723_1000015101 | 3300028025 | Deep Subsurface Sediment | MKEPKIAQMDWRSLGYWPIWKDGKKVWVPKDDKSFDKDTKN |
| Ga0247722_102648371 | 3300028027 | Deep Subsurface Sediment | VIIIFGALMPKEPKITQMDWRSLGYWPVYQNGKKVWVPKDEAYNKDRED |
| Ga0238435_1138081 | 3300029349 | Freshwater | MREPKIAQMDWRSLGYWPVWKDGKKVWVPKDDKSFDKD |
| Ga0315899_114934012 | 3300031784 | Freshwater | MDISGALMPKEPKITQMDWRSLGYWPEYKNGKKVWVPKDDKNDEDRED |
| Ga0315900_106137241 | 3300031787 | Freshwater | MVEFGVHMAKEPKITKMDWRSLGYWPVYKDGKKVWEKDDKSFNQDTEN |
| Ga0334994_0002011_6680_6829 | 3300033993 | Freshwater | MERFGVSMPKDPKIMTMDWRSLGYWPVWKDGKKVWVPKDDKSFNEDTKN |
| Ga0334994_0186027_631_777 | 3300033993 | Freshwater | MERFGVSMPKDPKIMTMDWRSLGYWPVWKNGKKVWVPKDEQLNNNSED |
| Ga0334979_0002881_974_1102 | 3300033996 | Freshwater | MPREPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFNKNTEN |
| Ga0335005_0521197_218_343 | 3300034022 | Freshwater | MKEPKIVQMDWRALGYWPIWKDGKKVWVPKDDKSFNKNTEN |
| Ga0335005_0757188_183_329 | 3300034022 | Freshwater | MDTFGAPMPKEPKITQMDWRSLGYWPVWKDGKKVWVPKDEPFKKDSKD |
| Ga0334995_0210654_385_510 | 3300034062 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDAESFNKDSKN |
| Ga0334995_0454949_1_123 | 3300034062 | Freshwater | MEEFGVHMAKEPKITQMDWRSLGYWPVWKDGKKVWVPKDVE |
| Ga0335019_0000016_8609_8734 | 3300034066 | Freshwater | MKEPKIAQMDWRSLGYWPVYKDGKKVWVPKDDKSFNQDRKN |
| Ga0334990_0011610_2484_2621 | 3300034068 | Freshwater | MDTSGALMPKEPKITQMDWRSLGYWPVWKDGKKVWVPKDVKTSED |
| Ga0335020_0013143_4707_4832 | 3300034082 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKMWVPKDKTDYWDKIDD |
| Ga0335012_0082759_1692_1811 | 3300034093 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDAESFKKDTE |
| Ga0335012_0340393_404_529 | 3300034093 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPRDAEAFNKNTEN |
| Ga0335029_0014945_3648_3797 | 3300034102 | Freshwater | MGMYGVLMPREPKITKMDWRALGYWPVYKNGKKVWVPEDDKSFNEDTKN |
| Ga0335029_0028869_865_1032 | 3300034102 | Freshwater | MGYNVLSAYFYGRMMKEPRIAQMDWRSLGYWPVWKDGKKVWVPKDDKSFNKNTEN |
| Ga0335050_0364677_90_215 | 3300034108 | Freshwater | MKEPKITQMDWRSLGYWPVWKDGKKVWVPKDKTDYWDKIDD |
| Ga0335054_0788320_89_217 | 3300034119 | Freshwater | MPKEPKITKMDWRSLGYWPVWKDGKKVWVPKDAESFNKNTEN |
| Ga0335049_0021012_2394_2522 | 3300034272 | Freshwater | MKEPKIMSMDWRSLGYWPVWKDGKKVWVPKDDKLFNQTSEDE |
| ⦗Top⦘ |