NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F024761

Metagenome Family F024761

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F024761
Family Type Metagenome
Number of Sequences 204
Average Sequence Length 39 residues
Representative Sequence VLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA
Number of Associated Samples 152
Number of Associated Scaffolds 204

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 16.75 %
% of genes near scaffold ends (potentially truncated) 76.96 %
% of genes from short scaffolds (< 2000 bps) 58.33 %
Associated GOLD sequencing projects 142
AlphaFold2 3D model prediction Yes
3D model pTM-score0.27

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (70.588 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland
(13.725 % of family members)
Environment Ontology (ENVO) Unclassified
(54.412 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(41.667 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 9.23%    β-sheet: 13.85%    Coil/Unstructured: 76.92%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.27
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 204 Family Scaffolds
PF08483Obsolete Pfam Family 34.31
PF01695IstB_IS21 23.53
PF00665rve 16.18
PF00589Phage_integrase 1.47
PF02837Glyco_hydro_2_N 0.98
PF00291PALP 0.49
PF05552TM_helix 0.49
PF12840HTH_20 0.49
PF09299Mu-transpos_C 0.49
PF12762DDE_Tnp_IS1595 0.49
PF13358DDE_3 0.49
PF01965DJ-1_PfpI 0.49
PF14743DNA_ligase_OB_2 0.49
PF01381HTH_3 0.49
PF13414TPR_11 0.49
PF01850PIN 0.49
PF16011CBM9_2 0.49
PF14559TPR_19 0.49
PF14903WG_beta_rep 0.49
PF03781FGE-sulfatase 0.49
PF00380Ribosomal_S9 0.49
PF08281Sigma70_r4_2 0.49
PF13426PAS_9 0.49
PF00149Metallophos 0.49
PF13561adh_short_C2 0.49

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 204 Family Scaffolds
COG1484DNA replication protein DnaCReplication, recombination and repair [L] 23.53
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 16.18
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 16.18
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 16.18
COG4584TransposaseMobilome: prophages, transposons [X] 16.18
COG3250Beta-galactosidase/beta-glucuronidaseCarbohydrate transport and metabolism [G] 0.98
COG0103Ribosomal protein S9Translation, ribosomal structure and biogenesis [J] 0.49
COG0668Small-conductance mechanosensitive channelCell wall/membrane/envelope biogenesis [M] 0.49
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 0.49
COG3264Small-conductance mechanosensitive channel MscKCell wall/membrane/envelope biogenesis [M] 0.49


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms70.59 %
UnclassifiedrootN/A29.41 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001356|JGI12269J14319_10042365All Organisms → cellular organisms → Bacteria2831Open in IMG/M
3300001356|JGI12269J14319_10059597All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2189Open in IMG/M
3300001356|JGI12269J14319_10066452All Organisms → cellular organisms → Bacteria2014Open in IMG/M
3300001356|JGI12269J14319_10082355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1693Open in IMG/M
3300002223|C687J26845_10070605All Organisms → cellular organisms → Bacteria → Acidobacteria1363Open in IMG/M
3300003368|JGI26340J50214_10009301All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3145Open in IMG/M
3300005184|Ga0066671_10036425All Organisms → cellular organisms → Bacteria2366Open in IMG/M
3300005540|Ga0066697_10151184All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1371Open in IMG/M
3300005540|Ga0066697_10330077Not Available891Open in IMG/M
3300005556|Ga0066707_10028767All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3047Open in IMG/M
3300005712|Ga0070764_10940406All Organisms → cellular organisms → Bacteria → Acidobacteria543Open in IMG/M
3300005764|Ga0066903_100716918All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1768Open in IMG/M
3300006052|Ga0075029_100604695All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300006791|Ga0066653_10332768Not Available767Open in IMG/M
3300006804|Ga0079221_10643842Not Available725Open in IMG/M
3300006865|Ga0073934_10162377Not Available1572Open in IMG/M
3300009012|Ga0066710_100070712All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4476Open in IMG/M
3300009012|Ga0066710_100680023All Organisms → cellular organisms → Bacteria1567Open in IMG/M
3300009089|Ga0099828_10322401All Organisms → cellular organisms → Bacteria1391Open in IMG/M
3300009089|Ga0099828_11911023All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium521Open in IMG/M
3300009137|Ga0066709_100213389All Organisms → cellular organisms → Bacteria2548Open in IMG/M
3300009518|Ga0116128_1017986All Organisms → cellular organisms → Bacteria2425Open in IMG/M
3300009519|Ga0116108_1009751All Organisms → cellular organisms → Bacteria3666Open in IMG/M
3300009547|Ga0116136_1109507All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28714Open in IMG/M
3300009547|Ga0116136_1110913Not Available709Open in IMG/M
3300009549|Ga0116137_1089183Not Available921Open in IMG/M
3300009617|Ga0116123_1012550All Organisms → cellular organisms → Bacteria2941Open in IMG/M
3300009628|Ga0116125_1045506Not Available1111Open in IMG/M
3300009630|Ga0116114_1011359All Organisms → cellular organisms → Bacteria2855Open in IMG/M
3300009637|Ga0116118_1183561All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium662Open in IMG/M
3300009639|Ga0116122_1129119All Organisms → cellular organisms → Bacteria810Open in IMG/M
3300009639|Ga0116122_1222184Not Available588Open in IMG/M
3300009639|Ga0116122_1254459Not Available543Open in IMG/M
3300009640|Ga0116126_1012011Not Available4077Open in IMG/M
3300009643|Ga0116110_1011118All Organisms → cellular organisms → Bacteria3707Open in IMG/M
3300009644|Ga0116121_1129573Not Available794Open in IMG/M
3300009698|Ga0116216_10985490Not Available504Open in IMG/M
3300009764|Ga0116134_1144463Not Available842Open in IMG/M
3300009839|Ga0116223_10867094Not Available515Open in IMG/M
3300010329|Ga0134111_10129935Not Available985Open in IMG/M
3300010339|Ga0074046_10017987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria5012Open in IMG/M
3300010339|Ga0074046_10055481All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Caulifigura → Caulifigura coniformis2618Open in IMG/M
3300010339|Ga0074046_10124397All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1655Open in IMG/M
3300010341|Ga0074045_10422355Not Available862Open in IMG/M
3300010343|Ga0074044_10499251Not Available795Open in IMG/M
3300010343|Ga0074044_10578870Not Available733Open in IMG/M
3300010379|Ga0136449_100272939All Organisms → cellular organisms → Bacteria3115Open in IMG/M
3300010379|Ga0136449_100297964All Organisms → cellular organisms → Bacteria2943Open in IMG/M
3300010379|Ga0136449_101839356Not Available904Open in IMG/M
3300010391|Ga0136847_13259861All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2426Open in IMG/M
3300012210|Ga0137378_11193700All Organisms → cellular organisms → Bacteria → Acidobacteria677Open in IMG/M
3300012532|Ga0137373_10241857All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1462Open in IMG/M
3300014151|Ga0181539_1019938All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3808Open in IMG/M
3300014151|Ga0181539_1048205All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria)2024Open in IMG/M
3300014151|Ga0181539_1148748Not Available936Open in IMG/M
3300014151|Ga0181539_1318838All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300014152|Ga0181533_1032940All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2967Open in IMG/M
3300014152|Ga0181533_1150233Not Available953Open in IMG/M
3300014153|Ga0181527_1021478All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium4123Open in IMG/M
3300014153|Ga0181527_1034120All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2969Open in IMG/M
3300014153|Ga0181527_1269554All Organisms → cellular organisms → Bacteria → Acidobacteria680Open in IMG/M
3300014155|Ga0181524_10413401All Organisms → cellular organisms → Bacteria → Acidobacteria586Open in IMG/M
3300014157|Ga0134078_10180399All Organisms → cellular organisms → Bacteria → Acidobacteria849Open in IMG/M
3300014158|Ga0181521_10455098All Organisms → cellular organisms → Bacteria → Acidobacteria620Open in IMG/M
3300014162|Ga0181538_10073092All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2074Open in IMG/M
3300014164|Ga0181532_10813682All Organisms → cellular organisms → Bacteria → Acidobacteria501Open in IMG/M
3300014491|Ga0182014_10078022All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2092Open in IMG/M
3300014498|Ga0182019_11016155All Organisms → cellular organisms → Bacteria → Acidobacteria603Open in IMG/M
3300014502|Ga0182021_10259507All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2038Open in IMG/M
3300014638|Ga0181536_10458159All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM3873561Open in IMG/M
3300016270|Ga0182036_10008086All Organisms → cellular organisms → Bacteria → Proteobacteria5451Open in IMG/M
3300016341|Ga0182035_10120994All Organisms → cellular organisms → Bacteria → Acidobacteria1958Open in IMG/M
3300016341|Ga0182035_11122369All Organisms → cellular organisms → Bacteria → Acidobacteria700Open in IMG/M
3300016387|Ga0182040_10084497All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2104Open in IMG/M
3300016445|Ga0182038_10492119Not Available1045Open in IMG/M
3300017925|Ga0187856_1077726All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1368Open in IMG/M
3300017925|Ga0187856_1179827Not Available778Open in IMG/M
3300017925|Ga0187856_1289498All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300017925|Ga0187856_1289585All Organisms → cellular organisms → Bacteria → Acidobacteria567Open in IMG/M
3300017929|Ga0187849_1006612All Organisms → cellular organisms → Bacteria8739Open in IMG/M
3300017929|Ga0187849_1281412All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium ST_bin13626Open in IMG/M
3300017929|Ga0187849_1283414All Organisms → cellular organisms → Bacteria → Acidobacteria623Open in IMG/M
3300017934|Ga0187803_10003257All Organisms → cellular organisms → Bacteria → Acidobacteria6394Open in IMG/M
3300017934|Ga0187803_10015999All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2991Open in IMG/M
3300017934|Ga0187803_10039716All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1866Open in IMG/M
3300017938|Ga0187854_10008986All Organisms → cellular organisms → Bacteria6507Open in IMG/M
3300017940|Ga0187853_10143497Not Available1148Open in IMG/M
3300017941|Ga0187850_10057689Not Available1978Open in IMG/M
3300017961|Ga0187778_10037822All Organisms → cellular organisms → Bacteria → Acidobacteria2947Open in IMG/M
3300017972|Ga0187781_10087692All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2153Open in IMG/M
3300017972|Ga0187781_10315915Not Available1109Open in IMG/M
3300017975|Ga0187782_11332338Not Available563Open in IMG/M
3300017975|Ga0187782_11579230Not Available518Open in IMG/M
3300017996|Ga0187891_1046157All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → unclassified Oscillatoria → Oscillatoria sp. FACHB-14071852Open in IMG/M
3300017996|Ga0187891_1053489Not Available1679Open in IMG/M
3300017998|Ga0187870_1089294Not Available1211Open in IMG/M
3300018002|Ga0187868_1266614Not Available573Open in IMG/M
3300018002|Ga0187868_1271509All Organisms → cellular organisms → Bacteria → Acidobacteria566Open in IMG/M
3300018003|Ga0187876_1108072Not Available1021Open in IMG/M
3300018004|Ga0187865_1014194All Organisms → cellular organisms → Bacteria → Acidobacteria4094Open in IMG/M
3300018008|Ga0187888_1006624All Organisms → cellular organisms → Bacteria → Acidobacteria7653Open in IMG/M
3300018008|Ga0187888_1152895Not Available943Open in IMG/M
3300018015|Ga0187866_1019549All Organisms → cellular organisms → Bacteria3501Open in IMG/M
3300018016|Ga0187880_1028980All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3171Open in IMG/M
3300018016|Ga0187880_1078178All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1681Open in IMG/M
3300018021|Ga0187882_1366045All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300018025|Ga0187885_10024014All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3420Open in IMG/M
3300018026|Ga0187857_10234110Not Available849Open in IMG/M
3300018033|Ga0187867_10697357All Organisms → cellular organisms → Bacteria → Acidobacteria553Open in IMG/M
3300018062|Ga0187784_10725998All Organisms → cellular organisms → Bacteria → Acidobacteria794Open in IMG/M
3300018088|Ga0187771_10513599Not Available1014Open in IMG/M
3300018090|Ga0187770_10040346All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3318Open in IMG/M
3300018431|Ga0066655_10023658All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2902Open in IMG/M
3300018433|Ga0066667_11388386All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium616Open in IMG/M
3300019082|Ga0187852_1025268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2923Open in IMG/M
3300019082|Ga0187852_1091210Not Available1353Open in IMG/M
3300019788|Ga0182028_1081214Not Available1170Open in IMG/M
3300021432|Ga0210384_10162638All Organisms → cellular organisms → Bacteria → Acidobacteria2004Open in IMG/M
3300022526|Ga0224533_1020016Not Available1158Open in IMG/M
3300023258|Ga0224535_1013649All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1979Open in IMG/M
3300025311|Ga0209343_10028890All Organisms → cellular organisms → Bacteria → Acidobacteria5601Open in IMG/M
3300025320|Ga0209171_10032893All Organisms → cellular organisms → Bacteria3736Open in IMG/M
3300025432|Ga0208821_1027729Not Available1170Open in IMG/M
3300025442|Ga0208034_1040001Not Available1045Open in IMG/M
3300025453|Ga0208455_1056537Not Available821Open in IMG/M
3300025454|Ga0208039_1009695All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2429Open in IMG/M
3300025469|Ga0208687_1013432All Organisms → cellular organisms → Bacteria2451Open in IMG/M
3300025473|Ga0208190_1010991All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2273Open in IMG/M
3300025480|Ga0208688_1008201All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter3164Open in IMG/M
3300025496|Ga0208191_1040361All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1039Open in IMG/M
3300025498|Ga0208819_1011647All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2780Open in IMG/M
3300025506|Ga0208937_1039514Not Available1130Open in IMG/M
3300025581|Ga0208355_1019067All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2058Open in IMG/M
3300025878|Ga0209584_10046217All Organisms → cellular organisms → Bacteria → Acidobacteria1536Open in IMG/M
3300026297|Ga0209237_1030219All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2967Open in IMG/M
3300026305|Ga0209688_1002285All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3235Open in IMG/M
3300026313|Ga0209761_1134783Not Available1183Open in IMG/M
3300026329|Ga0209375_1028874All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3031Open in IMG/M
3300026332|Ga0209803_1104127Not Available1156Open in IMG/M
3300026528|Ga0209378_1027037All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3078Open in IMG/M
3300026538|Ga0209056_10191738All Organisms → cellular organisms → Bacteria → Acidobacteria1507Open in IMG/M
3300027641|Ga0208827_1018063All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2628Open in IMG/M
3300027825|Ga0209039_10025219Not Available2950Open in IMG/M
3300027825|Ga0209039_10063131All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1655Open in IMG/M
3300027825|Ga0209039_10245780All Organisms → cellular organisms → Bacteria → Acidobacteria716Open in IMG/M
3300027854|Ga0209517_10038402All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3838Open in IMG/M
3300027854|Ga0209517_10051320All Organisms → cellular organisms → Bacteria3114Open in IMG/M
3300027854|Ga0209517_10111837All Organisms → cellular organisms → Bacteria1816Open in IMG/M
3300027854|Ga0209517_10118866All Organisms → cellular organisms → Bacteria1744Open in IMG/M
3300027854|Ga0209517_10264425Not Available1022Open in IMG/M
3300027879|Ga0209169_10634481All Organisms → cellular organisms → Bacteria → Acidobacteria557Open in IMG/M
3300027905|Ga0209415_10173225All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2105Open in IMG/M
3300028015|Ga0265353_1035293Not Available506Open in IMG/M
3300028069|Ga0255358_1061343All Organisms → cellular organisms → Bacteria → Acidobacteria537Open in IMG/M
3300028552|Ga0302149_1022252All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1663Open in IMG/M
3300028906|Ga0308309_10868179Not Available783Open in IMG/M
3300029817|Ga0247275_1010886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3359Open in IMG/M
3300029817|Ga0247275_1012625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2990Open in IMG/M
3300030294|Ga0311349_11901153All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300030706|Ga0310039_10027848All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus2650Open in IMG/M
3300030706|Ga0310039_10357263All Organisms → cellular organisms → Bacteria → Acidobacteria544Open in IMG/M
3300031241|Ga0265325_10160196All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter fuscus1059Open in IMG/M
3300031549|Ga0318571_10300442All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium603Open in IMG/M
3300031573|Ga0310915_10030896All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3343Open in IMG/M
3300031680|Ga0318574_10021964All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3123Open in IMG/M
3300031724|Ga0318500_10053620All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1720Open in IMG/M
3300031748|Ga0318492_10050339All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1943Open in IMG/M
3300031768|Ga0318509_10020950All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3058Open in IMG/M
3300031777|Ga0318543_10010203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3255Open in IMG/M
3300031781|Ga0318547_10187090Not Available1232Open in IMG/M
3300031793|Ga0318548_10111370Not Available1317Open in IMG/M
3300031821|Ga0318567_10069439All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1859Open in IMG/M
3300031880|Ga0318544_10009532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus3027Open in IMG/M
3300031893|Ga0318536_10017503All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3200Open in IMG/M
3300031896|Ga0318551_10018982All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3162Open in IMG/M
3300031942|Ga0310916_10036891All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3645Open in IMG/M
3300031949|Ga0214473_10519338Not Available1326Open in IMG/M
3300031954|Ga0306926_10962290Not Available1018Open in IMG/M
3300032069|Ga0315282_10083515All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2996Open in IMG/M
3300032069|Ga0315282_10301181Not Available1045Open in IMG/M
3300032090|Ga0318518_10016063All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3214Open in IMG/M
3300032091|Ga0318577_10437229Not Available625Open in IMG/M
3300032118|Ga0315277_10832846Not Available866Open in IMG/M
3300032160|Ga0311301_10239473All Organisms → cellular organisms → Bacteria3016Open in IMG/M
3300032160|Ga0311301_10242342All Organisms → cellular organisms → Bacteria2991Open in IMG/M
3300032160|Ga0311301_10247446All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2947Open in IMG/M
3300032163|Ga0315281_10122591All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2980Open in IMG/M
3300032261|Ga0306920_100106556All Organisms → cellular organisms → Bacteria → Acidobacteria4151Open in IMG/M
3300032770|Ga0335085_10038844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia6552Open in IMG/M
3300033158|Ga0335077_10393650All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1490Open in IMG/M
3300033402|Ga0326728_10029387All Organisms → cellular organisms → Bacteria9432Open in IMG/M
3300033402|Ga0326728_10124477All Organisms → cellular organisms → Bacteria2943Open in IMG/M
3300033402|Ga0326728_10162943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter2372Open in IMG/M
3300033402|Ga0326728_10521917Not Available956Open in IMG/M
3300033402|Ga0326728_11039548All Organisms → cellular organisms → Bacteria → Acidobacteria562Open in IMG/M
3300033405|Ga0326727_10136363All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium2979Open in IMG/M
3300033405|Ga0326727_10251662All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter1822Open in IMG/M
3300033475|Ga0310811_10992708All Organisms → cellular organisms → Bacteria → Acidobacteria737Open in IMG/M
3300033755|Ga0371489_0134893All Organisms → cellular organisms → Bacteria1370Open in IMG/M
3300033755|Ga0371489_0341922All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium706Open in IMG/M
3300033827|Ga0334848_052245Not Available745Open in IMG/M
3300033977|Ga0314861_0303515Not Available719Open in IMG/M
3300033983|Ga0371488_0227335Not Available925Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland13.73%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland12.75%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil10.29%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil8.33%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog6.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil4.90%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.90%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland3.92%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil3.43%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.43%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil2.94%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.96%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.96%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment1.96%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.96%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil1.96%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen1.47%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.98%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.98%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.98%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment0.49%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.49%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.49%
Hot Spring SedimentEnvironmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment0.49%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.49%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.49%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.49%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.49%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.49%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil0.49%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.49%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.49%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.49%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.49%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001356Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007EnvironmentalOpen in IMG/M
3300002223Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2EnvironmentalOpen in IMG/M
3300003368Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2EnvironmentalOpen in IMG/M
3300005184Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120EnvironmentalOpen in IMG/M
3300005540Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146EnvironmentalOpen in IMG/M
3300005556Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006791Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102EnvironmentalOpen in IMG/M
3300006804Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200EnvironmentalOpen in IMG/M
3300006865Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaGEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009547Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40EnvironmentalOpen in IMG/M
3300009549Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100EnvironmentalOpen in IMG/M
3300009617Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009630Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009640Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009698Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaGEnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010339Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3EnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010391Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406EnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012532Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaGEnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014152Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaGEnvironmentalOpen in IMG/M
3300014153Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaGEnvironmentalOpen in IMG/M
3300014155Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaGEnvironmentalOpen in IMG/M
3300014157Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014491Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaGEnvironmentalOpen in IMG/M
3300014498Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaGEnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016445Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108EnvironmentalOpen in IMG/M
3300017925Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40EnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017934Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017961Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MGEnvironmentalOpen in IMG/M
3300017972Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300017996Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40EnvironmentalOpen in IMG/M
3300017998Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150EnvironmentalOpen in IMG/M
3300018001Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5EnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018003Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40EnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018021Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018088Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MGEnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300018433Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300022526Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 10-14EnvironmentalOpen in IMG/M
3300023258Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34EnvironmentalOpen in IMG/M
3300025311Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes)EnvironmentalOpen in IMG/M
3300025320Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025432Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025442Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025454Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025469Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025480Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025498Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025581Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025878Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes)EnvironmentalOpen in IMG/M
3300026297Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026305Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes)EnvironmentalOpen in IMG/M
3300026313Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes)EnvironmentalOpen in IMG/M
3300026329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes)EnvironmentalOpen in IMG/M
3300026332Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes)EnvironmentalOpen in IMG/M
3300026528Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes)EnvironmentalOpen in IMG/M
3300026538Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes)EnvironmentalOpen in IMG/M
3300027641Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027825Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300028015Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6EnvironmentalOpen in IMG/M
3300028069Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030706Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2)EnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031549Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24EnvironmentalOpen in IMG/M
3300031573Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111EnvironmentalOpen in IMG/M
3300031680Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22EnvironmentalOpen in IMG/M
3300031724Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031777Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24EnvironmentalOpen in IMG/M
3300031781Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20EnvironmentalOpen in IMG/M
3300031793Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031942Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032069Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033827Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9EnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300033983Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12269J14319_1004236543300001356Peatlands SoilVLIPMKVVSDSDLIPVAGSEVKPGIFGAQRRWLSYGA*
JGI12269J14319_1005959713300001356Peatlands SoilLLGIPMKVFSDSDWIPVTGSEVKLIVFGAKRRWRSYRA*
JGI12269J14319_1006645213300001356Peatlands SoilVRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA*
JGI12269J14319_1008235513300001356Peatlands SoilLRIPLKVISDSGLIPIAGSEVKPIIFGAKRRWRSYSA*
C687J26845_1007060513300002223SoilNEENICSVLIPMKVVSDSDLNPVTGSEVKPIVFGAKRRWRSYGA*
JGI26340J50214_1000930113300003368Bog Forest SoilMPKVLIPMKLVTDSDLIPGAGSDVMPVTVGAKRRWRSYGA*
Ga0066671_1003642533300005184SoilLQAFDFFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA*
Ga0066697_1015118413300005540SoilMKTAKFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA*
Ga0066697_1033007713300005540SoilLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA*
Ga0066707_1002876713300005556SoilFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA*
Ga0070764_1094040623300005712SoilLIPMKVVSNSDLIAVTRSDAMPGTFGAKRRWRSYGA*
Ga0066903_10071691833300005764Tropical Forest SoilMLVPDVLIPMKVVSDSDLIPVAHSETMPVTVGAKRRWRSYSA*
Ga0075029_10060469513300006052WatershedsMGIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA*
Ga0066653_1033276813300006791SoilLAWLVLIPIKVISDSDLIPVTDSDVKLIAFGAKRRWRSYAA*
Ga0079221_1064384243300006804Agricultural SoilLATLLIPTKAVSDSDLVPGTDSDAMPVTIGAKRRWW
Ga0073934_1016237733300006865Hot Spring SedimentMLIPMKVVSDSDLIPVTGSDVMPVAIGAKRRWRPYRA*
Ga0066710_10007071253300009012Grasslands SoilVLIPMKVGSDSDLIPVAGSDAMAVTVGAKRRWHSYRA
Ga0066710_10068002313300009012Grasslands SoilLQAFDFFLIPMKAVSDSYLIPVTCSDAMPVKIGAQRRWRPYRA
Ga0099828_1032240133300009089Vadose Zone SoilFGRNCRKLAIPMKVVSDSDLIPVTGSDAMVVTIGAKRRWRLYGA*
Ga0099828_1191102323300009089Vadose Zone SoilMSESNPFSMLIPMKVVSDSDLIAVTHSDAIPITIGAKRRWRGYRA*
Ga0066709_10021338933300009137Grasslands SoilMLIPMKVGSDSDLIPVAGSDAMAVTVGAKRRWHSYRA*
Ga0116128_101798623300009518PeatlandVLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYG
Ga0116108_100975153300009519PeatlandLIPMKVVSDSDLIPVAHSDAKPVTIGAKRRWRFYGA*
Ga0116136_110950723300009547PeatlandMPIPMKVVDDSDLNPVGGSEVKPGVFGAQRRWRSYGA*
Ga0116136_111091313300009547PeatlandMLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA*
Ga0116137_108918313300009549PeatlandIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSYSA*
Ga0116123_101255013300009617PeatlandVLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA*
Ga0116125_104550613300009628PeatlandLRIPMKLVSDSDLIPVTCSELKAVVFGAKRRWRSYRA*
Ga0116114_101135943300009630PeatlandLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA*
Ga0116118_118356113300009637PeatlandVKVELLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWDSYGA*
Ga0116122_112911913300009639PeatlandMLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYG
Ga0116122_122218423300009639PeatlandVNRLLIPLKVVSDSDLIPVAASEVKPVVFGAKRRW
Ga0116122_125445913300009639PeatlandMMLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSY
Ga0116126_101201153300009640PeatlandLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA*
Ga0116110_101111813300009643PeatlandMKITLLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA*
Ga0116121_112957313300009644PeatlandRHKLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA*
Ga0116216_1098549013300009698Peatlands SoilNQVRFVLIPMKVISDSDLIPITRSDAMPIRVGAKRRWLSYRA*
Ga0116134_114446313300009764PeatlandRGLDLGIPMKVVSDSDLIPVAGSEVKPGVFGAKRRWHSYRA*
Ga0116223_1086709423300009839Peatlands SoilLIPMKVVSDSDLIPVAHSDAKPVTVGAKRRWRSYRA*
Ga0134111_1012993523300010329Grasslands SoilMLIPMKVVSDSDLIPVTRSDAMPVTIGAQRRWRPYRA*
Ga0074046_1001798783300010339Bog Forest SoilMLIPMKLVTDSDLIPGAGSDVMPVTVGAKRRWRSYGA*
Ga0074046_1005548113300010339Bog Forest SoilVLIPMKLVTDSDLIPGAGSDVMPVTVGAKRRWRSYGA*
Ga0074046_1012439743300010339Bog Forest SoilLIPMKLVTDSDLIPGAGSDVMPVTVGAKRRWRSYGA*
Ga0074045_1042235523300010341Bog Forest SoilRIPMKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYRA*
Ga0074044_1049925133300010343Bog Forest SoilMLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA*
Ga0074044_1057887013300010343Bog Forest SoilVRIPMKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYRA*
Ga0136449_10027293953300010379Peatlands SoilLIPMKVISDSDLIPITRSDAMPIRVGAKRRWLSYRA*
Ga0136449_10029796413300010379Peatlands SoilRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA*
Ga0136449_10183935623300010379Peatlands SoilAIPMKVGSASDLNPVADSEVKLGVFGAQRRWRSYGA*
Ga0136847_1325986143300010391Freshwater SedimentLIPMKVVSDSDLIPVTGSEVKAVVFGAKRRWRCYRA*
Ga0137378_1119370023300012210Vadose Zone SoilLIPTKVGTDSDLIPVTRSDAMPVTFGAKRRWRFYGA*
Ga0137373_1024185743300012532Vadose Zone SoilGVLVLEELLIPMKVGTDSDLIPVTRSDAMAVTFEAKRRWRFYGA*
Ga0181539_101993873300014151BogMLPIPMKVIGDSDWIRVTGSEVKLIVFGAKRRWRSYRA*
Ga0181539_104820513300014151BogMPIPMKVIGDSDWIRVTGSEVKLIVFGAKRRWRSYRA*
Ga0181539_114874813300014151BogMKTQREPSLLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSY
Ga0181539_131883823300014151BogLIPLKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYSA*
Ga0181533_103294013300014152BogPIPMKVIGDSDWIRVTGSEVKLIVFGAKRRWRSYRA*
Ga0181533_115023323300014152BogVRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA*
Ga0181527_102147863300014153BogMLPIPMKVIGDSDWIRVTGSEVKLIVFGAKRRWRSY
Ga0181527_103412013300014153BogVRIPLKVISDSGLIPIAGSEMKPIVFGAKRRWRSYSA*
Ga0181527_126955423300014153BogMMLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSYDA*
Ga0181524_1041340123300014155BogVRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWHSYGA*
Ga0134078_1018039933300014157Grasslands SoilALALLIPIKVGSDSEWIPVARSEAMLVTVGAKRRWRRYGA*
Ga0181521_1045509813300014158BogPMRIPLKVISDSGLIPIAGSEVKPIIFGAKRRWRSYSA*
Ga0181538_1007309233300014162BogPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA*
Ga0181532_1081368223300014164BogGIPMKVVSDSDLIPVAGSEVKPGVFGAKRRWHSYRA*
Ga0182014_1007802233300014491BogSQKQENLEMLRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA*
Ga0182019_1101615523300014498FenLIPMKVIIDSDLIPVTGSEVKLIVFGAKRRWHSYRA*
Ga0182021_1025950733300014502FenLRIPMKVVGDSDLNPVAGSEVKPGVFGAKRRWRSYRA*
Ga0181536_1045815933300014638BogIPMKVVSDSDLIPVAGSEVKPGIFGAQRRWLSYGA*
Ga0182036_1000808613300016270SoilVLIPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRSYSA
Ga0182035_1012099443300016341SoilLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0182035_1112236913300016341SoilIPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRCYGA
Ga0182040_1008449713300016387SoilIPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRSYSA
Ga0182038_1049211913300016445SoilVPIPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRCYGA
Ga0187856_107772613300017925PeatlandMLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA
Ga0187856_117982713300017925PeatlandLLLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSY
Ga0187856_128949823300017925PeatlandLIPLKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYSA
Ga0187856_128958523300017925PeatlandLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA
Ga0187849_1006612103300017929PeatlandMLIPLKVVTDSDLIPVAASEVKPVVFGAKRRWRSYGA
Ga0187849_128141223300017929PeatlandLGYSPVVGTGVLIPMKAGTDSDLMPVSDSEAMLVAIGAKRRWRSYGA
Ga0187849_128341413300017929PeatlandGIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRFYGA
Ga0187803_1000325763300017934Freshwater SedimentLIPMKVVSDSDLIPVTGSDAMVVTAGAKRRWRTYRA
Ga0187803_1001599943300017934Freshwater SedimentVIPMKVVSDSDLIPVTHSDAMAVTVGAKRRWRSYGA
Ga0187803_1003971623300017934Freshwater SedimentMVIPMKVVSDSDLIPVTHSDAMAVTVGAKRRWRSYGA
Ga0187854_10008986133300017938PeatlandVQSIRRVLIPLKVVTDSDLIPVAASEVKPVVFGAKRRWRSYGA
Ga0187853_1014349723300017940PeatlandLIPMKVVSDSDLIPVAHSDAKPVTIGAKRRWRFYGA
Ga0187850_1005768963300017941PeatlandVQSIRRVLIPLKVVTDSDLIPVAASEVKPVVFGAKRRWRS
Ga0187778_1003782213300017961Tropical PeatlandMSRIHAGAGVLIPMMVITDSDLIPVTHSDAMPITFGAQRRWLSYRA
Ga0187781_1008769233300017972Tropical PeatlandLIPMKVVSDSDLIPVAHSEAMPVTVGAKRRWRSYSA
Ga0187781_1031591523300017972Tropical PeatlandRWPRIMLLIPMIVISDSDLIPVTRSDAMPITVGAKRRWLSHRA
Ga0187782_1133233823300017975Tropical PeatlandMLIPMKVDSDSDLIPVAHSDAKPVTVGAKRRWRFYGA
Ga0187782_1157923013300017975Tropical PeatlandMRIPMKVIGDSDMIPVTGSEVKLIVFGAKRRWHFHGA
Ga0187891_104615733300017996PeatlandVLIPMKVVSDSDLIPVAHSDAKPVTIGAKRRWRFYGA
Ga0187891_105348913300017996PeatlandMKTQREPSLLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSYDA
Ga0187870_108929413300017998PeatlandVQSIRRVLIPLKVVTDSDLIPVAASEVKPVVFGAKRRWRSY
Ga0187815_1008028323300018001Freshwater SedimentVAEKRHFQPQVKLLGIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA
Ga0187868_126661413300018002PeatlandLRIPMKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYRA
Ga0187868_127150913300018002PeatlandVLIPLKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYSA
Ga0187876_110807213300018003PeatlandVLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA
Ga0187865_101419463300018004PeatlandPFLLIPMKVVSNSDLIPVTHSEAMPVVIGAKRRWRRYGA
Ga0187888_100662483300018008PeatlandVLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSY
Ga0187888_115289523300018008PeatlandMMLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSYDA
Ga0187866_101954953300018015PeatlandLLAKSLVRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA
Ga0187880_102898023300018016PeatlandMMTLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA
Ga0187880_107817833300018016PeatlandWTVLIPMKVIGNSDLVPVTGSEVKRIVFGAKRRWRSYRA
Ga0187882_136604523300018021PeatlandLIPLKVVTDSDLIPVAASEVKPVVFGAKRRWRSYSA
Ga0187885_1002401413300018025PeatlandLLLIPMKVVSDSDLIPVAHSDAKPVTIGAKRRWRFYGA
Ga0187857_1023411023300018026PeatlandLLIPMKVVSDSDLIPVAHSDAKPVTIGAKRRWRFYGA
Ga0187867_1069735723300018033PeatlandVPVRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA
Ga0187784_1072599823300018062Tropical PeatlandTYSTFSLYLLIPLKVGSDSDFNPVTGSGVKLGVFGAQRRWHSYRA
Ga0187771_1051359913300018088Tropical PeatlandVLIPMIVISDSDLIPVTHSDAMLITVGAKRRWLFHRA
Ga0187770_1004034613300018090Tropical PeatlandLRIPLKVGGDSDLNPVTGSGAKPGVFGAQRRWRSYGA
Ga0066655_1002365843300018431Grasslands SoilLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA
Ga0066667_1138838623300018433Grasslands SoilLIPMKVGSDSDLIPVAGSDAMAVTVGAKRRWHSYRA
Ga0187852_102526813300019082PeatlandNIPHLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA
Ga0187852_109121013300019082PeatlandMKTQREPSLLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRS
Ga0182028_108121423300019788FenTTFSAYYEYLRIPMKMIGDSDWIPVTGSEMKLMVFGAKRRWHSYPA
Ga0210384_1016263833300021432SoilMGIPMKVVSDSDLIPITGSEVKLIVFGAKRRWRSYRA
Ga0224533_102001633300022526SoilDFTGAMRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA
Ga0224535_101364913300023258SoilPVLIPMKVIIDSDLIPVTGSEVKLIVFGAKRRWHSYRA
Ga0209343_1002889013300025311GroundwaterVLLLIPMKVVSDSDLNPVTGSEVKPIVFGAKRRWRSYGA
Ga0209171_1003289313300025320Iron-Sulfur Acid SpringAKMPMLIPMKVVGDSDLIPVTGSEVKLIVFGAKRRWRSYGA
Ga0208821_102772913300025432PeatlandVLAIPVKVGSDSDLNPVGGSEVKPGVFGAQRRWRSYGA
Ga0208034_104000113300025442PeatlandGIPVKVVSDSDLIPVTCSEVKAVVFGAKRRWHFYRA
Ga0208455_105653723300025453PeatlandGFLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA
Ga0208039_100969513300025454PeatlandLVGYRSSQMLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA
Ga0208687_101343213300025469PeatlandMLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSY
Ga0208190_101099113300025473PeatlandLLSVLSEFVRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA
Ga0208688_100820113300025480PeatlandLVLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA
Ga0208191_104036113300025496PeatlandVLLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYG
Ga0208819_101164713300025498PeatlandLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA
Ga0208937_103951423300025506PeatlandMFEGEVLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA
Ga0208355_101906713300025581Arctic Peat SoilFSGPQPLRIPMKVISDSDLIPVTCSEVKAVVFGGKRRWRSYGA
Ga0209584_1004621733300025878Arctic Peat SoilMPGPFENTLRIPMKVISDSDWIPVTGSEVKLIVFGAKRRWRSYRA
Ga0209237_103021913300026297Grasslands SoilDQRTSCMLIPMKVVSDSDLIPGTDSDAMPVTIGAQRRW
Ga0209688_100228523300026305SoilLQAFDFFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA
Ga0209761_113478323300026313Grasslands SoilWIMRMSSRVMLIPMKVVSDSDLIPGTDSDAMPVTIGAQRRW
Ga0209375_102887443300026329SoilMFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA
Ga0209803_110412713300026332SoilAITPGVLIPMKVVSDSDLIPGTDSDAMPVTIGAQRRW
Ga0209378_102703713300026528SoilMKTAKFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA
Ga0209056_1019173813300026538SoilRFGSQVLIPMKVGSDSDLIPVAGSDAMAVTVGAKRRWHSYRA
Ga0208827_101806333300027641Peatlands SoilREEIEPLGIPMKVFSDSDWIPVTGSEVKLIVFGAKRRWRSYRA
Ga0209039_1002521913300027825Bog Forest SoilMPKVLIPMKLVTDSDLIPGAGSDVMPVTVGAKRRW
Ga0209039_1006313143300027825Bog Forest SoilLIPMKLVTDSDLIPGAGSDVMPVTVGAKRRWRSYGA
Ga0209039_1024578013300027825Bog Forest SoilRQFHCQMLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWHSYGA
Ga0209517_1003840253300027854Peatlands SoilLVGLGWLRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA
Ga0209517_1005132043300027854Peatlands SoilHPLDMDMGIPMKVFSDSDWIPVTGSEVKLIVFGAKRRWRSYRA
Ga0209517_1011183713300027854Peatlands SoilMNIVLLIPMKVVSDSDLIPVAGSEVKPGIFGAQRRWLSYGA
Ga0209517_1011886613300027854Peatlands SoilHPLGLEEKVLIPMKVISDSDLIPITRSDAMPIRVGAKRRWLSYRA
Ga0209517_1026442523300027854Peatlands SoilSLANLLIPMKVIIDSDLIPVTGSEVKLIVFGAKRRWRSYRA
Ga0209169_1063448123300027879SoilARMRIPMKVVSDSDLILVTCSEVKVVVFGAKRRWRSYRA
Ga0209415_1017322513300027905Peatlands SoilVSLQHVLAIPMKVGSASDLNPVADSEVKLGVFGAQRRWRSYGA
Ga0265353_103529313300028015SoilRIPMKLVSDSDLIPVTCSELKAVVFGAKRRWRSYRA
Ga0255358_106134313300028069SoilGLRIPMKVVSDFDLIPVTGSEVKPIIFGAKRRWRPYRA
Ga0302149_102225243300028552BogTLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA
Ga0308309_1086817913300028906SoilLRIPMKVVSDSDLILVTCSEVKVVVFGAKRRWRSYRA
Ga0247275_101088613300029817SoilCWLWLLIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA
Ga0247275_101262513300029817SoilVAGFLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA
Ga0311349_1190115313300030294FenWKHNPGMLIPMKVIIDSDMIPVTGSEVKLIVFGAKRRWRSYRA
Ga0310039_1002784833300030706Peatlands SoilPLVGIPMKVFSDSDWIPVTGSEVKLIVFGAKRRWRSYRA
Ga0310039_1035726323300030706Peatlands SoilCSSRIRMALRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA
Ga0265325_1016019613300031241RhizosphereRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA
Ga0318571_1030044233300031549SoilIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0310915_1003089613300031573SoilMLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318574_1002196433300031680SoilVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318500_1005362013300031724SoilSNSGVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318492_1005033933300031748SoilRAPVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318509_1002095013300031768SoilCLLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318543_1001020333300031777SoilMLRLIRSKLLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318547_1018709013300031781SoilGILLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318548_1011137023300031793SoilLKFLLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318567_1006943933300031821SoilPVILMMLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318544_1000953233300031880SoilMQRIFSAVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318536_1001750313300031893SoilGTPPLDVLIPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRSYSA
Ga0318551_1001898213300031896SoilSVYRFARKMLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0310916_1003689113300031942SoilLWVVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0214473_1051933833300031949SoilMLIPMKVVSDSDLIPVTRSDAMLVTIGAKRRWRRYGA
Ga0306926_1096229013300031954SoilSFISKVPIPMKVVSDSDLIPVTHSDAKPVTVGAKRR
Ga0315282_1008351543300032069SedimentSFAAESHQKAALLIPMKVIRDSDLIPVTGSEVKPIVFGAKRRWRSNGA
Ga0315282_1030118113300032069SedimentLLVGIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA
Ga0318518_1001606313300032090SoilRMLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0318577_1043722923300032091SoilMVLIPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRSYSA
Ga0315277_1083284623300032118SedimentADDAQASLLLIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA
Ga0311301_1023947313300032160Peatlands SoilNQVRFVLIPMKVISDSDLIPITRSDAMPIRVGAKRRWLSYRA
Ga0311301_1024234253300032160Peatlands SoilVPCGRLLIPMKVVSDSDLIPVAGSEVKPGIFGAQRRWLSYGA
Ga0311301_1024744613300032160Peatlands SoilALRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA
Ga0315281_1012259113300032163SedimentTSVGLLIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA
Ga0306920_10010655613300032261SoilLVPREVGVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA
Ga0335085_1003884463300032770SoilGIPMKVFSDSDWIPVTGSEVKLIVFGAKRRWRSYRA
Ga0335077_1039365013300033158SoilAGNRRVLIPMIVISDSDLIPVTHSDAMPIRVGAKRRWLSHRA
Ga0326728_10029387123300033402Peat SoilRIPLKVISDSGLIPIAGSEVKPIVFGAKRRWRSYSA
Ga0326728_1012447713300033402Peat SoilGIPLKVGSDSDLNPVAGSEVKPGVFGAKRRWRSYGA
Ga0326728_1016294313300033402Peat SoilLGQRQIARMHIPLKVISDSGLIPIAGSEVKPIVFGAKRRWRSYSA
Ga0326728_1052191723300033402Peat SoilKDKAYLKIMGIPMKVVSDSDLISVTCSEVKAVVFGAKRRWPSYRA
Ga0326728_1103954823300033402Peat SoilLIPLKVVSDSDLIPVAVSEVKPGVFGAQRRWRSYGA
Ga0326727_1013636343300033405Peat SoilKLRLRLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA
Ga0326727_1025166213300033405Peat SoilVQLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA
Ga0310811_1099270813300033475SoilNSTFNAVFADLLLIPMKVVSDSDLIPVTGSGVKPIIFGAKRRWRCYRA
Ga0371489_0134893_1243_13563300033755Peat SoilMLIPLKVVSDSDLIPVAVSEVKPGVFGAQRRWRSYGA
Ga0371489_0341922_230_3433300033755Peat SoilMRIPLKVISDSGLIPIAGSEVKPIVFGAKRRWRSYSA
Ga0334848_052245_2_1093300033827SoilIPMKVIIDSDLIPVTGSEVKLIVFGAKRRWHSYRA
Ga0314861_0303515_148_2703300033977PeatlandVRKLLIPMKVVSDSDLIPVAHSDAKPVTVGAKRRWRSYGA
Ga0371488_0227335_17_1483300033983Peat SoilMHQDALLRIPMKVVSDSDLIPVTGSEVKAVVFGAKRRWRSYRA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.