Basic Information | |
---|---|
Family ID | F024761 |
Family Type | Metagenome |
Number of Sequences | 204 |
Average Sequence Length | 39 residues |
Representative Sequence | VLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA |
Number of Associated Samples | 152 |
Number of Associated Scaffolds | 204 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | No |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 16.75 % |
% of genes near scaffold ends (potentially truncated) | 76.96 % |
% of genes from short scaffolds (< 2000 bps) | 58.33 % |
Associated GOLD sequencing projects | 142 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.27 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (70.588 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland (13.725 % of family members) |
Environment Ontology (ENVO) | Unclassified (54.412 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (41.667 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 9.23% β-sheet: 13.85% Coil/Unstructured: 76.92% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.27 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 204 Family Scaffolds |
---|---|---|
PF08483 | Obsolete Pfam Family | 34.31 |
PF01695 | IstB_IS21 | 23.53 |
PF00665 | rve | 16.18 |
PF00589 | Phage_integrase | 1.47 |
PF02837 | Glyco_hydro_2_N | 0.98 |
PF00291 | PALP | 0.49 |
PF05552 | TM_helix | 0.49 |
PF12840 | HTH_20 | 0.49 |
PF09299 | Mu-transpos_C | 0.49 |
PF12762 | DDE_Tnp_IS1595 | 0.49 |
PF13358 | DDE_3 | 0.49 |
PF01965 | DJ-1_PfpI | 0.49 |
PF14743 | DNA_ligase_OB_2 | 0.49 |
PF01381 | HTH_3 | 0.49 |
PF13414 | TPR_11 | 0.49 |
PF01850 | PIN | 0.49 |
PF16011 | CBM9_2 | 0.49 |
PF14559 | TPR_19 | 0.49 |
PF14903 | WG_beta_rep | 0.49 |
PF03781 | FGE-sulfatase | 0.49 |
PF00380 | Ribosomal_S9 | 0.49 |
PF08281 | Sigma70_r4_2 | 0.49 |
PF13426 | PAS_9 | 0.49 |
PF00149 | Metallophos | 0.49 |
PF13561 | adh_short_C2 | 0.49 |
COG ID | Name | Functional Category | % Frequency in 204 Family Scaffolds |
---|---|---|---|
COG1484 | DNA replication protein DnaC | Replication, recombination and repair [L] | 23.53 |
COG2801 | Transposase InsO and inactivated derivatives | Mobilome: prophages, transposons [X] | 16.18 |
COG2826 | Transposase and inactivated derivatives, IS30 family | Mobilome: prophages, transposons [X] | 16.18 |
COG3316 | Transposase (or an inactivated derivative), DDE domain | Mobilome: prophages, transposons [X] | 16.18 |
COG4584 | Transposase | Mobilome: prophages, transposons [X] | 16.18 |
COG3250 | Beta-galactosidase/beta-glucuronidase | Carbohydrate transport and metabolism [G] | 0.98 |
COG0103 | Ribosomal protein S9 | Translation, ribosomal structure and biogenesis [J] | 0.49 |
COG0668 | Small-conductance mechanosensitive channel | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
COG1262 | Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domain | Posttranslational modification, protein turnover, chaperones [O] | 0.49 |
COG3264 | Small-conductance mechanosensitive channel MscK | Cell wall/membrane/envelope biogenesis [M] | 0.49 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 70.59 % |
Unclassified | root | N/A | 29.41 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001356|JGI12269J14319_10042365 | All Organisms → cellular organisms → Bacteria | 2831 | Open in IMG/M |
3300001356|JGI12269J14319_10059597 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2189 | Open in IMG/M |
3300001356|JGI12269J14319_10066452 | All Organisms → cellular organisms → Bacteria | 2014 | Open in IMG/M |
3300001356|JGI12269J14319_10082355 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1693 | Open in IMG/M |
3300002223|C687J26845_10070605 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1363 | Open in IMG/M |
3300003368|JGI26340J50214_10009301 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3145 | Open in IMG/M |
3300005184|Ga0066671_10036425 | All Organisms → cellular organisms → Bacteria | 2366 | Open in IMG/M |
3300005540|Ga0066697_10151184 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1371 | Open in IMG/M |
3300005540|Ga0066697_10330077 | Not Available | 891 | Open in IMG/M |
3300005556|Ga0066707_10028767 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3047 | Open in IMG/M |
3300005712|Ga0070764_10940406 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 543 | Open in IMG/M |
3300005764|Ga0066903_100716918 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1768 | Open in IMG/M |
3300006052|Ga0075029_100604695 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 733 | Open in IMG/M |
3300006791|Ga0066653_10332768 | Not Available | 767 | Open in IMG/M |
3300006804|Ga0079221_10643842 | Not Available | 725 | Open in IMG/M |
3300006865|Ga0073934_10162377 | Not Available | 1572 | Open in IMG/M |
3300009012|Ga0066710_100070712 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4476 | Open in IMG/M |
3300009012|Ga0066710_100680023 | All Organisms → cellular organisms → Bacteria | 1567 | Open in IMG/M |
3300009089|Ga0099828_10322401 | All Organisms → cellular organisms → Bacteria | 1391 | Open in IMG/M |
3300009089|Ga0099828_11911023 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 521 | Open in IMG/M |
3300009137|Ga0066709_100213389 | All Organisms → cellular organisms → Bacteria | 2548 | Open in IMG/M |
3300009518|Ga0116128_1017986 | All Organisms → cellular organisms → Bacteria | 2425 | Open in IMG/M |
3300009519|Ga0116108_1009751 | All Organisms → cellular organisms → Bacteria | 3666 | Open in IMG/M |
3300009547|Ga0116136_1109507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium RIFCSPLOWO2_02_FULL_61_28 | 714 | Open in IMG/M |
3300009547|Ga0116136_1110913 | Not Available | 709 | Open in IMG/M |
3300009549|Ga0116137_1089183 | Not Available | 921 | Open in IMG/M |
3300009617|Ga0116123_1012550 | All Organisms → cellular organisms → Bacteria | 2941 | Open in IMG/M |
3300009628|Ga0116125_1045506 | Not Available | 1111 | Open in IMG/M |
3300009630|Ga0116114_1011359 | All Organisms → cellular organisms → Bacteria | 2855 | Open in IMG/M |
3300009637|Ga0116118_1183561 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 662 | Open in IMG/M |
3300009639|Ga0116122_1129119 | All Organisms → cellular organisms → Bacteria | 810 | Open in IMG/M |
3300009639|Ga0116122_1222184 | Not Available | 588 | Open in IMG/M |
3300009639|Ga0116122_1254459 | Not Available | 543 | Open in IMG/M |
3300009640|Ga0116126_1012011 | Not Available | 4077 | Open in IMG/M |
3300009643|Ga0116110_1011118 | All Organisms → cellular organisms → Bacteria | 3707 | Open in IMG/M |
3300009644|Ga0116121_1129573 | Not Available | 794 | Open in IMG/M |
3300009698|Ga0116216_10985490 | Not Available | 504 | Open in IMG/M |
3300009764|Ga0116134_1144463 | Not Available | 842 | Open in IMG/M |
3300009839|Ga0116223_10867094 | Not Available | 515 | Open in IMG/M |
3300010329|Ga0134111_10129935 | Not Available | 985 | Open in IMG/M |
3300010339|Ga0074046_10017987 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria | 5012 | Open in IMG/M |
3300010339|Ga0074046_10055481 | All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Caulifigura → Caulifigura coniformis | 2618 | Open in IMG/M |
3300010339|Ga0074046_10124397 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1655 | Open in IMG/M |
3300010341|Ga0074045_10422355 | Not Available | 862 | Open in IMG/M |
3300010343|Ga0074044_10499251 | Not Available | 795 | Open in IMG/M |
3300010343|Ga0074044_10578870 | Not Available | 733 | Open in IMG/M |
3300010379|Ga0136449_100272939 | All Organisms → cellular organisms → Bacteria | 3115 | Open in IMG/M |
3300010379|Ga0136449_100297964 | All Organisms → cellular organisms → Bacteria | 2943 | Open in IMG/M |
3300010379|Ga0136449_101839356 | Not Available | 904 | Open in IMG/M |
3300010391|Ga0136847_13259861 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2426 | Open in IMG/M |
3300012210|Ga0137378_11193700 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 677 | Open in IMG/M |
3300012532|Ga0137373_10241857 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1462 | Open in IMG/M |
3300014151|Ga0181539_1019938 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3808 | Open in IMG/M |
3300014151|Ga0181539_1048205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Syntrophobacterales → Syntrophaceae → Syntrophus → unclassified Syntrophus (in: Bacteria) → Syntrophus sp. (in: d-proteobacteria) | 2024 | Open in IMG/M |
3300014151|Ga0181539_1148748 | Not Available | 936 | Open in IMG/M |
3300014151|Ga0181539_1318838 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300014152|Ga0181533_1032940 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2967 | Open in IMG/M |
3300014152|Ga0181533_1150233 | Not Available | 953 | Open in IMG/M |
3300014153|Ga0181527_1021478 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 4123 | Open in IMG/M |
3300014153|Ga0181527_1034120 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2969 | Open in IMG/M |
3300014153|Ga0181527_1269554 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 680 | Open in IMG/M |
3300014155|Ga0181524_10413401 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 586 | Open in IMG/M |
3300014157|Ga0134078_10180399 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 849 | Open in IMG/M |
3300014158|Ga0181521_10455098 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 620 | Open in IMG/M |
3300014162|Ga0181538_10073092 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2074 | Open in IMG/M |
3300014164|Ga0181532_10813682 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 501 | Open in IMG/M |
3300014491|Ga0182014_10078022 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2092 | Open in IMG/M |
3300014498|Ga0182019_11016155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 603 | Open in IMG/M |
3300014502|Ga0182021_10259507 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2038 | Open in IMG/M |
3300014638|Ga0181536_10458159 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Phyllobacteriaceae → Mesorhizobium → unclassified Mesorhizobium → Mesorhizobium sp. WSM3873 | 561 | Open in IMG/M |
3300016270|Ga0182036_10008086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 5451 | Open in IMG/M |
3300016341|Ga0182035_10120994 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1958 | Open in IMG/M |
3300016341|Ga0182035_11122369 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 700 | Open in IMG/M |
3300016387|Ga0182040_10084497 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2104 | Open in IMG/M |
3300016445|Ga0182038_10492119 | Not Available | 1045 | Open in IMG/M |
3300017925|Ga0187856_1077726 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1368 | Open in IMG/M |
3300017925|Ga0187856_1179827 | Not Available | 778 | Open in IMG/M |
3300017925|Ga0187856_1289498 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300017925|Ga0187856_1289585 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 567 | Open in IMG/M |
3300017929|Ga0187849_1006612 | All Organisms → cellular organisms → Bacteria | 8739 | Open in IMG/M |
3300017929|Ga0187849_1281412 | All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium ST_bin13 | 626 | Open in IMG/M |
3300017929|Ga0187849_1283414 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 623 | Open in IMG/M |
3300017934|Ga0187803_10003257 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 6394 | Open in IMG/M |
3300017934|Ga0187803_10015999 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2991 | Open in IMG/M |
3300017934|Ga0187803_10039716 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1866 | Open in IMG/M |
3300017938|Ga0187854_10008986 | All Organisms → cellular organisms → Bacteria | 6507 | Open in IMG/M |
3300017940|Ga0187853_10143497 | Not Available | 1148 | Open in IMG/M |
3300017941|Ga0187850_10057689 | Not Available | 1978 | Open in IMG/M |
3300017961|Ga0187778_10037822 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2947 | Open in IMG/M |
3300017972|Ga0187781_10087692 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2153 | Open in IMG/M |
3300017972|Ga0187781_10315915 | Not Available | 1109 | Open in IMG/M |
3300017975|Ga0187782_11332338 | Not Available | 563 | Open in IMG/M |
3300017975|Ga0187782_11579230 | Not Available | 518 | Open in IMG/M |
3300017996|Ga0187891_1046157 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria → unclassified Oscillatoria → Oscillatoria sp. FACHB-1407 | 1852 | Open in IMG/M |
3300017996|Ga0187891_1053489 | Not Available | 1679 | Open in IMG/M |
3300017998|Ga0187870_1089294 | Not Available | 1211 | Open in IMG/M |
3300018002|Ga0187868_1266614 | Not Available | 573 | Open in IMG/M |
3300018002|Ga0187868_1271509 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 566 | Open in IMG/M |
3300018003|Ga0187876_1108072 | Not Available | 1021 | Open in IMG/M |
3300018004|Ga0187865_1014194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4094 | Open in IMG/M |
3300018008|Ga0187888_1006624 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 7653 | Open in IMG/M |
3300018008|Ga0187888_1152895 | Not Available | 943 | Open in IMG/M |
3300018015|Ga0187866_1019549 | All Organisms → cellular organisms → Bacteria | 3501 | Open in IMG/M |
3300018016|Ga0187880_1028980 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3171 | Open in IMG/M |
3300018016|Ga0187880_1078178 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1681 | Open in IMG/M |
3300018021|Ga0187882_1366045 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300018025|Ga0187885_10024014 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3420 | Open in IMG/M |
3300018026|Ga0187857_10234110 | Not Available | 849 | Open in IMG/M |
3300018033|Ga0187867_10697357 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 553 | Open in IMG/M |
3300018062|Ga0187784_10725998 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 794 | Open in IMG/M |
3300018088|Ga0187771_10513599 | Not Available | 1014 | Open in IMG/M |
3300018090|Ga0187770_10040346 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3318 | Open in IMG/M |
3300018431|Ga0066655_10023658 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2902 | Open in IMG/M |
3300018433|Ga0066667_11388386 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 616 | Open in IMG/M |
3300019082|Ga0187852_1025268 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2923 | Open in IMG/M |
3300019082|Ga0187852_1091210 | Not Available | 1353 | Open in IMG/M |
3300019788|Ga0182028_1081214 | Not Available | 1170 | Open in IMG/M |
3300021432|Ga0210384_10162638 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2004 | Open in IMG/M |
3300022526|Ga0224533_1020016 | Not Available | 1158 | Open in IMG/M |
3300023258|Ga0224535_1013649 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1979 | Open in IMG/M |
3300025311|Ga0209343_10028890 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 5601 | Open in IMG/M |
3300025320|Ga0209171_10032893 | All Organisms → cellular organisms → Bacteria | 3736 | Open in IMG/M |
3300025432|Ga0208821_1027729 | Not Available | 1170 | Open in IMG/M |
3300025442|Ga0208034_1040001 | Not Available | 1045 | Open in IMG/M |
3300025453|Ga0208455_1056537 | Not Available | 821 | Open in IMG/M |
3300025454|Ga0208039_1009695 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2429 | Open in IMG/M |
3300025469|Ga0208687_1013432 | All Organisms → cellular organisms → Bacteria | 2451 | Open in IMG/M |
3300025473|Ga0208190_1010991 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2273 | Open in IMG/M |
3300025480|Ga0208688_1008201 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 3164 | Open in IMG/M |
3300025496|Ga0208191_1040361 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1039 | Open in IMG/M |
3300025498|Ga0208819_1011647 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2780 | Open in IMG/M |
3300025506|Ga0208937_1039514 | Not Available | 1130 | Open in IMG/M |
3300025581|Ga0208355_1019067 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2058 | Open in IMG/M |
3300025878|Ga0209584_10046217 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1536 | Open in IMG/M |
3300026297|Ga0209237_1030219 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2967 | Open in IMG/M |
3300026305|Ga0209688_1002285 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3235 | Open in IMG/M |
3300026313|Ga0209761_1134783 | Not Available | 1183 | Open in IMG/M |
3300026329|Ga0209375_1028874 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3031 | Open in IMG/M |
3300026332|Ga0209803_1104127 | Not Available | 1156 | Open in IMG/M |
3300026528|Ga0209378_1027037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3078 | Open in IMG/M |
3300026538|Ga0209056_10191738 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1507 | Open in IMG/M |
3300027641|Ga0208827_1018063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2628 | Open in IMG/M |
3300027825|Ga0209039_10025219 | Not Available | 2950 | Open in IMG/M |
3300027825|Ga0209039_10063131 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1655 | Open in IMG/M |
3300027825|Ga0209039_10245780 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 716 | Open in IMG/M |
3300027854|Ga0209517_10038402 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3838 | Open in IMG/M |
3300027854|Ga0209517_10051320 | All Organisms → cellular organisms → Bacteria | 3114 | Open in IMG/M |
3300027854|Ga0209517_10111837 | All Organisms → cellular organisms → Bacteria | 1816 | Open in IMG/M |
3300027854|Ga0209517_10118866 | All Organisms → cellular organisms → Bacteria | 1744 | Open in IMG/M |
3300027854|Ga0209517_10264425 | Not Available | 1022 | Open in IMG/M |
3300027879|Ga0209169_10634481 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 557 | Open in IMG/M |
3300027905|Ga0209415_10173225 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2105 | Open in IMG/M |
3300028015|Ga0265353_1035293 | Not Available | 506 | Open in IMG/M |
3300028069|Ga0255358_1061343 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 537 | Open in IMG/M |
3300028552|Ga0302149_1022252 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1663 | Open in IMG/M |
3300028906|Ga0308309_10868179 | Not Available | 783 | Open in IMG/M |
3300029817|Ga0247275_1010886 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3359 | Open in IMG/M |
3300029817|Ga0247275_1012625 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2990 | Open in IMG/M |
3300030294|Ga0311349_11901153 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 548 | Open in IMG/M |
3300030706|Ga0310039_10027848 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 2650 | Open in IMG/M |
3300030706|Ga0310039_10357263 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 544 | Open in IMG/M |
3300031241|Ga0265325_10160196 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae → Archangiaceae → Cystobacter → Cystobacter fuscus | 1059 | Open in IMG/M |
3300031549|Ga0318571_10300442 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 603 | Open in IMG/M |
3300031573|Ga0310915_10030896 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3343 | Open in IMG/M |
3300031680|Ga0318574_10021964 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3123 | Open in IMG/M |
3300031724|Ga0318500_10053620 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1720 | Open in IMG/M |
3300031748|Ga0318492_10050339 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1943 | Open in IMG/M |
3300031768|Ga0318509_10020950 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3058 | Open in IMG/M |
3300031777|Ga0318543_10010203 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3255 | Open in IMG/M |
3300031781|Ga0318547_10187090 | Not Available | 1232 | Open in IMG/M |
3300031793|Ga0318548_10111370 | Not Available | 1317 | Open in IMG/M |
3300031821|Ga0318567_10069439 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1859 | Open in IMG/M |
3300031880|Ga0318544_10009532 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 3027 | Open in IMG/M |
3300031893|Ga0318536_10017503 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3200 | Open in IMG/M |
3300031896|Ga0318551_10018982 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3162 | Open in IMG/M |
3300031942|Ga0310916_10036891 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3645 | Open in IMG/M |
3300031949|Ga0214473_10519338 | Not Available | 1326 | Open in IMG/M |
3300031954|Ga0306926_10962290 | Not Available | 1018 | Open in IMG/M |
3300032069|Ga0315282_10083515 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2996 | Open in IMG/M |
3300032069|Ga0315282_10301181 | Not Available | 1045 | Open in IMG/M |
3300032090|Ga0318518_10016063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 3214 | Open in IMG/M |
3300032091|Ga0318577_10437229 | Not Available | 625 | Open in IMG/M |
3300032118|Ga0315277_10832846 | Not Available | 866 | Open in IMG/M |
3300032160|Ga0311301_10239473 | All Organisms → cellular organisms → Bacteria | 3016 | Open in IMG/M |
3300032160|Ga0311301_10242342 | All Organisms → cellular organisms → Bacteria | 2991 | Open in IMG/M |
3300032160|Ga0311301_10247446 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2947 | Open in IMG/M |
3300032163|Ga0315281_10122591 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2980 | Open in IMG/M |
3300032261|Ga0306920_100106556 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 4151 | Open in IMG/M |
3300032770|Ga0335085_10038844 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 6552 | Open in IMG/M |
3300033158|Ga0335077_10393650 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1490 | Open in IMG/M |
3300033402|Ga0326728_10029387 | All Organisms → cellular organisms → Bacteria | 9432 | Open in IMG/M |
3300033402|Ga0326728_10124477 | All Organisms → cellular organisms → Bacteria | 2943 | Open in IMG/M |
3300033402|Ga0326728_10162943 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 2372 | Open in IMG/M |
3300033402|Ga0326728_10521917 | Not Available | 956 | Open in IMG/M |
3300033402|Ga0326728_11039548 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 562 | Open in IMG/M |
3300033405|Ga0326727_10136363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 2979 | Open in IMG/M |
3300033405|Ga0326727_10251662 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter | 1822 | Open in IMG/M |
3300033475|Ga0310811_10992708 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 737 | Open in IMG/M |
3300033755|Ga0371489_0134893 | All Organisms → cellular organisms → Bacteria | 1370 | Open in IMG/M |
3300033755|Ga0371489_0341922 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 706 | Open in IMG/M |
3300033827|Ga0334848_052245 | Not Available | 745 | Open in IMG/M |
3300033977|Ga0314861_0303515 | Not Available | 719 | Open in IMG/M |
3300033983|Ga0371488_0227335 | Not Available | 925 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 13.73% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 12.75% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.29% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 8.33% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 6.86% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.90% |
Peat Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil | 4.90% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 3.92% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 3.43% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.43% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.94% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 1.96% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.96% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 1.96% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 1.96% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 1.96% |
Fen | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Fen | 1.47% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 1.47% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 0.98% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.98% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.98% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 0.49% |
Groundwater | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater | 0.49% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 0.49% |
Hot Spring Sediment | Environmental → Aquatic → Thermal Springs → Sediment → Unclassified → Hot Spring Sediment | 0.49% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 0.49% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.49% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.49% |
Bog | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Bog | 0.49% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.49% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 0.49% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.49% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.49% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.49% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001356 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 | Environmental | Open in IMG/M |
3300002223 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_1.2 | Environmental | Open in IMG/M |
3300003368 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM2 | Environmental | Open in IMG/M |
3300005184 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_120 | Environmental | Open in IMG/M |
3300005540 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_146 | Environmental | Open in IMG/M |
3300005556 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 | Environmental | Open in IMG/M |
3300005712 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 | Environmental | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300006052 | Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013 | Environmental | Open in IMG/M |
3300006791 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_102 | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006865 | Hot spring sediment bacterial and archeal communities from British Columbia, Canada, to study Microbial Dark Matter (Phase II) - Larsen N4 metaG | Environmental | Open in IMG/M |
3300009012 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159 | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009137 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158 | Environmental | Open in IMG/M |
3300009518 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150 | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009547 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 | Environmental | Open in IMG/M |
3300009549 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_100 | Environmental | Open in IMG/M |
3300009617 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_100 | Environmental | Open in IMG/M |
3300009628 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10 | Environmental | Open in IMG/M |
3300009630 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_40 | Environmental | Open in IMG/M |
3300009637 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 | Environmental | Open in IMG/M |
3300009639 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 | Environmental | Open in IMG/M |
3300009640 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009764 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40 | Environmental | Open in IMG/M |
3300009839 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010341 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012532 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_80_16 metaG | Environmental | Open in IMG/M |
3300014151 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaG | Environmental | Open in IMG/M |
3300014152 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_60_metaG | Environmental | Open in IMG/M |
3300014153 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_60_metaG | Environmental | Open in IMG/M |
3300014155 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_60_metaG | Environmental | Open in IMG/M |
3300014157 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Met_20cm_2_24_1 metaG | Environmental | Open in IMG/M |
3300014158 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaG | Environmental | Open in IMG/M |
3300014162 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaG | Environmental | Open in IMG/M |
3300014164 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaG | Environmental | Open in IMG/M |
3300014491 | Permafrost microbial communities from Stordalen Mire, Sweden - 612S2D metaG | Environmental | Open in IMG/M |
3300014498 | Permafrost microbial communities from Stordalen Mire, Sweden - 812E2M metaG | Environmental | Open in IMG/M |
3300014502 | Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300014638 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaG | Environmental | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016445 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 | Environmental | Open in IMG/M |
3300017925 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_40 | Environmental | Open in IMG/M |
3300017929 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100 | Environmental | Open in IMG/M |
3300017934 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_3 | Environmental | Open in IMG/M |
3300017938 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150 | Environmental | Open in IMG/M |
3300017940 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100 | Environmental | Open in IMG/M |
3300017941 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150 | Environmental | Open in IMG/M |
3300017961 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP5_20_MG | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300017996 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_40 | Environmental | Open in IMG/M |
3300017998 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_150 | Environmental | Open in IMG/M |
3300018001 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW-S_5 | Environmental | Open in IMG/M |
3300018002 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40 | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018004 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018015 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150 | Environmental | Open in IMG/M |
3300018016 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40 | Environmental | Open in IMG/M |
3300018021 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_150 | Environmental | Open in IMG/M |
3300018025 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100 | Environmental | Open in IMG/M |
3300018026 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100 | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018088 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018431 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104 | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300019082 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40 | Environmental | Open in IMG/M |
3300019788 | Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction) | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300022526 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 10-14 | Environmental | Open in IMG/M |
3300023258 | Peat soil microbial communities from Stordalen Mire, Sweden - 717 E1 30-34 | Environmental | Open in IMG/M |
3300025311 | Groundwater microbial communities from Rifle, Colorado - Rifle CSP2_plank lowO2_0.2 (SPAdes) | Environmental | Open in IMG/M |
3300025320 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025432 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_40 (SPAdes) | Environmental | Open in IMG/M |
3300025442 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_100 (SPAdes) | Environmental | Open in IMG/M |
3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
3300025454 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 (SPAdes) | Environmental | Open in IMG/M |
3300025469 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_100 (SPAdes) | Environmental | Open in IMG/M |
3300025473 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes) | Environmental | Open in IMG/M |
3300025480 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 (SPAdes) | Environmental | Open in IMG/M |
3300025496 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes) | Environmental | Open in IMG/M |
3300025498 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 (SPAdes) | Environmental | Open in IMG/M |
3300025506 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes) | Environmental | Open in IMG/M |
3300025581 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-3 deep-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025878 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-D (SPAdes) | Environmental | Open in IMG/M |
3300026297 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 10_02_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026305 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_142 (SPAdes) | Environmental | Open in IMG/M |
3300026313 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_40cm (SPAdes) | Environmental | Open in IMG/M |
3300026329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_131 (SPAdes) | Environmental | Open in IMG/M |
3300026332 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_138 (SPAdes) | Environmental | Open in IMG/M |
3300026528 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_156 (SPAdes) | Environmental | Open in IMG/M |
3300026538 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_114 (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027825 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027879 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes) | Environmental | Open in IMG/M |
3300027905 | Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes) | Environmental | Open in IMG/M |
3300028015 | Soil microbial communities from Maridalen valley, Oslo, Norway - NSE6 | Environmental | Open in IMG/M |
3300028069 | Peat soil microbial communities from Stordalen Mire, Sweden - G.F.S.T0 | Environmental | Open in IMG/M |
3300028552 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1 | Environmental | Open in IMG/M |
3300028906 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2) | Environmental | Open in IMG/M |
3300029817 | Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25 | Environmental | Open in IMG/M |
3300030294 | II_Fen_E3 coassembly | Environmental | Open in IMG/M |
3300030706 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG (v2) | Environmental | Open in IMG/M |
3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Host-Associated | Open in IMG/M |
3300031549 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f24 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031680 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f22 | Environmental | Open in IMG/M |
3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
3300031748 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031777 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f24 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031821 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031893 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28 | Environmental | Open in IMG/M |
3300031896 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19 | Environmental | Open in IMG/M |
3300031942 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF176 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032069 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20 | Environmental | Open in IMG/M |
3300032090 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032118 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032163 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300033158 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1 | Environmental | Open in IMG/M |
3300033402 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MN | Environmental | Open in IMG/M |
3300033405 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MY | Environmental | Open in IMG/M |
3300033475 | Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YC | Environmental | Open in IMG/M |
3300033755 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fraction | Environmental | Open in IMG/M |
3300033827 | Peat soil microbial communities from Stordalen Mire, Sweden - 714 E2 5-9 | Environmental | Open in IMG/M |
3300033977 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75 | Environmental | Open in IMG/M |
3300033983 | Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB23AN SIP fraction | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12269J14319_100423654 | 3300001356 | Peatlands Soil | VLIPMKVVSDSDLIPVAGSEVKPGIFGAQRRWLSYGA* |
JGI12269J14319_100595971 | 3300001356 | Peatlands Soil | LLGIPMKVFSDSDWIPVTGSEVKLIVFGAKRRWRSYRA* |
JGI12269J14319_100664521 | 3300001356 | Peatlands Soil | VRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA* |
JGI12269J14319_100823551 | 3300001356 | Peatlands Soil | LRIPLKVISDSGLIPIAGSEVKPIIFGAKRRWRSYSA* |
C687J26845_100706051 | 3300002223 | Soil | NEENICSVLIPMKVVSDSDLNPVTGSEVKPIVFGAKRRWRSYGA* |
JGI26340J50214_100093011 | 3300003368 | Bog Forest Soil | MPKVLIPMKLVTDSDLIPGAGSDVMPVTVGAKRRWRSYGA* |
Ga0066671_100364253 | 3300005184 | Soil | LQAFDFFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA* |
Ga0066697_101511841 | 3300005540 | Soil | MKTAKFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA* |
Ga0066697_103300771 | 3300005540 | Soil | LIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA* |
Ga0066707_100287671 | 3300005556 | Soil | FLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA* |
Ga0070764_109404062 | 3300005712 | Soil | LIPMKVVSNSDLIAVTRSDAMPGTFGAKRRWRSYGA* |
Ga0066903_1007169183 | 3300005764 | Tropical Forest Soil | MLVPDVLIPMKVVSDSDLIPVAHSETMPVTVGAKRRWRSYSA* |
Ga0075029_1006046951 | 3300006052 | Watersheds | MGIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA* |
Ga0066653_103327681 | 3300006791 | Soil | LAWLVLIPIKVISDSDLIPVTDSDVKLIAFGAKRRWRSYAA* |
Ga0079221_106438424 | 3300006804 | Agricultural Soil | LATLLIPTKAVSDSDLVPGTDSDAMPVTIGAKRRWW |
Ga0073934_101623773 | 3300006865 | Hot Spring Sediment | MLIPMKVVSDSDLIPVTGSDVMPVAIGAKRRWRPYRA* |
Ga0066710_1000707125 | 3300009012 | Grasslands Soil | VLIPMKVGSDSDLIPVAGSDAMAVTVGAKRRWHSYRA |
Ga0066710_1006800231 | 3300009012 | Grasslands Soil | LQAFDFFLIPMKAVSDSYLIPVTCSDAMPVKIGAQRRWRPYRA |
Ga0099828_103224013 | 3300009089 | Vadose Zone Soil | FGRNCRKLAIPMKVVSDSDLIPVTGSDAMVVTIGAKRRWRLYGA* |
Ga0099828_119110232 | 3300009089 | Vadose Zone Soil | MSESNPFSMLIPMKVVSDSDLIAVTHSDAIPITIGAKRRWRGYRA* |
Ga0066709_1002133893 | 3300009137 | Grasslands Soil | MLIPMKVGSDSDLIPVAGSDAMAVTVGAKRRWHSYRA* |
Ga0116128_10179862 | 3300009518 | Peatland | VLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYG |
Ga0116108_10097515 | 3300009519 | Peatland | LIPMKVVSDSDLIPVAHSDAKPVTIGAKRRWRFYGA* |
Ga0116136_11095072 | 3300009547 | Peatland | MPIPMKVVDDSDLNPVGGSEVKPGVFGAQRRWRSYGA* |
Ga0116136_11109131 | 3300009547 | Peatland | MLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA* |
Ga0116137_10891831 | 3300009549 | Peatland | IPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSYSA* |
Ga0116123_10125501 | 3300009617 | Peatland | VLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA* |
Ga0116125_10455061 | 3300009628 | Peatland | LRIPMKLVSDSDLIPVTCSELKAVVFGAKRRWRSYRA* |
Ga0116114_10113594 | 3300009630 | Peatland | LRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA* |
Ga0116118_11835611 | 3300009637 | Peatland | VKVELLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWDSYGA* |
Ga0116122_11291191 | 3300009639 | Peatland | MLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYG |
Ga0116122_12221842 | 3300009639 | Peatland | VNRLLIPLKVVSDSDLIPVAASEVKPVVFGAKRRW |
Ga0116122_12544591 | 3300009639 | Peatland | MMLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSY |
Ga0116126_10120115 | 3300009640 | Peatland | LPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA* |
Ga0116110_10111181 | 3300009643 | Peatland | MKITLLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA* |
Ga0116121_11295731 | 3300009644 | Peatland | RHKLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA* |
Ga0116216_109854901 | 3300009698 | Peatlands Soil | NQVRFVLIPMKVISDSDLIPITRSDAMPIRVGAKRRWLSYRA* |
Ga0116134_11444631 | 3300009764 | Peatland | RGLDLGIPMKVVSDSDLIPVAGSEVKPGVFGAKRRWHSYRA* |
Ga0116223_108670942 | 3300009839 | Peatlands Soil | LIPMKVVSDSDLIPVAHSDAKPVTVGAKRRWRSYRA* |
Ga0134111_101299352 | 3300010329 | Grasslands Soil | MLIPMKVVSDSDLIPVTRSDAMPVTIGAQRRWRPYRA* |
Ga0074046_100179878 | 3300010339 | Bog Forest Soil | MLIPMKLVTDSDLIPGAGSDVMPVTVGAKRRWRSYGA* |
Ga0074046_100554811 | 3300010339 | Bog Forest Soil | VLIPMKLVTDSDLIPGAGSDVMPVTVGAKRRWRSYGA* |
Ga0074046_101243974 | 3300010339 | Bog Forest Soil | LIPMKLVTDSDLIPGAGSDVMPVTVGAKRRWRSYGA* |
Ga0074045_104223552 | 3300010341 | Bog Forest Soil | RIPMKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYRA* |
Ga0074044_104992513 | 3300010343 | Bog Forest Soil | MLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA* |
Ga0074044_105788701 | 3300010343 | Bog Forest Soil | VRIPMKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYRA* |
Ga0136449_1002729395 | 3300010379 | Peatlands Soil | LIPMKVISDSDLIPITRSDAMPIRVGAKRRWLSYRA* |
Ga0136449_1002979641 | 3300010379 | Peatlands Soil | RIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA* |
Ga0136449_1018393562 | 3300010379 | Peatlands Soil | AIPMKVGSASDLNPVADSEVKLGVFGAQRRWRSYGA* |
Ga0136847_132598614 | 3300010391 | Freshwater Sediment | LIPMKVVSDSDLIPVTGSEVKAVVFGAKRRWRCYRA* |
Ga0137378_111937002 | 3300012210 | Vadose Zone Soil | LIPTKVGTDSDLIPVTRSDAMPVTFGAKRRWRFYGA* |
Ga0137373_102418574 | 3300012532 | Vadose Zone Soil | GVLVLEELLIPMKVGTDSDLIPVTRSDAMAVTFEAKRRWRFYGA* |
Ga0181539_10199387 | 3300014151 | Bog | MLPIPMKVIGDSDWIRVTGSEVKLIVFGAKRRWRSYRA* |
Ga0181539_10482051 | 3300014151 | Bog | MPIPMKVIGDSDWIRVTGSEVKLIVFGAKRRWRSYRA* |
Ga0181539_11487481 | 3300014151 | Bog | MKTQREPSLLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSY |
Ga0181539_13188382 | 3300014151 | Bog | LIPLKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYSA* |
Ga0181533_10329401 | 3300014152 | Bog | PIPMKVIGDSDWIRVTGSEVKLIVFGAKRRWRSYRA* |
Ga0181533_11502332 | 3300014152 | Bog | VRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA* |
Ga0181527_10214786 | 3300014153 | Bog | MLPIPMKVIGDSDWIRVTGSEVKLIVFGAKRRWRSY |
Ga0181527_10341201 | 3300014153 | Bog | VRIPLKVISDSGLIPIAGSEMKPIVFGAKRRWRSYSA* |
Ga0181527_12695542 | 3300014153 | Bog | MMLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSYDA* |
Ga0181524_104134012 | 3300014155 | Bog | VRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWHSYGA* |
Ga0134078_101803993 | 3300014157 | Grasslands Soil | ALALLIPIKVGSDSEWIPVARSEAMLVTVGAKRRWRRYGA* |
Ga0181521_104550981 | 3300014158 | Bog | PMRIPLKVISDSGLIPIAGSEVKPIIFGAKRRWRSYSA* |
Ga0181538_100730923 | 3300014162 | Bog | PIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA* |
Ga0181532_108136822 | 3300014164 | Bog | GIPMKVVSDSDLIPVAGSEVKPGVFGAKRRWHSYRA* |
Ga0182014_100780223 | 3300014491 | Bog | SQKQENLEMLRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA* |
Ga0182019_110161552 | 3300014498 | Fen | LIPMKVIIDSDLIPVTGSEVKLIVFGAKRRWHSYRA* |
Ga0182021_102595073 | 3300014502 | Fen | LRIPMKVVGDSDLNPVAGSEVKPGVFGAKRRWRSYRA* |
Ga0181536_104581593 | 3300014638 | Bog | IPMKVVSDSDLIPVAGSEVKPGIFGAQRRWLSYGA* |
Ga0182036_100080861 | 3300016270 | Soil | VLIPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRSYSA |
Ga0182035_101209944 | 3300016341 | Soil | LIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0182035_111223691 | 3300016341 | Soil | IPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRCYGA |
Ga0182040_100844971 | 3300016387 | Soil | IPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRSYSA |
Ga0182038_104921191 | 3300016445 | Soil | VPIPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRCYGA |
Ga0187856_10777261 | 3300017925 | Peatland | MLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA |
Ga0187856_11798271 | 3300017925 | Peatland | LLLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSY |
Ga0187856_12894982 | 3300017925 | Peatland | LIPLKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYSA |
Ga0187856_12895852 | 3300017925 | Peatland | LIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA |
Ga0187849_100661210 | 3300017929 | Peatland | MLIPLKVVTDSDLIPVAASEVKPVVFGAKRRWRSYGA |
Ga0187849_12814122 | 3300017929 | Peatland | LGYSPVVGTGVLIPMKAGTDSDLMPVSDSEAMLVAIGAKRRWRSYGA |
Ga0187849_12834141 | 3300017929 | Peatland | GIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRFYGA |
Ga0187803_100032576 | 3300017934 | Freshwater Sediment | LIPMKVVSDSDLIPVTGSDAMVVTAGAKRRWRTYRA |
Ga0187803_100159994 | 3300017934 | Freshwater Sediment | VIPMKVVSDSDLIPVTHSDAMAVTVGAKRRWRSYGA |
Ga0187803_100397162 | 3300017934 | Freshwater Sediment | MVIPMKVVSDSDLIPVTHSDAMAVTVGAKRRWRSYGA |
Ga0187854_1000898613 | 3300017938 | Peatland | VQSIRRVLIPLKVVTDSDLIPVAASEVKPVVFGAKRRWRSYGA |
Ga0187853_101434972 | 3300017940 | Peatland | LIPMKVVSDSDLIPVAHSDAKPVTIGAKRRWRFYGA |
Ga0187850_100576896 | 3300017941 | Peatland | VQSIRRVLIPLKVVTDSDLIPVAASEVKPVVFGAKRRWRS |
Ga0187778_100378221 | 3300017961 | Tropical Peatland | MSRIHAGAGVLIPMMVITDSDLIPVTHSDAMPITFGAQRRWLSYRA |
Ga0187781_100876923 | 3300017972 | Tropical Peatland | LIPMKVVSDSDLIPVAHSEAMPVTVGAKRRWRSYSA |
Ga0187781_103159152 | 3300017972 | Tropical Peatland | RWPRIMLLIPMIVISDSDLIPVTRSDAMPITVGAKRRWLSHRA |
Ga0187782_113323382 | 3300017975 | Tropical Peatland | MLIPMKVDSDSDLIPVAHSDAKPVTVGAKRRWRFYGA |
Ga0187782_115792301 | 3300017975 | Tropical Peatland | MRIPMKVIGDSDMIPVTGSEVKLIVFGAKRRWHFHGA |
Ga0187891_10461573 | 3300017996 | Peatland | VLIPMKVVSDSDLIPVAHSDAKPVTIGAKRRWRFYGA |
Ga0187891_10534891 | 3300017996 | Peatland | MKTQREPSLLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSYDA |
Ga0187870_10892941 | 3300017998 | Peatland | VQSIRRVLIPLKVVTDSDLIPVAASEVKPVVFGAKRRWRSY |
Ga0187815_100802832 | 3300018001 | Freshwater Sediment | VAEKRHFQPQVKLLGIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA |
Ga0187868_12666141 | 3300018002 | Peatland | LRIPMKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYRA |
Ga0187868_12715091 | 3300018002 | Peatland | VLIPLKVVSDSDLIPVAGSEVKPGVFGAKRRWRSYSA |
Ga0187876_11080721 | 3300018003 | Peatland | VLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA |
Ga0187865_10141946 | 3300018004 | Peatland | PFLLIPMKVVSNSDLIPVTHSEAMPVVIGAKRRWRRYGA |
Ga0187888_10066248 | 3300018008 | Peatland | VLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSY |
Ga0187888_11528952 | 3300018008 | Peatland | MMLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRSYDA |
Ga0187866_10195495 | 3300018015 | Peatland | LLAKSLVRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA |
Ga0187880_10289802 | 3300018016 | Peatland | MMTLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA |
Ga0187880_10781783 | 3300018016 | Peatland | WTVLIPMKVIGNSDLVPVTGSEVKRIVFGAKRRWRSYRA |
Ga0187882_13660452 | 3300018021 | Peatland | LIPLKVVTDSDLIPVAASEVKPVVFGAKRRWRSYSA |
Ga0187885_100240141 | 3300018025 | Peatland | LLLIPMKVVSDSDLIPVAHSDAKPVTIGAKRRWRFYGA |
Ga0187857_102341102 | 3300018026 | Peatland | LLIPMKVVSDSDLIPVAHSDAKPVTIGAKRRWRFYGA |
Ga0187867_106973572 | 3300018033 | Peatland | VPVRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA |
Ga0187784_107259982 | 3300018062 | Tropical Peatland | TYSTFSLYLLIPLKVGSDSDFNPVTGSGVKLGVFGAQRRWHSYRA |
Ga0187771_105135991 | 3300018088 | Tropical Peatland | VLIPMIVISDSDLIPVTHSDAMLITVGAKRRWLFHRA |
Ga0187770_100403461 | 3300018090 | Tropical Peatland | LRIPLKVGGDSDLNPVTGSGAKPGVFGAQRRWRSYGA |
Ga0066655_100236584 | 3300018431 | Grasslands Soil | LIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA |
Ga0066667_113883862 | 3300018433 | Grasslands Soil | LIPMKVGSDSDLIPVAGSDAMAVTVGAKRRWHSYRA |
Ga0187852_10252681 | 3300019082 | Peatland | NIPHLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA |
Ga0187852_10912101 | 3300019082 | Peatland | MKTQREPSLLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWRS |
Ga0182028_10812142 | 3300019788 | Fen | TTFSAYYEYLRIPMKMIGDSDWIPVTGSEMKLMVFGAKRRWHSYPA |
Ga0210384_101626383 | 3300021432 | Soil | MGIPMKVVSDSDLIPITGSEVKLIVFGAKRRWRSYRA |
Ga0224533_10200163 | 3300022526 | Soil | DFTGAMRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA |
Ga0224535_10136491 | 3300023258 | Soil | PVLIPMKVIIDSDLIPVTGSEVKLIVFGAKRRWHSYRA |
Ga0209343_100288901 | 3300025311 | Groundwater | VLLLIPMKVVSDSDLNPVTGSEVKPIVFGAKRRWRSYGA |
Ga0209171_100328931 | 3300025320 | Iron-Sulfur Acid Spring | AKMPMLIPMKVVGDSDLIPVTGSEVKLIVFGAKRRWRSYGA |
Ga0208821_10277291 | 3300025432 | Peatland | VLAIPVKVGSDSDLNPVGGSEVKPGVFGAQRRWRSYGA |
Ga0208034_10400011 | 3300025442 | Peatland | GIPVKVVSDSDLIPVTCSEVKAVVFGAKRRWHFYRA |
Ga0208455_10565372 | 3300025453 | Peatland | GFLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA |
Ga0208039_10096951 | 3300025454 | Peatland | LVGYRSSQMLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA |
Ga0208687_10134321 | 3300025469 | Peatland | MLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSY |
Ga0208190_10109911 | 3300025473 | Peatland | LLSVLSEFVRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA |
Ga0208688_10082011 | 3300025480 | Peatland | LVLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA |
Ga0208191_10403611 | 3300025496 | Peatland | VLLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYG |
Ga0208819_10116471 | 3300025498 | Peatland | LRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA |
Ga0208937_10395142 | 3300025506 | Peatland | MFEGEVLIPLKVVSDSDLIPVAVSEVKPVVFGAKRRWRSYGA |
Ga0208355_10190671 | 3300025581 | Arctic Peat Soil | FSGPQPLRIPMKVISDSDLIPVTCSEVKAVVFGGKRRWRSYGA |
Ga0209584_100462173 | 3300025878 | Arctic Peat Soil | MPGPFENTLRIPMKVISDSDWIPVTGSEVKLIVFGAKRRWRSYRA |
Ga0209237_10302191 | 3300026297 | Grasslands Soil | DQRTSCMLIPMKVVSDSDLIPGTDSDAMPVTIGAQRRW |
Ga0209688_10022852 | 3300026305 | Soil | LQAFDFFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA |
Ga0209761_11347832 | 3300026313 | Grasslands Soil | WIMRMSSRVMLIPMKVVSDSDLIPGTDSDAMPVTIGAQRRW |
Ga0209375_10288744 | 3300026329 | Soil | MFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA |
Ga0209803_11041271 | 3300026332 | Soil | AITPGVLIPMKVVSDSDLIPGTDSDAMPVTIGAQRRW |
Ga0209378_10270371 | 3300026528 | Soil | MKTAKFLIPMKAVSDSDLIPVTRSDAMPVKIGAQRRWRPYRA |
Ga0209056_101917381 | 3300026538 | Soil | RFGSQVLIPMKVGSDSDLIPVAGSDAMAVTVGAKRRWHSYRA |
Ga0208827_10180633 | 3300027641 | Peatlands Soil | REEIEPLGIPMKVFSDSDWIPVTGSEVKLIVFGAKRRWRSYRA |
Ga0209039_100252191 | 3300027825 | Bog Forest Soil | MPKVLIPMKLVTDSDLIPGAGSDVMPVTVGAKRRW |
Ga0209039_100631314 | 3300027825 | Bog Forest Soil | LIPMKLVTDSDLIPGAGSDVMPVTVGAKRRWRSYGA |
Ga0209039_102457801 | 3300027825 | Bog Forest Soil | RQFHCQMLIPLKVVSDSDLIPVAASEVKPVVFGAKRRWHSYGA |
Ga0209517_100384025 | 3300027854 | Peatlands Soil | LVGLGWLRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA |
Ga0209517_100513204 | 3300027854 | Peatlands Soil | HPLDMDMGIPMKVFSDSDWIPVTGSEVKLIVFGAKRRWRSYRA |
Ga0209517_101118371 | 3300027854 | Peatlands Soil | MNIVLLIPMKVVSDSDLIPVAGSEVKPGIFGAQRRWLSYGA |
Ga0209517_101188661 | 3300027854 | Peatlands Soil | HPLGLEEKVLIPMKVISDSDLIPITRSDAMPIRVGAKRRWLSYRA |
Ga0209517_102644252 | 3300027854 | Peatlands Soil | SLANLLIPMKVIIDSDLIPVTGSEVKLIVFGAKRRWRSYRA |
Ga0209169_106344812 | 3300027879 | Soil | ARMRIPMKVVSDSDLILVTCSEVKVVVFGAKRRWRSYRA |
Ga0209415_101732251 | 3300027905 | Peatlands Soil | VSLQHVLAIPMKVGSASDLNPVADSEVKLGVFGAQRRWRSYGA |
Ga0265353_10352931 | 3300028015 | Soil | RIPMKLVSDSDLIPVTCSELKAVVFGAKRRWRSYRA |
Ga0255358_10613431 | 3300028069 | Soil | GLRIPMKVVSDFDLIPVTGSEVKPIIFGAKRRWRPYRA |
Ga0302149_10222524 | 3300028552 | Bog | TLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA |
Ga0308309_108681791 | 3300028906 | Soil | LRIPMKVVSDSDLILVTCSEVKVVVFGAKRRWRSYRA |
Ga0247275_10108861 | 3300029817 | Soil | CWLWLLIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA |
Ga0247275_10126251 | 3300029817 | Soil | VAGFLPIPMKVVDDSDLNPVAGSEVKPGVFGAKRRWRSYPA |
Ga0311349_119011531 | 3300030294 | Fen | WKHNPGMLIPMKVIIDSDMIPVTGSEVKLIVFGAKRRWRSYRA |
Ga0310039_100278483 | 3300030706 | Peatlands Soil | PLVGIPMKVFSDSDWIPVTGSEVKLIVFGAKRRWRSYRA |
Ga0310039_103572632 | 3300030706 | Peatlands Soil | CSSRIRMALRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA |
Ga0265325_101601961 | 3300031241 | Rhizosphere | RIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA |
Ga0318571_103004423 | 3300031549 | Soil | IPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0310915_100308961 | 3300031573 | Soil | MLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318574_100219643 | 3300031680 | Soil | VLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318500_100536201 | 3300031724 | Soil | SNSGVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318492_100503393 | 3300031748 | Soil | RAPVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318509_100209501 | 3300031768 | Soil | CLLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318543_100102033 | 3300031777 | Soil | MLRLIRSKLLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318547_101870901 | 3300031781 | Soil | GILLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318548_101113702 | 3300031793 | Soil | LKFLLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318567_100694393 | 3300031821 | Soil | PVILMMLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318544_100095323 | 3300031880 | Soil | MQRIFSAVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318536_100175031 | 3300031893 | Soil | GTPPLDVLIPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRSYSA |
Ga0318551_100189821 | 3300031896 | Soil | SVYRFARKMLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0310916_100368911 | 3300031942 | Soil | LWVVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0214473_105193383 | 3300031949 | Soil | MLIPMKVVSDSDLIPVTRSDAMLVTIGAKRRWRRYGA |
Ga0306926_109622901 | 3300031954 | Soil | SFISKVPIPMKVVSDSDLIPVTHSDAKPVTVGAKRR |
Ga0315282_100835154 | 3300032069 | Sediment | SFAAESHQKAALLIPMKVIRDSDLIPVTGSEVKPIVFGAKRRWRSNGA |
Ga0315282_103011811 | 3300032069 | Sediment | LLVGIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA |
Ga0318518_100160631 | 3300032090 | Soil | RMLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0318577_104372292 | 3300032091 | Soil | MVLIPMKVVSDSDLIPVTHSDAKPVTVGAKRRWRSYSA |
Ga0315277_108328462 | 3300032118 | Sediment | ADDAQASLLLIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA |
Ga0311301_102394731 | 3300032160 | Peatlands Soil | NQVRFVLIPMKVISDSDLIPITRSDAMPIRVGAKRRWLSYRA |
Ga0311301_102423425 | 3300032160 | Peatlands Soil | VPCGRLLIPMKVVSDSDLIPVAGSEVKPGIFGAQRRWLSYGA |
Ga0311301_102474461 | 3300032160 | Peatlands Soil | ALRIPMKVDSDSDLIPVTCSEVKAVVFGAKRRWRSYGA |
Ga0315281_101225911 | 3300032163 | Sediment | TSVGLLIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA |
Ga0306920_1001065561 | 3300032261 | Soil | LVPREVGVLIPMKVVGDSDLIPVAHSETMPVTVGAKRRWRSYSA |
Ga0335085_100388446 | 3300032770 | Soil | GIPMKVFSDSDWIPVTGSEVKLIVFGAKRRWRSYRA |
Ga0335077_103936501 | 3300033158 | Soil | AGNRRVLIPMIVISDSDLIPVTHSDAMPIRVGAKRRWLSHRA |
Ga0326728_1002938712 | 3300033402 | Peat Soil | RIPLKVISDSGLIPIAGSEVKPIVFGAKRRWRSYSA |
Ga0326728_101244771 | 3300033402 | Peat Soil | GIPLKVGSDSDLNPVAGSEVKPGVFGAKRRWRSYGA |
Ga0326728_101629431 | 3300033402 | Peat Soil | LGQRQIARMHIPLKVISDSGLIPIAGSEVKPIVFGAKRRWRSYSA |
Ga0326728_105219172 | 3300033402 | Peat Soil | KDKAYLKIMGIPMKVVSDSDLISVTCSEVKAVVFGAKRRWPSYRA |
Ga0326728_110395482 | 3300033402 | Peat Soil | LIPLKVVSDSDLIPVAVSEVKPGVFGAQRRWRSYGA |
Ga0326727_101363634 | 3300033405 | Peat Soil | KLRLRLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYGA |
Ga0326727_102516621 | 3300033405 | Peat Soil | VQLRIPMKVVSDSDLIPVTCSEVKAVVFGAKRRWRSYRA |
Ga0310811_109927081 | 3300033475 | Soil | NSTFNAVFADLLLIPMKVVSDSDLIPVTGSGVKPIIFGAKRRWRCYRA |
Ga0371489_0134893_1243_1356 | 3300033755 | Peat Soil | MLIPLKVVSDSDLIPVAVSEVKPGVFGAQRRWRSYGA |
Ga0371489_0341922_230_343 | 3300033755 | Peat Soil | MRIPLKVISDSGLIPIAGSEVKPIVFGAKRRWRSYSA |
Ga0334848_052245_2_109 | 3300033827 | Soil | IPMKVIIDSDLIPVTGSEVKLIVFGAKRRWHSYRA |
Ga0314861_0303515_148_270 | 3300033977 | Peatland | VRKLLIPMKVVSDSDLIPVAHSDAKPVTVGAKRRWRSYGA |
Ga0371488_0227335_17_148 | 3300033983 | Peat Soil | MHQDALLRIPMKVVSDSDLIPVTGSEVKAVVFGAKRRWRSYRA |
⦗Top⦘ |